3RTQA

Structure of the mouse cd1d-hs44-inkt tcr complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
273
structure length
268
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural and functional characterization of a novel nonglycosidic type I NKT agonist with immunomodulatory properties.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 74
structure length 268
sequence length 273
ec nomenclature
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rtqA01
3PP4H 5E7FA 2GK0A 4PJFE 3EJYC 1JTPA 4I2XA 3ULVC 3RY6C 4LVOB 3HZKA 3UJIL 1WBZA 3MRBA 3C60B 1KJ3H 3BZ4A 3PE9A 1W0VA 4RX4A 2Y36H 1CT8A 2NY2D 3GGWA 4XPFL 2NY3C 3I6GA 5KS9F 2VMFA 1A6WL 3QPQC 3TV3L 1NC2A 4H20H 1QFPA 2NY1D 1QRNE 3MR9B 4ZUUB 4IHOA 4QRQB 3SPVA 3BUYB 4XPBH 5I8EA 1NKOA 2VR9A 3ILQC 3S96A 1F58H 3BXNB 2OI9A 1PKQB 2YUXA 3BO8B 3D18B 3FB8A 1MFBH 3NCMA 3IF1A 1JPFA 3T0EC 4NFDA 3NCYP 1WLHA 2DQCL 3W2DL 3EGSB 3Q1SL 4LCWB 2X4OA 1AXTH 4MNGE 5L2JB 2ITDB 4HZAA 3MGAA 2D3VA 4K3EH 2X1PA 4QY8A 5DWUL 1PLGL 4OM0L 3U9PH 3BN9D 3ESVF 2EYRA 3CSYA 1BD2E 4LRNL 4ZAKB 3PWUB 1QPPA 1Y18A 4JHAL 1R5VA 2VITA 4YBLC 5LGKA 4K94H 1LQVA 3HE7A 3N9GL 3BD4A 2HT2D 5DI8A 4OT1H 4X6CE 2X4PA 3DVIA 4TVPH 4GOSA 1KLGB 4IDLA 5FKAA 1YEHL 3EOAB 3NMEA 3SO5A 3RGVD 5GRJL 3WXWH 4RFNC 3VDAA 1IQWL 2PW2A 3ARGA 3K8LA 3QDJD 1ZT1A 1OGAA 2HJLB 1XZ0A 4OUOA 3R1GL 4U6YA 1P6AB 2VDPL 4Z7UB 4MQXD 4NO0A 5MHSD 1G7HA 1RURH 5SWQB 4EBQL 1D3CA 7CGTA 5EZOL 2CUMA 4DN3H 5LGJA 4YK4C 1JPSL 3SDCB 1M4KA 3LHPH 3DVGB 4G6AC 4FXKA 1I85C 4JB9H 4YXLL 4M93B 2FWOB 1UZ8B 1ZHLB 4H5SA 4G8FB 1I1FA 2DICA 3O4OB 4XT1C 4OGYH 1WZ1H 1ACYH 3BRFA 3I75B 1A4JB 1NDMA 2CMRL 4ZPTB 3STLA 4NHUB 4R7DB 4HF5L 5F8QC 3P73B 1OLZA 4UTBH 4APQD 5BXFB 2EE9A 4TPRL 1GPOH 2VZOA 4XAWL 3UC0H 4LLYB 3MC0A 1PG7H 3QCVH 4AEIL 1C5DA 4ODBD 4OGXH 2RB8A 1KCLA 4HIJA 3F7YB 4MS8D 2NY5L 4J8RA 3ULUF 5BV7L 1LEIA 3IS0X 1J0HA 1JF5A 3G5YA 1FC1A 1KN4H 1YNKH 5DUBB 4Y16B 2AW2A 4S1RL 1T6VN 1M71B 4QRRE 3V5HA 1AR1D 2CK0H 1WUNT 4NQSB 5JXEA 2W60A 5EUKB 5GGRA 5IM7B 5B3JF 3PWPD 2W9EL 5C0CE 4LSSL 4J2XA 1S5HB 1T6WA 2BC4A 3CMOH 3V5DA 2HLAA 1EO7A 3BSZH 4PTTB 5CGYD 4U1LB 3EOYG 4XNYL 2Z8SA 3MJ9H 2ZSVB 2ESVB 3RWJB 5HVHB 2H8PA 3CU7A 5GZNC 1QFUH 1LP9F 2OJEA 5TDOB 1FSKB 4DZBA 2OP4H 2AJUL 1IGTA 2ORBL 4PPTA 2J8OA 3SDAD 2DI9A 5JLZA 4MNHA 5ADPL 4EN3B 2BMKA 4YHOL 1IAKA 1ITCA 5D1ZA 2C26A 2D7TH 1E4WH 5KSBF 4YX2L 5FXCH 2BNRE 2ZUQC 1SBSL 1RUPH 2G75A 1T83C 5CEZL 3ZHLA 4ETYA 5FK9B 1S7UA 4U7MA 5I18L 3UTZA 5GHWL 1F6FB 1PKQE 1IFHL 1DUZB 1CFVH 4KUZH 3VGDA 1OTTD 4PLNC 1G6RB 4IRJA 3ULUD 3JWDC 1ORQB 1VGKA 3G5ZB 3DX9B 3GMPB 4QHUA 5KVDL 3FHAA 3G5VB 1JGDA 4GH7B 2DQEL 3I6LE 4L3ED 4P4RA 12E8L 4HXBL 4D9QE 3WNNA 2Q20A 2VZVA 2YD4A 4KK5C 1NGXA 3JWOH 4OF7A 5CGMA 1PEZA 4LU5H 1EEZA 2GTZB 5DEFA 5A16A 3UDWA 5C1MB 2UVEA 2QV2A 2J1KA 2NPLX 4WFED 2GFBA 3ERYA 2GJZA 1YEIL 5D6DC 5IB2A 5JIKA 1QUNA 5EO1A 5I17B 3QJHA 3WYRA 5ICXB 2N56A 1JBJA 4AEHL 2DQIH 1KPVB 2VXTL 4PRID 3NCCB 1Z9LA 3TH3T 2ZOKB 4YJZL 5F7HA 4AIZB 4Z7UE 3RDTD 3S3SA 4M6OL 2AI0H 4YDLB 4PV8B 3C6LD 2V17H 1NMBH 2RGSA 4PGDA 4MMXC 3D48R 1CTNA 2MQ0A 1Q9KA 3EJJX 3FAXA 5DJAB 1BZ7A 2NW2A 5IG7B 3WEXB 2BFVL 4O58L 5GS3A 1X44A 3S5LG 2I60H 4LMQE 2PYED 5IFAL 3IU4H 2RCSH 1HKFA 4U3XA 1TJIL 4BZ1L 1OARH 2J6EH 1IC5H 2N7AA 5I0DA 4NHUE 3H9SE 2H32B 3OX8A 2XQBL 4CVUA 4R2GD 1LK2A 3DUSA 5E5MA 3WE6B 3VRIA 5A2FA 5DMJB 5DHVB 3KNBB 4JY4A 2DDQH 5DD0L 4ELKA 1G6RL 2Q76A 3ROOB 3RL2A 4JRYA 3GJFH 2AJXL 2ZCHL 2P8PB 1F8TL 2V7NB 1DQDL 4NGHH 4UT7L 3WIFA 3VG9B 5KVMC 2HWZL 4UNUA 2HTKC 2ZJSH 3QIUA 1C8PA 3CFCH 3GSQA 1CDUA 1XGRB 2BVQA 2EE6A 2EH8L 3HNSL 2IPTL 2XN9A 4FP8H 1BBJA 4YXKL 1KTKE 3MRGA 3VI4E 3P2TA 3HMXL 3HR6A 3ARDC 5JHDD 1G7JA 4C83A 1G7PB 4Y2DB 1FFOA 4UUJB 4XVJH 3D5OF 4NQUA 3MNZB 4NN5C 2JJSA 1DL7H 2R1YA 5E08L 1XMWA 5F1IB 3EO0A 4Z77A 5F3BB 3RPIA 3ARVA 5CEYA 4OLXL 4FQXB 4U6VH 2P5EA 1KTRL 5MENB 2ARJB 2PW1B 3LKNA 5D1XD 2DQTL 5DJCB 1EAPA 1RZIB 4LLVA 2ILLA 3R8QA 4L3CB 2Y4SA 1FL3A 3GIZH 4H0IA 2EXYC 3B5HA 4ELMB 3WUWB 4OFKA 1CD8A 1CQYA 4LVOC 5F7YC 3ARBD 4FFZH 1AO7D 3KPNB 1OW0A 3AXLB 4D9RD 3V7MA 1IEBA 4XMKH 5IW6A 2OTWA 2ITCB 3TYFA 1V7NH 3KWWB 3KPMA 4CDGC 3QISA 4HUXB 3B8YA 2YD3A 3O6FA 5E4EB 4JJ5B 1T21A 3PP3K 2AV7B 2OJZL 4Q9QH 3FO0L 1NCWL 2FYYB 3L5WB 4KJWD 4YDJA 1F4WH 2NY5C 5BV7C 3EYVB 2Q7NA 1NGQL 2CDFB 1UEYA 3IFLH 3SDXE 5D7IF 1HWGB 3P9WB 2YUWA 3D3VE 3MRRA 3GBMH 5JMRA 1S7TB 3O2DH 3E2HA 2EIBA 5IROC 1RU9H 1FE8L 2N7BA 1TQCB 3P0YL 2QADD 3QO0A 4ZAKC 2OYPA 4ZPVB 3SOBH 5DURB 2IADA 2A0LC 3RIAK 2DQJH 3PV6B 4JKWA 3VDBA 3S36L 3BMVA 4XRCB 4ZSOA 1S7VB 1XF3B 3ARWA 1QHOA 2XZQH 5EIQA 2ZPKH 3DURB 3I3EA 1DBBL 3FQNB 3CH1A 5IVXA 1MIEH 4G8IA 3WFBL 3EIFA 1KIPB 1UM6L 1AIFA 2CLVB 3CFEB 4HPOH 4QKXB 3KPQB 3TN0D 2CJUH 2I07A 2RBLA 5HI3C 2VLLB 5DMIL 5HHMA 1QA9A 4KV5E 4HFUL 4XCEA 3W39B 4R4ND 3D9AH 4MGXA 3VMOA 3SHSA 2Q8BH 3DIFA 3K7UA 4GRLD 3WL9B 3WIIL 4JFPB 3SDCC 1FNFA 4OCYL 4ZXBA 4NNPL 1MJ7L 1ND0B 4PRPB 5IFHL 4M93C 2Y07H 3LV3B 5EWIL 3NIGE 4WFFE 4P2QD 1AE6H 3VE0B 4ODSH 5GJTL 1YN6B 4XCCL 3Q48A 1UB5B 3O4OC 1KELH 3L3IB 3QUYD 5D7LE 3O9WD 3REWA 1T0MA 4MJ4A 5KZCD 3QAZB 3TBWB 3RVXC 3PP4L 4R9HA 4DVBA 3PGFH 2P5WA 2K3TA 3HG1D 1U8OB 1T1YA 2R2CA 4N8VA 2VH5H 5K59E 2HFEB 2NW3B 4Z76A 1KJ3L 4U6HB 2Y36L 1K2DB 1KIQB 2ICEB 3K3QA 3VFPA 4H20L 4Y16C 5DK3A 7FABH 1T0NA 3CH8A 4DKAA 1ZSDA 1II4E 4X7CC 4F15B 2XI9A 3OJDB 5E0QA 2JB5H 2CUHA 5DRWA 4HMDA 4WV1B 4XVTH 2B4CH 2HG5B 3F5WB 5HPMB 5CHNA 4XHJD 3SKJH 1CFBA 4MD0A 1YZZA 3BZEB 5HVHC 3QXWA 4B7IA 2LAAA 4I4WB 3A6OA 1FSKC 4L4JA 4I77H 4EI5B 4L3AA 4N68A 3PIQA 1EV2E 3RZWA 4EN3C 4RNRB 3MOAL 5DXWA 5GSRA 2HRLA 3ZSSA 3W0WB 5I16A 4QGYA 2X70B 4NZRH 3UJTL 4PY8I 2UZIL 1QLRA 1N2RA 5EN2B 2GSIB 3EO1A 4XVUD 3HB3C 1EBAA 3HI1B 2MCPH 1FVEB 1LE5B 5GGQH 4GUPA 3WXWL 4LSRH 3QQ9D 4Q9CA 1SJEB 2FEEL 3D2UA 2E3VA 2HRPL 1JHTA 3JTTA 5T5FH 5TF1L 3B3IB 3IYLW 2EDYA 2VLME 4GRMA 2H26A 5ESAA 4LSTL 2G2RB 3VXSD 4LAJH 1M7IB 4DN3L 4BUGA 4M43H 1F4YH 5CP3H 1AXIB 1R3HB 4QXGL 4NZUH 4MA1B 2H41A 3LHPL 2XZZA 1AC6A 4X4ZA 4G8GD 4O9HH 3M8OH 4O2EA 4A2MA 3DYPA 4YFLF 3C5ZB 2CKBH 2H3NB 4UU9B 3FRUB 3DV6A 4LSDA 4OGYL 1WZ1L 3KXFB 1Q38A 1ACYL 3NPZB 2FX8H 1AGCB 1XR9B 3F7QA 1KCUH 4GRWF 1KPUB 5L88L 3V6OE 1UWXK 5ISZD 1JPGA 3MX0A 4UTBL 5K93A 3L3OA 5GGVL 2GK0B 3RVWC 1A7QL 3UC0L 1JYWA 4I2XB 3QCVL 4JN1L 3VFMA 2L4OA 3HZKB 4OGXL 1NLDH 1WBZB 3MRBB 3BZ4B 1W0VB 3BZFA 4YDLC 1CT8B 3GGWB 1SEQL 1P4LA 3I6GB 1KN4L 1YNKL 1R3IH 3K2UL 4MAUL 1NC2B 3DRTA 2NY6B 5F97E 4PRPE 1M1SA 4IHOB 4OD1H 3SPVB 5KW9H 4NN7B 5I8EB 1AH1A 3S96B 2OI9B 3FB8B 3IF1B 3WBDA 1JPFB 4CKVX 3CMOL 3BYTA 3EBAA 4RAHA 3DUUA 4YUEH 4NKOA 3BSZL 2X4OB 3ARYA 2YPLA 4N0FA 4XPAL 1QNZH 4I0PA 4X5LA 1ZK9A 4ZMAT 4G9FE 5E2WH 1LO5B 4KJPD 2EYRB 3CSYB 2CR6A 2QQQA 1UZ6E 3BP4A 3MRHB 3O2VH 1JHLL 1Y18B 4QTHA 5LXGH 1R5VB 2D7TL 1E4WL 2WMPA 4OTXH 2VITB 1I8LA 1BQHG 3A67L 3SDDD 3QO1A 3QR2A 3VG9C 3HE7B 5DRZA 1OAXL 2EDHA 5AUMA 2VDOH 3QWQB 4Z7QF 2V7HA 5DI8B 1CFVL 1D6VH 4KUZL 1N4XH 2X4PB 2AP2A 4YLQT 2A1WL 2XKNB 2FBJL 5FKAB 5CD5D 1YPZF 4KKAC 2XA8H 1QFHA 4N9OB 4PJ5A 3EOBA 3DETD 2YC1A 2PW2B 3ARGB 3WHE1 3D69A 4Y2DC 1ZT1B 1OGAB 3B9KD 4XPGH 1XZ0B 4U6YB 1V5JA 2YA0A 4NO0B 1WIPA 2JJUA 3TWCL 5DF0A 1HXYA 5SV4A 3RWIA 1NCUA 3QCTL 3JWOL 4WI3A 5EORH 2W9DL 5LGJB 1D6EA 4FQXC 3W0WE 1UH3A 1NUFA 4U31A 1JGEA 5CS7A 4FXKB 1D9KD 1CGXA 4HWUA 3P4MA 1I1FB 5IVZA 1RJZA 2YWYA 5DK0A 3SGKA 3V52L 3G5XA 1CGVA 3BJ91 2DQGL 3OHXB 4QTIH 3PQYD 2YD2A 3STLB 3EFDH 2DQIL 4BQ8A 3HS0B 4HQQH 3CDGA 4Z7OF 2X6MA 1MCSA 4ZYKA 3AREA 1FPTL 5CCKH 2AI0L 1C5DB 3MLRH 1E6JH 4HJ0C 4XBGA 5IEHB 5EIIA 1NMBL 1CXEA 4HIJB 2FO4A 4J8RB 4NKIL 1LEIB 3G5YB 1U42A 5E4EC 1PX3A 1CFSA 1NBVL 2F58H 1YJDH 5KVEL 2C9AA 3C2AL 2QL1A 3S34H 5T1DH 2W60B 1DQJA 4JQIH 5GGRB 3F7RA 1OARL 2J6EL 2BC4B 1F3RB 3PWJA 2CLRA 3V5DB 2HLAB 4QXUH 3JXAA 4YHYC 3TPUA 3U7YL 3N1GC 2H8PB 5J56B 3S6CA 5FEBA 4M9PA 4Y4HD 2OJEB 2UUDK 4HH9A 1TQCC 3FN0H 4RGOL 4DZBB 2DDQL 1IGTB 1AJ7H 3ARPA 2Q3ZA 5JLZB 4MNHB 1C5CH 3V95A 1T04A 2BMKB 2LTQB 1NFDE 4ZO7A 1IAKB 5D1ZB 3S88L 1U92A 1SY6A 1GHFL 4YWGH 3IDUA 2G75B 3CFCL 1S7UB 5IFJA 3UTZB 4KI5F 3V6OC 1M6OA 4ZUTA 3KLHC 5L6YH 3QDGA 5B4MD 3RPKA 4S0UC 4FP8L 1PEWA 2OZ4A 3WHXA 1KCGC 1BFSA 4G6FB 5SWSA 1IT9H 4IRJB 1FHGA 3TIDA 2A83B 4NWTH 2FLBT 3WHE0 1CXKA 3OBAA 1VGKB 4XP5H 4QXTA 4XVJL 4PJIA 1W72A 4ZUWA 3MBED 4P4RB 5AG9A 1U58A 1DL7L 4ZD3L 2CK2A 1NGXB 4KVNH 4U6VL 3U0PA 1NGYA 4KK8D 1EEZB 5DEFB 2R1WB 4X8XA 5A16B 1HQRA 3UYPA 4POYA 4POZC 2GFBB 2GJZB 3BT2L 4F2MA 5IB2B 3ZTJG 3TJHA 3GIZL 1H8NA 3QAZC 1LK3L 5EO1B 3N50A 4ZNCD 4IM8A 2AXHA 4U49A 3MTRA 3LIZH 3O4LD 3ZT6A 3EYFA 3C9NA 1O5DT 4JFFD 2ZG1A 2PCPA 1OGTA 3B2UC 1AGEA 2B1AL 1OGAE 2X41A 1NCTA 1CICD 4XMKL 5FYJE 1V7NL 4G3YH 4H25A 4KI5D 4W4OA 3R06A 5J4MA 1YMHA 1NH6A 3PGDA 4G9DB 4PGDB 4BSJA 4OZHF 4EDWH 4F15C 1JTTA 3LH2H 4K71B 4OQTH 1SYVA 1QOKA 4OF6A 1BZ7B 1FYTA 4Q9QL 2NW2B 5D93B 4MJID 1F4WL 1SM3L 1VEOA 4R97C 3AS3A 4KTEH 5ICZA 2R2HA 2J5LB 3L5HA 1KGCD 3GBML 2E7MA 3OX8B 3UX9B 1LK2B 1MHHA 3DUSB 5E5MB 5KVFL 1RU9L 2WV3A 3VRIB 4FQLL 4LBEA 3FZUD 4JY4B 4JFEE 1WVZA 1EUUA 2D7QA 5DFVC 4ELKB 5C3LD 1A02N 4KVCL 3GSXA 2Q76B 2EH7H 4KDTA 3RL2B 1VESA 2ZPKL 4JRYB 1DBAL 2MMXA 3UTTA 5F70A 3CVHH 5E6YA 5JPMA 2K7PA 4PJXF 1WBYA 5JDJA 3WIFB 1MIEL 3DJ9A 4NP4H 3QIUB 4ZFGH 3T3MF 3GSQB 35C8L 2VQ1A 4HPOL 1BAFH 5DK2A 3EDEA 4R4BA 4Y2OA 2XN9B 1BBJB 2BNQD 3IFNL 5D2NA 5H35A 1CBVL 1CD1A 1NCBH 2CDGA 4RFEA 4LSPH 1HHGA 3FQRA 4LPWA 3VXPA 1G7JB 5L2KD 3H2WA 4C83B 5F1NA 2VN7A 3D9AL 2Q8BL 1FFOB 2FD6H 1OAYL 4YGVA 2BVTA 3SY0A 2D31A 3S98A 2AJVL 2R1YB 4YE4H 4MA1C 3EO0B 4MJ5B 4Z77B 3RPIB 1CTOA 2CGRH 2FB4H 5FHAH 3ZKQD 1AE6L 4M3JA 2P5EB 4ODSL 2DTML 1FO0H 3C5ZC 4MB5A 3GSNH 4YBQC 3D25A 2IBZX 3LKNB 1I9JL 1IGIH 2R69L 3DPBA 1YMMD 5I1LB 1EAPB 4Q74A 1N6VA 3TO2A 4LLVB 5KG9A 3JWOC 4G6KH 3GEWB 4UAOB 3TT1L 1FL3B 2AEPH 2KUTA 3PGFL 4PJFF 3ARRA 4GLRI 1MFDH 8FABB 3KYAA 1FZMA 5BMFH 3HC4H 2H2SD 2BZDA 3MV7A 5EC1A 1IEBB 3QNYA 2B1HH 7FABL 3WNLA 2OTWB 1G0DA 3TYFB 5ALBH 2NY6C 3KPMB 4AH2A 2RJMA 3O6FB 1LEKA 1T21B 2FJHA 4JZJA 2B4CL 1JYVA 4QWWC 1P84J 5E2VH 4YDJB 3SKJL 1U6AH 4WRLA 2Z8RA 1YEFH 4PLKD 3MRRB 1RHHA 3B9EA 3CLEH 3E2HB 3MSPA 4LSQL 2A2QT 4P2RD 3QO0B 4UINL 3DI2B 1LDPH 1CVRA 2IADB 3P0VH 3UP1A 3B2VL 5F7DA 43CAA 1JGVH 4ZSOB 3T0WA 1ZHKA 3HE7C 4YHMH 5GGTH 2FECI 1S7XA 1A64A 4K07A 1LO0H 5EDXA 4LIQE 5E70A 3CH1B 5IVXB 2FSEA 5ELIA 1CCZA 4G8IB 2MCPL 3PNWA 2NXZD 2XQYK 4GBXD 4PLJC 1AIFB 4LSRL 4TQEH 2ZCLL 1T80A 4M8QB 1QRND 1FNGA 1EUTA 5T5FL 2I07B 2NX5E 3ARGC 4WW1A 5HHMB 5F1OB 5DQJA 1QA9B 3MV8E 4XCEB 1F4YL 4PG2A 3DIFB 4U1MA 4O2CA 2JELH 4NZUL 3O2WL 3L1OH 3D1MC 5KS9A 4JPVH 4O9HL 4ZXBB 3RGVA 5MEQA 1OAKH 4FG6C 2DLEA 4RFOH 4YHZH 4JFOA 3QDJA 1NANI 1WIOA 2XT1B 3JZ7A 4OFPA 2CKBL 1KF9B 2E27H 2BVOA 5DR5L 4IRSD 4Y4FD 1BD2D 2FJGB 2FX8L 1KCUL 3REWB 2VDKH 2WK2A 1T5WA 1U3JA 2HT3C 3D85D 4KQ3H 3PL6B 1T0MB 3QZWA 4MNQB 5JW4Q 1NC4D 4HJJL 1JWSA 4DVBB 1TZHA 2P5WB 2PR4L 4FXGA 4L8DA 1Q9WA 25C8L 1T1YB 4N8VB 2EZ0D 5FYJU 5DFWH 2FL5A 1NLDL 4Z76B 3L5XH 4XP1H 1CE6A 2EEDA 1TJGH 3K4AA 2GAZA 1ZLWH 5I66A 2CR3A 1R3IL 1E27A 4POUB 3K4ZA 4OIBA 4P4KA 5CUSH 1T0NB 2C3HA 4APQA 1ZSDB 3ZL4H 3VFSA 4EI6A 4XVSL 5JXEC 3PUCA 5C09A 3MLYH 5HHXH 3INUH 1J18A 2I25N 2JK5A 5DRWB 3RWCA 2DLFL 3O3DA 4KDWA 4CNIA 4KZDH 2M8XA 5CHNB 4MS8A 1DE4B 2Q7YA 3H3PH 2QSTA 4MD0B 1QNZL 3UTPD 5B3NA 3FB5B 1CFNA 1EBPA 5TE4H 5I1CL 2IMNA 4AYFA 1I8MA 4OM1H 5E2WL 3PWPA 1KOAA 2G5BA 3O2VL 2RR3A 4OCMC 3PIQB 4QNPE 3O6MH 2Q8AH 5D1ZC 2DJSA 4OTXL 3C5SA 5GSRB 5I16B 3RY5A 4DKEL 1DBJL 1G7QA 3QEHA 2VABB 1NDGA 4J3XA 1D6VL 1ZHNA 4RMSA 5CD3A 1NAKH 1N2RB 1QLRB 4J4PA 5KJRL 3EO1B 3FO9A 4S10A 3SDAA 3FFCD 4OKVA 3UZQA 1RULL 1DTUA 1CWVA 3LEVH 4IRJC 5C2UB 4ONFH 2APXA 4GUPB 1YEJL 4QRRD 5DD5H 2DBJA 1OAZH 3D2UB 9CGTA 3JTTB 1JHTB 3ORJA 4XPGL 2PN5A 1JF6A 4P5KA 5C0CD 1KSRA 4GRMB 2H26B 4JLRA 5ESAB 4OF0A 5EORL 1H3PH 4AT6A 1L8JA 4JFZH 2HH0L 4JFDB 4FQ2H 1IILE 2D0HA 3C5JA 5LGHH 4O2EB 4ZSOE 3UDWC 5D2LB 5GZOC 1A7NH 4JG1H 1SHMA 5DC4B 4GQPH 4HKZA 3C60D 3DV6B 3AB0B 2IANA 4U6XB 1P84K 4JQXA 3STZA 5IVOA 1JPGB 2V9TA 4HQQL 3L3OB 1C7TA 4X8JA 2BNRD 2XRAH 4WU7A 2R2BA 3WIHH 4Z7UF 2R0LL 5HD8D 5HHME 3VFMB 1LP9A 3KLSA 3MLRL 1E6JL 4OZGE 4C4KT 3BZFB 5KVGH 2PNDA 1P4LB 2YD7A 2YHGA 4H26A 3FMGH 1BFOA 4K71C 1VFBA 1I1AD 3DRTB 4NZTL 4HBCH 4PRIA 1S7QA 5LKNA 3S34L 5D93C 1T2QL 3VFVA 5KSBA 4DVRL 1PG7W 3HPLA 3I6LD 3QI9D 3S3JA 4EEEA 4I1NB 4RIRA 3ZDZE 5IT2H 2WBWB 3DUUB 4NKOB 2J5LC 3ARXA 2YPLB 2QSQA 4X83A 5JUEL 1HHJA 3HAEG 5MEPA 4N0FB 2EDQA 2P8LA 3GSUA 4XBPA 3BW9A 4I0PB 3FN0L 4ZQKA 2AXGA 2B4CC 2A9NH 4MZ2A 3NZHH 3OG4B 1U93B 4PJ8A 2OTUA 1C5CL 2EKJA 5T1MA 3BP4B 4QTHB 5CILH 3WJLC 1P6FA 3LY6A 5TPWL 1BMGA 5I1AA 5I15H 1GC1L 3QO1B 3JV4A 1ONQA 1JGLL 5IGXL 5DRZB 3QIUC 1A7PH 5AUMB 5EC2A 2V7HB 4CVZA 5FF6A 5DUPH 3SDYL 3S97C 1ADQA 4GO6B 4PG9B 1YYLH 3AS2A 4YFLI 3HC3H 3VI4F 3EYUH 3F62A 1UXWA 4U4BA 4NWTL 3IT8D 4XP5L 4JM2B 4PJ5B 3EOBB 5DJXA 2YC1B 3D69B 3K2MC 4Z0BL 1Y6NR 1RUKH 1RD6A 4M7KL 1S9WA 3OGCA 2JJSC 2FNBA 4PRDA 1HXYB 3GHEH 3RWIB 5ACLA 2DL2A 3N85H 2D0GA 1MWAH 5ANMA 1D6EB 1S3KL 1I8IA 1UVQA 3H9SD 5HYIA 3VG0L 2JJTC 4BQBA 1IM3A 1JGEB 3OTTA 4WU5A 5JHDA 3QWOA 4NYLA 3HZYA 3P4MB 3Q3GA 1XCQA 1RJZB 1OLLA 3C87A 5IVZB 1OAUL 4UNTA 3G5XB 3LIZL 1O7VA 4JO1H 2YKLH 4WI8A 4B50A 4LCCA 1JZ3A 4I8DA 5DA0B 4TULH 3CDGB 1T1ZA 2FX9H 5D1XA 4XB7A 4ZYKB 3AREB 4KFZC 2AQ1A 1U8LA 2R56H 2ED7A 2UY6A 4HGWA 3SGEI 4XBGB 1IGCH 5EIIB 3TO4D 5I1JH 2FO4B 4EDWL 1MJUH 5C6TL 1PDKA 1DSFH 3O6FC 1CFSB 3TA3D 2KBGA 1U41A 4URTB 5CJQL 1AO7A 3ARZA 4RISH 4XMLH 4PRHA 1GOHA 3BKYL 4MXWH 3OXRA 2DAVA 5I1HH 1KEMH 3F58L 3LMJH 3PWJB 4LFHG 3SDXF 1F2XK 3LS4H 3MRMA 3P11H 3TPUB 3MOQA 3VRLF 3E2HC 2ZUUA 3BP5A 4HH9B 2A6IA 3TNNA 1L0YA 4K3JH 5GS0D 5GISH 1T04B 2EH7L 3MRLA 3GIVA 4PUBH 3CVHL 1QEWA 2FCBA 1U92B 5DO2D 1RZJH 5HYJE 5GQBA 3RKDD 1VERA 1OPGH 4WGVB 3E3QA 4NP4L 4ZFGL 5IFJB 3KS0J 1ZHBA 1RIUL 1M6OB 4ZUTB 5C70A 3QDGB 5D7KE 5BJTA 4PYHA 1I4FA 4L4TE 3WHXB 3ULUH 5SWSB 5ECJE 3QDME 3TIDB 4KV5F 4J3UA 4LSPL 5E9DE 1MLCA 1NUGA 4QXTB 3FRPA 4U1IA 4PJIB 2VLKD 2FD6L 1W72B 4ZUWB 2N1KA 3ZHKA 1U58B 2EDOA 4DKFL 2CGRL 4S1QL 4ZXBC 2X44D 4KRPD 2FB4L 1OT2A 1INEL 4QHKI 5FHAL 3TN0A 2XWJA 3D3VD 3U0PB 1NGYB 5BVPH 2Y72A 3GSNL 2Q86A 4M4PA 4WI4A 1OP5K 3T8XA 1HQRB 2JB6A 1FLTX 1YNLH 4G6KL 4GRLA 1ZWIA 1IGFH 3PL6C 2AEPL 5EU7E 2E8YA 1P2CA 5K59F 3EYFB 2WWMC 4P2QA 4JAMA 5D7IA 1A7OH 4RMWA 1HCVA 1OP3K 5T1KD 1DBKH 1H3TA 2PCPB 1OGTB 5CAYB 1XGPA 1AGEB 2IQ9L 3QULB 3QUYA 3O9WA 3IDGA 4H25B 5ALBL 5I74B 4NM4L 2EIZA 2VR5A 3R06B 4NWUL 1YMHB 1EVTC 3PGDB 5JXAH 5DZNA 3VI3E 1MJJA 1SYVB 4HUMB 1FYTB 2NY0B 5I19H 4J3TA 3NFPA 3BEVA 3SE3A 3U9UA 4EIGB 1HNFA 2R9HC 2R2HB 1KC5H 2B7DT 2JCCA 2Y23A 5I1KH 1HSAA 3CLEL 1MHHB 3OAYK 5E00A 4F58H 1LDPL 4LBEB 5D7LD 4DAGH 1MPAH 3KVQA 3DVNB 4ZODA 2OZ4L 4M48L 3PP3H 3GSXB 4NKMA 1Q0YH 2CRMA 4OGAD 3UTTB 3C6SA 1HZHH 3THML 5JA8B 5JPMB 4AQOA 1LO0L 5I1IH 1WBYB 5IK3A 5HHPA 1EGJA 4S2SA 1RAMA 3RZCD 2VQ1B 4XGZB 3BP7B 4PJHA 5DK2B 3QWRD 5HI5D 2BY0A 1EIBA 5D2NB 1GC1C 1MHPH 1JZ5A 3RIFF 5H35B 1CD1B 2CDGB 4RFEB 5EOQH 1HXMA 5TH2A 1HHGB 1HINL 3FQRB 3VXPB 3D0VA 5F1NB 1KCKA 1AY1L 3J8F7 5CZVH 4YGVB 1P4IH 3SY0B 2D31B 4JPVL 3I9GH 2DYPD 1OAKL 1HH9A 3NIFE 4NNXA 1KYOJ 4RFOL 2IJ0C 2ADGA 4MXVE 1H3GA 2E27L 4UV4H 2V9QA 2V5MA 3DLQR 3D25B 3IRZA 1AP2A 3QUMH 1CU4H 3VWJD 3RX7A 4L9LA 3TO2B 5FUCC 2VL4A 5FYKD 3BAEH 5KG9B 3UAJC 5INDA 1E4KA 4G8GA 3WUWG 5SWSE 1BREA 1OSPL 3RVVC 5KBNC 2V2WA 1TJGL 1K8DA 1FZMB 5C0JA 2VERN 4PJIE 1QFWI 3GRWA 4EKXA 3MV7B 2X40A 5CUSL 3QNYB 5EC1B 3S35X 3VFNA 5I2IA 2XWBA 5ISZA 3VFRA 5C07A 4OZIA 3MRPA 2KQNA 2VNCA 4AH2B 3ZL4L 4OZFH 3EAKA 2X10A 1UH2A 5HHXL 3INUL 1LEKB 2DJ4A 2FJHB 2VLMD 1X4YA 4JZJB 1AR2A 3KYOA 4DGIL 4KMQA 4KZDL 1UWGH 4HK0A 2AXJA 4HKXA 2NY2B 3OB8A 3H3PL 2I5YH 1GL4B 3VD3A 4ZOAA 5TE4L 1NL0L 5EIVA 2NY1B 3ZTNH 4OM1L 5FB8A 4I0PC 1TZIA 1I7ZA 1RHHB 2GHWB 2MHAA 1UZ6F 4P0DA 3O6ML 4RGNB 3QIBD 2Q8AL 5LBSH 4G43A 3DMMD 4UOW1 2EXWC 1I8LC 3HC0B 5F7DB 43CAB 2ZOLA 3CC5A 4J23A 2HLFC 4OLVL 1ZHKB 4NQXA 3NABH 2HT4C 3U4BL 1QP1A 5LJYH 1IBGH 1S7XB 3B9VA 1FYTE 2HJFB 2FSEB 2OK0H 2Y06H 3LEVL 3PNWB 4ONFL 1SJVA 3GMLB 4CN1A 1PYWA 3SDDA 1OAZL 4JM2C 1AGDA 5D7SH 4WW1B 3PXJA 4M1GH 3VXME 5DQJB 4YC2B 2E7BA 1NAMH 1H3PL 2W0FA 1B0RA 5A2LH 3LQAL 4ZDHA 4U1MB 4O2CB 3CFKA 5E56A 5KS9B 1GVIA 5LGHL 3RGVB 3ZYJA 5MEQB 1MFEH 2F53D 3F6LA 5AZEH 3VXRD 4AMKL 1A7NL 5FO9A 2UY7A 3QDJB 5LAXA 4G9FD 3B9KA 2BVOB 3BDYL 3TJEH 3I02A 4Z18A 4Z8FH 3ETBF 4M1DH 4PFEA 3MA9H 3SGKC 5I75B 5AEAA 3MNWA 3OPZL 1T5WB 3RIFK 1M05A 3QZWB 4UV7L 1MAMH 2MPAH 5ALCH 2C5DC 1JWSB 1B88A 3FB6A 4PJDF 1TZHB 5D2NE 4FXGB 4N90D 1D9KA 5BRZD 4L8DB 1Q9WB 3AREC 4MVBA 1R3JA 2FL5B 1RVFH 1J7VR 5JIIA 1CE6B 3AS0A 1URLA 2GAZB 3QEUA 5I66B 2VLJA 1E27B 3PQYA 4P4KB 3GM8A 4JO2H 2DQUL 3OKOA 4HBCL 2ERJB 1IM9D 4APQB 3HE6A 4Y5VA 5CJXA 4TVPE 5F6HJ 2WSKA 2X4NA 3VFSB 4EI6B 3F65A 5C09B 1UWXH 1MQ8A 2JK5B 4TNVK 4XX1G 3RWCB 4EI5D 4F7MA 3O3DB 4CNIB 1J8HA 3GDBA 4CU6A 3HNTL 3UMTA 2VKWA 2Q7YB 4KHTL 3GI9L 4MXQD 1CFNB 2OX5A 4PJ7E 2A9NL 1I8MB 4XP6L 4WI5A 3MUHL 2IBGA 4KRLB 5F21B 3PWPB 4CADA 3U4AA 4PP1C 1NFDF 1UACL 4Z6AT 2G5BB 1K5NA 5HYSA 4FQQA 4NC1C 4UOW0 4MCZA 3MV7E 1NGWA 4TN9A 3C5SB 5I15L 3GJEA 4J6RH 1AHWC 1G7QB 3QEHB 1A7PL 4Y4HA 1NDGB 1ZHNB 5CD3B 1FL6A 5DUPL 5LQBH 3SDAB 4PJCF 4OKVB 1U8NA 3EYUL 1AXSA 4YEFA 5FA3A 4GJTB 4M1CD 4XX1E 1MCPL 2R23A 2XKSA 4OCWL 2XG5A 5IBUG 1QPXA 1NEZA 1WFNA 1RUKL 1YEGL 1MRFL 1P1ZA 5EA0H 4P5KB 1CK0H 4JLRB 4HUVA 5K9OA 4RGNE 3P9LA 3GO1L 2L7UA 4AT6B 1CFTA 5F88A 5IJKA 2WAHA 4LVHB 3MNVA 2DL9A 4P2YA 3RUGE 5TQ2H 5IP4A 3C5JB 4NBYB 1KLUA 2A77L 3UTSE 3V4UH 4TSAH 3LB6C 4W6WB 1CLZH 2QEJA 4HKZB 4RX4D 5F96H 4BJLA 3TJHC 5AZ2H 1S9XA 1EXUA 3ZE0E 2IANB 2Y7QA 4MLSA 3T77A 2VUYA 4JO1L 3STZB 2H2PD 4X8JB 2FX9L 4I0KA 2R2BB 4WU7B 5EBMA 2ENYA 1LP9B 4ALAL 5DD3L 1F11B 5I1JL 3BQUD 4W4OC 5I74C 1CDHA 1JV5A 1HHKB 1MJUL 4FFVD 1MCHA 3MRIA 4P57A 4LASL 3ZZ1A 4C4KO 4JVWA 2R0KL 1I3GL 3O4LA 3BIBX 4KPHH 1BFOB 4JPKH 5KS9E 1VFBB 1EX0A 4PRIB 4RISL 1S7QB 4ZUVA 4JFFA 2NY0C 1OY3B 1CG9A 3VFVB 5KSBB 3QDJE 1EFQA 4YAQA 3HPLB 3CGTA 5I1HL 3RDTB 1OTUC 2BDNH 3UTQA 4RIRB 4OLUL 3C6LB 2DWDB 2AQ2A 3LS4L 4JZOA 3NGBB 4CMHB 1HHJB 3P11L 3QHTC 2HKHH 3SGJA 5F7NC 5MEPB 4NRYA 4WHTA 2DMKA 3GSUB 2P8LB 1T2XA 4XBPB 3BW9B 2AXGB 1NSNH 1P7QA 1S7RA 2PYEB 4K3JL 4PJ8B 5SX4H 5JW3H 2OTUB 3CCHA 1ZT7A 2BRRH 4PB9H 4F9LA 5T1MB 4R3SA 5FGSA 4GRWH 4ETQA 3U36A 5I1AB 1OCWH 4HIIA 4R2GB 1OPGL 3DGGA 1FORH 3JV4B 1ONQB 1MHEA 4LSVH 1OGAD 4FZEL 4IJ3B 1EH9A 2AEQH 5C09E 1HQ4A 5EC2B 3QXTA 4MMZC 3SKOA 2QSCH 5FF6B 1CD9B 2B8OT 3WFDH 3ULUL 5EOCH 5FV2A 2X4QA 2UUDH 3MJ6A 4UIMA 1UXWB 5D2NC 4DGVH 2NY7L 5DJXB 3JSSA 4PD4J 1BX2A 1EERB 2KH2B 3NCJL 1RUML 5EG6C 1NMCB 4LVNB 4K8RC 4GW1A 4BK4A 3OGCB 4PRDB 2CPCA 3DOSA 2ICWI 5ANMB 2BNQA 1I8IB 1UVQB 4QGTA 1EHAA 4OZHA 3IDJA 1I7TA 4GAGL 1IM3B 1MCQA 4B5EA 4WU5B 4XC1L 5JHDB 5L2KA 2R4RH 4JZNA 1EEUA 2COQA 1W2KT 4NYLB 1YNLL 4JFED 4XH2A 1IGFL 3HA0A 3HZYB 3Q3GB 4ENED 3KPLA 3LQAC 4KROD 1XCQB 3H8NA 4JCLA 3SQOL 4J7RA 3MYZA 1IE5A 5IW3A 1KXQE 3W5MA 3SKNB 2XZAH 2F8OA 2H6PA 3MRQA 4RDQG 3X17A 3MA7A 4F8QA 1A7OL 4LCCB 5K9JL 1T1ZB 3EYSH 4UILH 5D1XB 2QQKH 1JCKA 1U8LB 1YMMA 2XYCA 2MTPA 2BXYA 4HGWB 3BGFB 3QFJE 1OOAA 1AGFA 5A1AA 1I7RA 1DDHA 5JXAL 1WSST 1NMAL 3S4SG 2KKQA 2D7PA 2QSVA 1XGQA 4JZJC 5I19L 1R3KA 2IALA 1AO7B 2VXQH 4ZO9A 4KI1A 2NY2C 3OXRB 2J3SA 2X09A 2ZP0T 2Q87A 2VDLH 2IANE 2NY1C 4HWBA 1OHQA 4M5YL 5TFSH 3MRMB 5EBWA 1QHPA 1GIGH 5DA4A 1RQ5A 1CGYA 4F58L 1A7BA 3AFLA 4PRNA 3BP5B 1Q9LA 4DAGL 1MPAL 1HOCA 2R15A 1VDGA 2A6IB 3TNNB 2VZ3A 4JHWL 2YPKA 3VXNA 5JW4R 4PV9A 4LPVA 4WFGE 1Q0YL 3MRLB 3GIVB 4YZFE 4JG0H 5AYUH 2X89D 1HZHL 1QEWB 32C2A 5B39A 4N0CA 5I1IL 4U6TA 2IG2H 1IC4H 3BN9C 5FHBH 4P2RA 5D9SA 5DDHA 3LEYH 5F89A 2QADB 1ZHBB 1K3IA 4MDIA 5BJTB 4DN4H 4P2OD 4OQ1A 5GRZA 1I4FB 4BH7A 3BMWA 4G80A 3CFJA 4HXAL 3VFTA 4PJFA 4GT7A 1MLCB 4DQOL 2X1WL 2HT2C 4IDJH 2EECA 3T3PE 4H1LH 4YC2C 3T0VA 2VAAA 2Z92A 3OKLA 4U1IB 3VXUA 5BS0D 2J88H 4YIQA 4PG2C 2DLGA 4BYHA 1OAQH 5C6PB 5DQDH 2HMID 3RGVC 1VSCA 2YEZA 1UYWH 1QRNA 2EDJA 3TN0B 3UPRA 4UV4L 5D7JD 4G42A 3S9DB 4FFWD 1F90H 2Q86B 1PW3A 3T8XB 4MQXC 5J1AA 1FFQA 4Z95H 3ULVH 1I3UA 1CU4L 5I75C 1QVOA 2JB6B 4F9PA 5DZOA 2OL3A 3BAEL 2CIIA 1ZWIB 4GRLB 1UKSA 1EHXA 3UBXA 3JUZA 1P2CB 4C56D 1MAJA 4P2QB 4JAMB 1J86A 5D7IB 3KPRA 4IRSA 4Y4FA 5TJWK 1XGPB 3FFDA 2ZWLT 4JE4B 3X3GH 4UI2A 3QUYB 3O9WB 3L7EA 3D85A 3IDGB 1VFMA 3LVEA 3WKMH 5KZCB 2EIZB 1FZKA 2VC2L 4APQC 2NX5D 4P9MH 5ANME 5E5RB 3MJGX 1MJJB 5J13B 3MGTA 3FT3A 1UWGL 3MV8D 3U7AA 3NBNA 1QSFE 3VFUA 3NFPB 3BEVB 1GGIL 1S7SA 3K4DA 3U9UB 4MS8C 1E4XI 5B22A 1QYGL 2Y25A 3UJJL 2FLRT 3OGOE 3ALPA 1AR1C 5B38G 3RBGA 2DIJA 3V0VA 5FUOH 3LKQB 3RTQD 2ZSWA 5E00B 4PJEE 2AJYH 2VXSH 5JOPE 4GFTB 3E6FA 1UCBH 3OZ9L 1VPOL 4PD4K 3WSQH 5CGYC 4OV6F 3OJMB 5F72S 4NKMB 1WEJL 5HVWA 3NABL 3C6SB 3MLXH 2HFFA 2PYFA 1H0DA 1RIHH 5HHPB 4PRHE 3SDAC 4LPUA 4RAUA 4NO5A 5HHNA 3RJDA 4XNMA 4PJHB 4JQVA 5CLWA 4M4RA 1ZLSH 3HZMA 4WI7A 5C0DA 1HXMB 3QP3A 5TH2B 3D0VB 3FFCA 1N5YH 1OTTC 4N0UE 4LVHC 1MCWW 3MCKA 3ULUC 1F4XL 1ZXQA 4NNXB 1HH9B 1K85A 4QRRA 2ADGB 3ZYZA 1QKZL 2FGWL 4Z8FL 1EJ6A 1UM4L 4M1DL 4X7DC 5C0CA 3MA9L 3E3QE 4MQSB 1AP2B 4KRNA 3VXSB 1K6QH 5E8NA 4JQXC 1Z2KA 1MAML 4FQCH 2XY1A 3LDBB 5INDB 1T1XA 4G8GB 1AFVH 4UDTB 4OZGF 4A6YA 4UBDD 2V2WB 4EUPH 5C0JB 5T3ZH 4LP4A 2O5ZH 3QHZL 4OLZH 4R90H 3O0RL 1CL7I 3VFNB 2A6DA 2XWBB 5ISZB 4UB0L 3DBXA 3WNOA 3VFRB 5C07B 4OZIB 3MRPB 2BNRA 3MCLH 1QSVA 4BFEA 4UIKL 2VDQL 3ZDZF 3RDTC 4Z7WE 3KYOB 4HK0B 4HKXB 3C6LC 3HHRB 1X7QA 4MA3A 3NGBC 2G9HA 2LQRA 4JPIA 4CMHC 1BLNA 1I1AA 3HI5H 1HILA 5FB8B 1TZIB 1A3LH 2AJSH 1I7ZB 2R4SH 4W4NA 5D7IE 4X7SH 1EGJL 2MHAB 5D5ME 3QI9A 5DUMH 4P5TD 3PWLA 2IGFL 5IF0A 2DQHH 1RJLA 4G43B 3RNQA 4JFYA 2KZWA 2MJWA 4J6RL 4LLMB 1NJ9A 4R2GC 2ZOLB 1MY5A 2EO1A 3CC5B 3FOMA 3SJVD 3ZE2F 3JWDH 4HX1A 4NQXB 5SWZD 5HHMD 4IJ3C 4RZCA 3LPFA 4GAYA 1MCEA 1RMFH 3DX6A 1VADA 4PP8C 1G7LB 2AVGA 2VIRA 5J1TC 4XI5D 1PYWB 1HNGA 3SDDB 4K7PY 2ADIA 3IJSA 1AGDB 2JCCE 4LPTA 3WFEH 1JFQH 1RZGA 1NMCC 4LVNC 2ICWA 2W0FB 1B0RB 4ZDHB 4XP9H 3CFKB 5TQ2L 2F15A 4QRTA 4R8WH 1J12A 1GAFL 3ZYIA 4W68A 4LLWA 1NUDA 1LE9A 4H8WH 5FO9B 2NXYD 4CL7A 1CLZL 4NQTA 5LAXB 3B9KB 3BESR 2D03L 3NN8A 1QSEE 3I02B 1TETH 3GRWL 4MD5A 5AZ2L 4ZFFA 1WWCA 5CJ5A 2XV6B 3MNWB 5JW5A 1ULVA 5DS8A 1M05B 5ESQA 4WGWB 4PJHE 3ARQA 3H9SA 1UCTA 3OQ3B 4LCCC 3SKMB 3FB6B 5IEKA 4X6DE 1ACZA 1D9KB 5D1XC 1R3JB 1XGYL 3BDXA 3LRSA 3IDMA 3UJIH 3BGFC 2QHRH 3QUKA 5HHOD 3QEUB 5H94A 2VLJB 3PQYB 4KPHL 1F6AA 4JPKL 5J89A 3OKOB 2IPUG 3ARBC 4Y5VB 2YN3A 3UXFA 3IJYA 2H9GA 2X4NB 5FO7A 2YRPA 5IWLA 2VSDA 2SEBA 4F7MB 3WV0A 1J8HB 3IVKA 3KPOA 3TO4A 2DQCH 3Q1SH 2HKHL 3DX7A 2GSGB 1FLRL 2AK1H 3SGDH 3TA3A 4G8GE 3PDGA 5DWUH 1PLGH 2WLYA 4WFHE 2OM5A 4X9FA 4ONGH 4KJWC 4CADB 1EHNA 4LRNH 1K5NB 4OIIL 5HYSB 2H1PL 1G9NC 4FQQB 3K8MA 4MCZB 1RPQA 4LK4A 1NGWB 4JHAH 3MBXL 4JN2A 1HIMH 4RWHA 1OCWL 3GJEB 2F9BT 1FORL 4OZIE 5C07E 2MKLC 3E3QC 2F5BH 4Y4HB 4LQ1A 3BPCA 2QADC 4TNWK 4Y1AA 1FL6B 4L9DA 4LCYA 5IBTH 4WNQB 5AWNL 4JHBA 3WFDL 1U8NB 3LZFL 5EOCL 5FA3B 5I8KH 3WFCL 3MLUL 4RMTA 4L29A 3EKCA 1FVCA 1BHGA 4PGEA 5C0IA 1NEZB 1T7YA 1FJ1A 1IQWH 3IXAA 5I9QB 1P1ZB 5DVNA 2VXVL 1PG7X 3R1GH 2NZ9D 4ODVH 3U2SA 4HUVB 5K9OB 1X6NA 2IPUK 3P9LB 2J8UF 4U0RB 1CFTB 4EBQH 3TN0C 2AEIT 1M7XA 3MNVB 2Z35A 1KLUB 5DRNA 4NJ9L 2VDMH 4OI7A 1JNJA 2VLKA 4R4NC 4YXLH 2PETA 4GRLC 3SKUD 5DGQA 4UOJA 1EXUB 3VWKD 2Y7QB 3PWVA 3T77B 3MLZL 3QCUH 2XZAL 3SDXA 3BD5A 3B8SA 3D3VA 2CMRH 5HYJD 4X6FA 4HF5H 5EOTA 3EYSL 1H3VA 4UILL 3QUYC 1MNUL 3O9WC 4U2ZA 1JV5B 1OSZA 4L4TD 3VI3F 3MRIB 4P57B 4HWZB 1IJ9A 3QDMD 3O4LB 1FFPB 5E9DD 4WHYH 4ZUVB 1HEZA 4JFFB 5T1KA 4NUGH 1CG9B 3ZLQC 1LD9A 4YAQB 3P4NA 3SE3C 2VRAA 4CU7A 3UPCA 1Z0MA 3UTQB 3WMSA 2W9EH 2EC9U 4LSSH 5GRVL 3CU1A 4JZOB 3VFOA 4K3GA 3ESUF 1XF2A 4NRYB 4WHTB 3V6ZA 4OJFH 4XNYH 2W59A 1JE6A 1P7QB 2DMBA 3S7GA 5M94B 2AJUH 4XHJC 5HGGS 3CCHB 5JO5A 1ZT7B 3PJSA 5AYQA 2QR0A 5IHUL 3CK0L 2VDNH 2VLJE 4HUKB 4R3SB 3TCXA 3PQYE 2W0KA 1IZJA 3R4DA 4YHOH 4LGRB 1I75A 4ETQB 1JRHH 3U36B 1IC4L 4HIIB 3DGGB 2R0ZL 5FHBL 1V05A 1KB9J 1MHEB 4P99A 5FM5M 4YX2H 4HULB 1A5FL 1J0ZA 5KAQF 4X4XB 1HQ4B 3SKOB 1NPUA 3MRFA 4O5LL 5GHWH 4DN4L 1J8HE 1DLFL 3ABZA 3TH4T 2X4QB 4UIMB 2APFA 2JTDA 1BX2B 3LPWA 4XVUC 4NQVA 5KVDH 4ZS7L 3BPLB 1OAQL 4GW1B 3IDYB 3GSWA 12E8H 4HXBH 4MXVF 3QWRA 1P9MA 3QQ9C 5KSAD 2BNQB 1RUAL 4OZHB 3IDJB 4WO4D 3ULVL 1JF1A 5L2KB 2KPNA 4JZNB 2F19H 4WY7L 1J8KA 3U6RA 4XH2B 5F9DC 5INCA 4EQ3A 3KPLB 1YEIH 4M6AA 4HH8A 2DYPA 1ZLVK 1JNNL 2H6PB 4D3CL 3MA7B 3MLSL 4JFQB 2C4XA 1ZA6A 4AEHH 5F3HA 3V4PL 3L3GA 3STBA 4Y19D 1YMMB 3VWJA 1AGFB 1I7RB 1RZ8A 4M6OH 1DDHB 5E4IA 1OP5H 3RHWK 1H3UA 4P9ML 5CIPA 4U1HA 4Z5RA 1JZ8A 1PJ9A 5CSGA 1V8HA 2IPKA 1XGQB 1R3KB 2IALB 4EUPB 4Q97A 4X4YA 5DRXA 1DJSA 5B8CA 1MCCA 1OP3H 4BZ1H 2XTJE 2X9WA 1RJYA 4DZ8A 1MHCA 1EFXD 2YS4A 5EBWB 4P2CG 4HCRH 2AJYL 2XQBH 3HRZA 1EZVX 4RRPG 4HAGA 4PRNB 1LNUA 1Q9LB 5FKPB 4Z7NF 1HOCB 3CFBA 1TPXC 1TVHA 4XC3H 2M26A 1KCVH 1F6LL 4NJAL 2YPKB 3L3KA 5DD0H 3VXNB 4F7EA 4M02A 1UKQA 4OBSA 4PV9B 5E2TL 3O3BA 2JIXA 32C2B 3MLXL 1G9ML 5B39B 1RIHL 4KJPC 4UDUA 4P2RB 5D9SB 2QKIA 5DDHB 2HWZH 3QIBA 3BVNA 3DMMA 3ZKXB 2E9IA 3G08A 4MDIB 1CIUA 3OAYH 3SDDC 4BH7B 4G80B 4LRIA 3CFJB 3VFTB 3WFZA 1MCIA 1P4BH 4PJFB 2IPTH 1FNLA 2BHUA 4YXKH 1KEGH 1UB6A 3RAJH 2OQJA 3HMXH 3WUZA 2VAAB 2Z92B 4WWID 1N5YL 4MA8L 3IU3A 4RBPK 3FB7A 1HKLL 3AM8A 4YIQB 4XB8A 2DD8H 1C08A 1OB1A 2NXZB 2WIIA 1IAII 5CD5C 3GFUA 4WHDA 4AG4L 5E08H 4BQ9A 2YEZB 1QRNB 3DETC 1QFWL 3UPRB 2RQ8A 1KGCE 4G42B 3QQ4A 1MFCH 4KJYA 3B9KC 3QXDA 3VA2C 1J0YA 1K6QL 5B21A 1QVOB 3IJHA 2D4DA 3O6KH 2OL3B 4FQCL 2CIIB 1KN2L 5K9QG 4R4FL 3UBXB 3UTOA 2F53A 1MY7A 1OF2B 3VXRA 4D9LH 4FQIL 1D9KC 4G9FA 1FYTD 1F02I 4IRSB 4Y4FB 1BD2B 3VXTA 2O5ZL 5ENWA 4AQ1B 2EYSA 3FFDB 1CLOH 4M00A 3L7EB 5CBAA 3D85B 3H9HA 1NC4B 4O51A 3BKCH 4HWBL 5JR1L 5CJXC 3T1FA 4QHMA 4FFYH 2WUBL 5IJVA 5BRZA 1ORSA 4G6ML 3VXMD 3MGTB 3FT3B 3P77A 3U7WH 3VFUB 2OJZH 1SBBA 2MWCA 3FO0H 3FTGA 4QHLA 1KB9K 1S7SB 1NCWH 1ETZA 1WCQA 3V0WL 4WI9A 5FDWA 3KYMA 4PJ7F 2J12B 3HI5L 5A2KH 1N7ML 3T0AA 1Q9OA 2AJSL 3PF2A 5JOEA 3V0VB 3TP4A 4X7SL 4LPCA 1IGYA 1WITA 2ZSWB 5DUML 1L6XA 4GQ9H 4KXZI 1GCFA 4I3RH 3E6FB 2CDEA 1FE8H 5DD1L 1YMME 4XWGH 1L4IA 3GMNA 2IFGA 1CDIA 4MXQA 2PKDA 3S36H 3VDCA 1TTFA 4Y4HC 5IESL 4E9LA 3KGRA 2HFFB 1DBBH 1H0DB 2PYFB 1RY7B 1RMFL 4RAUB 4NO5B 3CDCA 2VOTA 5HHNB 2C7UA 1WICA 4XNMB 4YBHA 3T3ME 2XG4A 4PJGE 4TVPD 3WFEL 3AMKA 3V2AR 2M2DA 2VZTA 5I9QC 3HZMB 5CWSA 4PJDA 5C0DB 3IDIA 4H88L 2OL3L 3FFCB 4HFUH 4RA0C 5B4MC 4XP9L 5C2BH 4U0RC 1NFKA 3RUGF 5IJKC 3U48A 3MCKB 4WCYL 1X5KA 3QEQA 2JKXA 4QRRB 1MJ7H 4H8WL 3O81A 1WZMA 3RVTD 5IFHH 4OIAA 5EWIH 1TTGA 3MBEC 3ZE0F 1T7WA 2WBJD 2AAVA 5C0CB 5GJTH 1U8QA 1CZ8H 4CVWA 5E8NB 2UWEE 1A6VL 4KK8C 1VENA 1T1XB 1T3FA 1IC7L 3JTCA 2ID5A 1ZVYA 1EVUA 4A6YB 2QHRL 4YDIL 3VXUE 4CBPA 4F37F 1NFDA 1I8KA 3SCMA 2A6DB 3FHQA 3DBXB 3EYQD 2BNRB 2Z0BA 3BWAA 4WUUD 1QBBA 1BOGA 5JHLH 1CICC 3DO7A 4RGND 3V7AE 4KI5C 3BQUA 3PXHA 1X7QB 4MA3B 2G9HB 3G6JA 1N5AA 4JPIB 1V3KA 4PJCA 4DK6A 2AK1L 4KKNA 4LL9A 3SGJC 4LCIL 4XZUA 1BLNB 1I1AB 2DKMA 3UTSD 4CN4A 1HILB 1QFWM 4ONGL 4PP2A 3RFZC 1JJUA 3KPRE 5H37H 3QI9B 3T0XA 5AAMA 4F9LC 4U7KA 4AJ0A 4KHXH 3PWLB 5IF0B 1DEDA 1RJLB 3RNQB 3Q2CA 4JFYB 1HIML 4M6NH 3MOAH 1NJ9B 1RV6X 3FOMB 5FYLE 2F5BL 4HX1B 4J3OC 1WZKA 3UJTH 3Q6GL 5IBTL 3FZUC 4RZCB 2UZIH 4GAYB 1MOEA 3MMEA 1YEEH 2WBKA 4EQ2A 5I8KL 1MUJA 3DX6B 4YHNA 3MXWL 5E8EA 2VIRB 4QRPD 5BOZG 1MCFA 2ADIB 3IJSB 1FH5L 1G9MC 1VFOA 1RZGB 1A0QH 3TLRA 4E41D 2HRPH 4GAJL 1QRKA 3GBLA 5TF1H 1KBGL 4ODVL 3BPLC 1GGCH 2UYLA 4GMSH 2ICWB 2MFNA 4LSTH 5EZLB 3F7PC 3QIWD 2APBA 4LF3A 4OLWH 2GJ6E 3UTPE 4QXGH 1BIHA 4QRTB 4XCFL 5HI4D 3ZO0A 2VDML 4LLWB 4YQXH 4A6YL 1LE9B 3UZEA 3RWDA 2CRYA 1A3QA 3NN8B 4LKXA 2PF6A 3JTSA 4MD5B 2WNGA 1XAUA 3QCUL 4HIEA 5JW5B 4NHCL 5L88H 4P4KD 3PV7A 5DMGD 5DS8B 5LG1A 4TSBH 1S5IL 1JMZA 5ESQB 4ODTL 3H9SB 2OCFD 3EHBD 5IEKB 2IQAA 4JKKA 5F7EH 5GGVH 4HKBA 5C09D 1RK0A 1A7QH 3LRSB 4JFEA 4JN1H 2NNAA 1PZ5A 3IDMB 3QUKB 3FFCE 1P7KA 5I71B 1SEQH 3JWNC 1F6AB 4RCAA 4TVSa 3K2UH 4MAUH 5F9OH 1CS6A 2B0SL 4NUGL 3IJYB 4C59B 2H9GB 5FO7B 2H2SC 2SEBB 5ADOL 3IVKB 2Q3AA 3KPOB 3TO4B 2FR4A 3DX7B 4JVUA 4V2BA 4OJFL 3SE9L 3CDFA 3TA3B 2VE6A 3HKFA 3L5JA 4XPAH 4IRZH 4RDQF 5HHVH 1SMOA 4JKLA 4J4PD 3UYRH 2NLJA 1OWRM 4HMCA 4YZFF 5BOPA 5HDQL 2VDNL 1INDH 5FGRA 5J57B 1JHLH 4PLKC 1JRHL 2DLIA 1H9VA 2XA3A 4JN2B 4L4VA 4P3DA 3A67H 1H3WM 3QQ3A 3MV11 2IWGA 4BUHA 3BPCB 1OAXH 15C8H 3I3DA 4LCYB 3QFJD 2EDKA 3ZKXC 1DANU 2BSTA 3C09B 2P49B 2ZG2A 5IIEA 2A1WH 2FBJH 1AI1L 4P3WA 2X89A 1BBDH 1JHKL 4YHKL 1Z0NA 3T3PF 4XXDA 4L29B 2DRUA 1A6UL 1FVCB 3HPJA 4PGEB 4S1SL 1QQDA 5C0IB 1GGUA 4Q6IA 1FJ1B 4DCQA 3IXAB 1PFCA 2PTUA 2R29L 4OCXH 1LMKA 4PRAA 4RWYH 3U2SB 2NXZC 4GBXC 4KU1A 2IAND 3TWCH 4P2OA 3QCTH 1KPRA 3QUZD 3HR5A 3QPXH 4V1DA 2W9DH 2Z35B 3AUVA 2PTTA 5D8JH 2F19L 5DRNB 1WZLA 2VLKB 5BS0A 2FEDD 1I85A 3FQUA 5J3HD 3U4EA 4WFGD 3PWVB 4NQED 3V52H 4KRPB 1FBIH 2WY3A 2DQGH 3SDXB 5EUOF 3D3VB 5D7JA 4H8WC 4X6FB 2PXYD 2WIMA 5EOTB 4IRSC 4Y4FC 2BSED 5ID0A 3V8CA 4KK6D 2NY4D 3K46A 1FPTH 5I73B 3BOVA 5GPRA 1XF1A 1OSZB 2O26U 4C56A 4HUWA 2MQ3A 4NKIH 2FIKA 4WEUD 4LEOA 2EZ0C 3TVMD 1NBVH 1HEZB 5T1KB 4EXKA 5KVEH 1DLHA 3C2AH 1PZUB 1IGML 1LD9B 3P4NB 4LARH 1F4AA 4PJ8D 2IF7A 3ELAT 3T2PA 4HS8H 2GEEA 3VFOB 2NX5A 3M45A 3TZVD 5IHLB 4X7EC 4BZ2L 4PJEF 4HCRL 1XF2B 4QT5A 1XH3A 4XCNA 2GT9A 3V6ZB 3U7YH 5I8CA 2NZIA 3MV8A 4HC1A 1I3RA 1JP5A 4XC3L 3GSOA 4MJ2A 1KCVL 4RGOH 5GS0L 2ADJA 4OD3L 5JO5B 1IAOA 3PJSB 2QR0B 4PB0L 5DC9B 3EJZD 3F12A 5C92A 3RTQA 3S88H 3GI8H 1GHFH 3DWTA 2BP3A 5D7LB 3CXDL 2E6PA 3MRFB 5FYJH 1RK1B 4EDXA 3PHQA 1FAIL 4K2UL 4J1UA 1P4BL 2EKSA 1T89A 1AGBA 1KEGL 1EJOH 2WQRA 3RAJL 5BW7A 1QSFD 5JZ7D 3MYJB 4NQVB 3GSVA 2DD8L 3RZCB 4ZD3H 3GSWB 1CLCA 4KWUA 5C9JA 5D1QD 1MF2H 1RIVL 1MFCL 4S1DD 1Y6MR 2QTEA 3MLPA 2EC9T 4DOHB 1JF1B 3VRJA 2VXUL 2V2XA 1X6LA 5JOPD 4C58B 3O6KL 3U6RB 4Y1AE 5INCB 4GMTH 5ITFA 4DW2H 1FYHB 4ISVA 3BT2H 1BIIA 1CDGA 4DGYH 2DYPB 2NYYD 4D9LL 1LK3H 4D8PA 4FZ8H 5D6DA 2C1OA 3FCTA 1VEPA 3OF6D 1ZA6B 5F3HB 1FN4A 1R5WA 3C60C 4PRHD 1CLOL 1UT9A 3L3GB 3MRJA 1OVZA 1T03H 4G5ZH 2B1AH 3VWJB 4JRXE 1LO3L 2QQLL 3BKCL 1RZ8B 4JDVA 3S3PA 4RA3A 2YXMA 5CIPB 4FFYL 4U1HB 4Z5RB 3IAGC 4XNUL 4NKQB 6FABL 5CZXD 4FQPA 5HD8C 4Z7WF 3B5GA 4QHNA 1U3HD 3FT2B 1U8MA 2IPKB 1YEDA 2FHBA 3U7WL 4G7VL 2VLKE 4X4YB 5DRXB 3LN5A 3G6AA 1NGZA 1SM3H 5B8CB 2ED9A 4PBXA 1I1AC 1B4JH 4OZFG 1RJYB 4DZ8B 1MHCB 1MAKA 5D5MF 4I18A 3SBWA 4GQ9L 3HRZB 3X14A 4F8TA 4OUUB 3QI9C 4I3RL 3TEUA 5A43C 3VRLE 1EZVY 1LNUB 5KVFH 4X9HA 3CFBB 4XWGL 5KTEH 1TVHB 4FQLH 3X13B 5F8RC 1BWMA 4F7EB 3L3KB 1OL0A 2YD9A 3LAFA 1KT2A 1AC0A 3X11A 2ZUTA 4KVCH 3O3BB 1JUFA 2JIXB 3S35H 2AGJL 3TBSA 1OWWA 4M7JH 1DBAH 3WNKA 5D6CB 5IV2A 4UDUB 4P5TA 2QKIB 3QIBB 3RA7H 3BVNB 35C8H 3DMMB 4WHCA 4YR6A 3G08B 2JCCF 1BVZA 4PJBF 4KK9D 1RZ7L 1D5ZB 3SJVA 4QRSA 5E95B 5SWZA 3ARFD 3IFNH 2Y5TB 4OCLC 1CBVH 2OQJB 1D5BA 4OZGA 4IMKA 5C2BL 3IU3B 3FB7B 4X9IA 1C08B 1OB1B 1OAYH 2WIIB 3OKDA 2AJVH 1EDQA 3WLWD 3MLTA 3QQ4B 1VFUA 2DQFA 1CL7L 4KJYB 4KTDL 4N5ED 2DTMH 3QXDB 2A6KA 1CZ8L 4NRZA 1A6ZA 1I9JH 3IJHB 2R69H 5DQ9A 4PJHF 1G7MA 4Z0XA 3K0WA 4L8SA 4RMUA 4X6DF 3TT1H 2F53B 3VXRB 3ZKND 1O0VA 2VUOA 1N26A 1N6UA 5DLMH 1FCGA 4G9FB 4X7TA 4LIQH 1QLEH 5EB9A 1Z5LA 3VXTB 5ENWB 2EYSB 3O11B 1A1OA 4CMMA 1VFAA 2VWEE 5I71C 5CBAB 2YBRA 3K1DA 1N3NA 1KXVC 3H9HB 3OKNA 1MREH 4LPXA 3OAUH 3KPPA 3T1FB 4QHMB 5IJVB 5BRZB 5JHLL 1ORSB 4DOHE 4ZUUA 3CZFA 2BVYA 2KDGA 3B5TA 3P77B 5HHOA 1I9EA 3TO4C 3FTGB 4QHLB 1ETZB 2K7QA 4Z7VF 1U95A 3NPSB 3U30B 2BSRA 3KYMB 5FDWB 5EFIA 3TA3C 1IM9B 1Q9OB 4GKOA 4NFCA 3ZKMD 1IGYB 1QSED 3HAEA 4GXUM 4ODXA 4BKLA 1JK8A 1IAMA 4KHXL 4E0RA 4LSQH 2CDEB 4UINH 3OKYA 1C1EL 4M6NL 3GMNB 5GRYA 1W0WA 4OZIF 5FYKE 5IROA 1KV3A 4M7LT 2LVEA 3B2VH 5D71L 4LGSB 4GKSA 3RL1A 1YEEL 4L8CA 5I6XB 2X05A 3C09C 5GS0C 1OT1A 1T7VA 4RGMB 1G9EA 5LWYH 4GG8A 2C7UB 5KANG 5EOCJ 5DO2C 3BHBA 4OCNC 4N1EA 2ZCLH 1A0QL 2HN7A 1MCRA 3RKDC 5A3ID 4FRWA 4HIXL 3VGHA 5CWSB 4PJDB 2ZUWA 3TT3H 1GGCL 3IDIB 3QJFA 4GMSL 5HGDA 1Y0LA 5CKAA 3TPKA 4OLWL 3HI6H 3GKWH 3O2WH 4NM8H 4ZOEA 4YQXL 1SEBA 5FA4A 4XNQA 1BZ9A 1EMTL 1PAMA 4WFHD 3V8OA 4IMLB 2W0PA 3DVGA 5DR5H 2HTLD 1OM3L 1U8QB 1FNSH 3O41A 4GW5B 1L7TH 3IKCA 3B6SA 4KRPC 4TSBL 4CU8A 3ZT5A 2EE2A 2FEEI 2GK2A 5C07D 4OFYA 3GMRA 4HJJH 5F7EL 1T3FB 4FTVD 3O45A 5EU4A 3MUJA 1X5YA 3LKSA 5C0BD 2PR4H 3ZKSD 25C8H 2GY7B 5ESVA 5I73C 1CDCA 5ABDE 1ZOXA 3VWKA 3EZ8A 1NFDB 1K4DA 5F9OL 1N6QH 1I8KB 3SCMB 1DR9A 4HEME 4BFGA 5HYJA 1AQDA 1T66D 3BWAB 4XVSH 1BOGB 2XFXA 3VD7A 4AZ8A 2OMNA 1NCCH 5L0QB 3X3FL 2DLFH 3DO7B 3BQUB 4L5FH 4L4TA 3G6JB 1N5AB 4PJCB 3C8DA 2OSLA 3WN5A 2ZCKL 2P4AB 3QDMA 2VZSA 3BFOA 5E9DA 3SN6N 1JZ6A 1IGJA 4QY8B 4XZUB 4IRZL 2F53E 3OR7A 5HHVL 3VXRE 5I1CH 1HSBA 1DVFD 4PP2B 1QD0A 1XGUA 3UYRL 1INDL 5IMKA 4B41A 2XTLA 5CP7A 5FCUH 3VH8G 2DQDL 2FX7H 2J8UA 3MCG1 4DKEH 3MOBL 4MYWB 1YY8A 1DBJH 4Q9RL 4N90E 2DM4A 5BRZE 15C8L 2DKUA 3BISA 3MMEB 2W1NA 5KJRH 5FK9A 3DROA 1MUJB 1QBAA 3CSPA 1BBDL 4YHNB 1DUYA 1BJ1H 1RULH 4IIQA 5CINL 5E8EB 4OGAC 1CDBA 2VSCA 1BM3H 1YEJH 3NVQA 4XTRD 5E6ID 1G6RA 4OCXL 1MRCL 4RWYL 3U0TA 2EDLA 2VWEC 4N9GA 3RZCC 2UYLB 1G7HB 4I5BA 3QDAA 5HI5C 1N59A 3IDXH 1P9MC 4IBLT 2GUOA 3QPXL 4JKMA 4LF3B 2HH0H 4JJHA 2DI7A 5D8JL 4LQFH 4Z9KB 4PBVC 3RWDB 4MVBD 4FQJL 4LKXB 1VACA 1YY9D 3JTSB 3FKUS 4H5SB 1BFVH 1FBIL 4HIEB 2VLJD 5J7CC 4W70A 1NDMB 5KSAA 1CIDA 4PJAE 3SO3B 2B5IB 4WUKL 3HE6D 4WO4A 2D2OA 2IQAB 3DXAE 4HKBB 4PJDE 1RK0B 2R0LH 1Z6JT 3VWJC 4JFEB 2NNAB 1PZ5B 4JPWL 4L8BA 1J8HD 1A14L 4KROB 1T0PB 4YO0A 1P7KB 3BIKA 3WS6C 5CSZA 1JNLL 1C16A 3QEQE 3V5HB 4QEGA 3ARSA 1KCSL 4NZTH 3TM6A 5ILTH 4N0YH 2XNAA 3RWHA 1T2QH 4Y19A 4AEEA 4LARL 1J1OL 4OLEA 4DVRH 4WW2F 4LVEA 4HS8L 1CE1L 1MCNA 2FR4B 3BPOB 3VXQA 5JUEH 4MJ6A 1ROWA 4ZUSA 1U8JA 5IB5A 4U05A 1V3JA 1IQDA 3CX5J 4LHJB 1JN6A 5FYKU 1Q1JL 2NLJB 5HYSG 3NH7L 2C4FU 1WQVT 1WFTA 5F6HI 1H8SA 1YQVL 5IQ9A 1DBMH 1EFXA 5TPWH 4P3DB 3GI8L 4AENA 1GC1H 3QQ3B 4C54A 1JGLH 5IGXH 5CBEA 4WEBH 3QIBC 5FYJL 3QBTB 3MODH 3DMMC 4Y8DC 2DLHA 5IIEB 3SDYH 2V6HA 3AAZA 1EJOL 4LRIC 3G6JE 4PJCE 2X4SA 1RJCA 2GITA 2EDFA 1MCKA 4D0BA 4XXDB 2HP4A 4F7CA 4UTAH 4OZ4A 1NEZG 3HPJB 3NA9L 3MFGB 1QQDB 3L3HA 4G7YH 4Q6IB 4DCQB 4QHUB 1RZKH 4Z0BH 5T3XE 1JGDB 3AM8C 4LNRA 4M7KH 4QOKD 1J0IA 1XCTA 4P2OB 2XTJD 5GGUA 1MF2L 4XCYA 1KPRB 3HR5B 4V1DB 1S3KH 4N8CH 2PTTB 4H1LG 3VG0H 2QJDA 4KJQD 1F3JA 5BS0B 4GMTL 1TTUA 4JHZA 3NOIA 4DW2L 3T2NL 5MENA 5DJDA 4DGYL 3FQUB 1EO8L 3U4EB 2DLTA 4FZ8L 1OAUH 1VEMA 3QJHB 3VFWA 4HT1L 5D7JB 5MEOA 4KKLD 3BEWA 2BX5A 5GRVK 4ONOA 1T03L 4G5ZL 5ID0B 1IEAA 1N0XL 4XWOD 3WFHA 4I0CC 1F00I 3AXLA 3CAFA 4E5XA 2DM2A 3N0PB 1S8DA 4C56B 4HUWB 2FIKB 2GIYA 5C6TH 3T2OA 2C1PA 4LEOB 1Q9KB 2V9RA 4WVRA 1DANT 3KWWA 3O8XD 3ULSA 1XIWD 4WV1C 3ZDYE 2IAMD 1DLHB 3TF7C 5CJQH 1ZLVH 3V6FA 1P7QD 4CW1A 2D9QB 3BKYH 1A2YA 2AV7A 1FV1A 4KQ4H 3U30C 5JMOC 4K55A 3F58H 1B4JL 1Y6KR 2EDBA 3S37X 4NQDA 2NX5B 2MCG1 1IMHC 2VL5A 2A73A 3CD4A 1XH3B 4QT5B 2GT9B 1X4ZA 4XCNB 3VXMA 5I8CB 2CDFA 5DSCA 1X5AA 4EI5C 3ZHDA 3MV8B 1CDJA 5KTEL 3GSOB 2FATH 3IGAA 2OR9H 4DWHA 2ADJB 1IAOB 2GTWA 3BIAX 4MXQC 3S35L 1L9NA 5C0AD 3T2QA 4M7JL 3F12B 1KIUA 3RTQB 3WLBA 1IAIL 1DEEA 1XF3A 4Q0XL 4RGMC 5GIRA 3RA7L 3WJJA 4EDXB 3PHQB 1RIUH 4PJGF 2BVQB 1LILA 4J1UB 1HH6A 2EKSB 2EICA 1AGBB 1CQKA 1UXSA 1MEXH 5EU5A 5FDYA 3MRGB 5GSVA 4DUWA 3VW3H 3T0EE 4UQ2A 4QLRA 3CX2A 3M1BA 2E8ZA 3GSVB 4HJGA 2ZNXA 4RMQA 4DKFH 4NIKB 4K23H 2WP3T 4M1CC 1WC7A 4S1QH 4ZS6D 1TCRA 2P44B 1T7XA 1R24A 5C9JB 2A38A 1INEH 5CEYB 4L4VE 3MLVH 3GZKA 3QA3A 5EULV 3VRJB 2V2XB 1KJMA 2UWEF 2DS4A 3E6HA 5JQ6L 5LVEA 5ITFB 4ISVB 3EDJA 1BIIB 1FC2D 4D2NA 4FA8A 4D8PB 4NKDA 4PJ7A 1UA6H 4JEGB 2C1OB 3FCTB 4JDTH 4RBPH 5DLML 4BQCA 4G6JH 2XQYG 4LIQL 3RU8L 1QLEL 4NBXB 4MX7A 1FN4B 1R5WB 2WBJA 3MRJB 2YA1A 2IQ9H 3CX5K 4GSDL 1RZFH 1MREL 5IW6B 3OAUL 4JDVB 4LHUG 4NM4H 4NWUH 2H2PC 3VD5A 3SE8H 3RBSA 4U1KA 4V1DE 3N1FC 4NN7C 3OL2A 1U8MB 1YYML 1UENA 1YEDB 2X42A 2OI9C 3KPTA 3DVFA 4M7ZB 4EUPG 4X98A 5BQ7A 1FGNH 4FS0A 5L0QC 1JWMA 3BQUC 1G7IA 3OJDA 5BS0E 3G6AB 4FFVC 4W6XB 4R0LA 4EVNA 2HG5A 1A22B 3IFOA 1D7FA 4N0CD 1K8IA 2EC8A 1TVBA 4I18B 4JCMA 4WUUA 4PLOB 1SY6H 2BNUA 3X14B 4I13B 3L3DA 2VKXA 3F8UB 1L6ZA 2X7LA 2FHCA 3C8KA 4JY5L 4KY1H 5DJYA 3RQ3A 5C8JA 4KKCD 2FO1A 1X5FA 3RUGA 1UC6A 1KT2B 2OZ4H 4M48H 3X11B 1JUFB 3UTSA 4C56E 4RNRA 4MLIA 3ZMRA 3TBSB 4NQCA 3LRHA 3THMH 4P59L 3MJ9A 5IV2B 1W72H 4P5TB 3VXUD 5LWYL 1MI5D 3TFKD 5EZIH 5EN2A 4YR6B 5T3ZE 4R96A 3SJVB 4QRSB 3G9AB 1DZBA 3LKRA 5SWZB 4X9GA 3TT3L 4HWEH 4H0HB 3TCLA 1D5BB 1HINH 2HA1A 3KYKL 4OZGB 2YOCA 1AY1H 3HI6L 3GKWL 1FIGL 4NM8L 3OKDB 2R0WH 4QRPA 3AU1A 4LSUL 4Q6YA 2Z91A 3GNMH 3MLTB 5ACMA 2DQFB 1QACA 4E41A 3KPRD 3KJ4B 3ILPA 1FNSL 2A6KB 4N1CA 4NRZB 1L7TL 1G1YA 4WIQA 4HFWA 1A6ZB 2JF1A 4NC0B 3WD5H 5DQ9B 1G7MB 4Z0XB 3QIWA 3UBXG 1NLBH 4L8SB 3SO3C 2VDRL 3H9ZA 5GS1A 5TE7L 1LO2H 3QEGL 1KPUA 2CRIA 5FYLD 4OAWA 2NXYB 1OSPH 4X7TB 2I24N 4P48A 4ENEC 1IAIM 1Z5LB 4KROC 3RVUD 4CMMB 1A1OB 1VFAB 4RQQA 1N6QL 3HLAA 2YBRB 5D72L 5FM5O 3VFPB 1N3NB 3OKNB 2PO6D 4PIRF 3KPPB 2GKIA 4V3DB 2BOCA 1B6UA 5GS2H 5BZWA 1NCCL 3CZFB 5EBLA 5HHOB 2BJML 4O02L 4BZYA 4DGIH 4L5FL 4P9HH 4V2CB 3BPOC 4YGAB 1U95B 1MCBA 2GJ6D 2BSRB 3QXVA 3BH9A 4EOWL 2P24A 5EFIB 1F97A 4YNYA 5E03A 1NL0H 1NCDH 5BV7B 3HAEB 1PSKH 1HYSD 2CXKA 4P46D 4ODXB 4BKLB 1JK8B 2PTVA 4LEXL 1UJ3A 2ZUXA 5FCUL 4E0RB 3MLWL 2LTQC 1LO5A 2FX7L 1W0WB 2CRZA 2VR4A 5DHXB 2VLRE 3MRHA 4JDZA 3ME0A 2HJKA 2J6EA 5GGSY 1R5IA 4OLVH 3R8BB 4GKSB 4P5MA 3U4BH 1WT5A 3WNPA 1GOGA 3RL1B 3W9DA 4L8CB 5C7XL 2LV4A 4K8RH 2ICWJ 4GG8B 2FRGP 3VFGH 2GJJA 5DHYA 3ALXA 3RWGA 1BM3L 2XKNA 3BHBB 3EFFA 3HNVH 1WCBA 2HN7B 2YSSA 3GHBL 4Q6IC 1BQSA 2HFGH 1BWWA 3GJFA 3Q0HA 3QJFB 5E8DL 1BJ8A 2P43B 1DN2A 3QFJA 5EBGA 5HGDB 1Y0LB 3IDXL 4P2OC 3ALWA 3LQAH 2R8SL 1U8KA 4LQFL 1WBXA 2JJWA 1SEBB 5FA4B 2YN5A 4XNQB 1BZ9B 5MP6H 3VGEA 4AMKH 1K3ZA 1ZT4A 2HVKA 2XWTA 3IDNA 1BFVL 3BDYH 5DTFA 1XR8A 1IKFH 4NUJA 2W65A 3O41B 2EDEA 3IKCB 5DMKA 3B6SB 3MJ7A 2HMIC 3OPZH 3QUZA 5D7JC 3QNXA 4FFWC 5DD6A 5IUSA 4UV7H 3OHXA 1V3LA 3GMRB 1GGBL 4GW4A 4J12A 3O45B 5EU4B 5F7MC 3SJVE 2P1YA 3D6GA 2A6JA 5JQHC 3R0NA 5SWZE 3LKSB 3CLFH 3HS0A 5ESVB 1B0GA 3D39E 3FN3A 4TUJA 3VWKB 1BFTA 4NQEA 1JVKA 1K4DB 2V2TA 1UKTA 3R0MA 2VZ1A 1KXTB 4HUUA 5IEHA 3V79C 2AV1A 2DQUH 5HYJB 1AQDB 2PXYA 5ILTL 3HUJE 4N0YL 1WAAE 2Z31D 1WGOA 3S4SA 1G0YR 4ZNEE 2XFXB 5J06A 4NOFA 4M61A 4L4TB 3HNTH 2OSLB 3WN5B 3QDMB 2A9ML 4KHTH 4WHYG 2X4RA 5E9DB 3GI9H 1IGJB 3TVMA 1A6PA 1CGUA 2DF3A 3OR7B 2BOBA 2EDRA 1OTSD 1HSBB 1XGUB 2R1XA 1YEKH 4XP6H 5E8OA 5IMKB 1UWEH 3P3YA 1UACH 5CP7B 4FABL 3QRFM 2O61A 1DBML 3LD8B 3TZVA 2HKFH 2J8UB 3QG6A 3RTQC 1YY8B 1DCLA 4WEBL 1J88A 1FL5A 1TENA 3MODL 3ZE2E 1Q94A 1KCRL 1YUHA 3O2DA 1F2QA 5HHOE 3DROB 1T89C 1DUYB 2XZCH 4UTAL 4IIQB 1SVCP 4OCRL 1QFOA 4P49A 5JPNA 5BW7C 1EHLL 5EUOA 4LCWE 1MCPH 4G7YL 4OCWH 2P46B 1RZKL 2GY5A 2A83A 4JFHE 1JGUL 3U0TB 5C3TA 1YEGH 1MRFH 4N9GB 1WTGT 2VN4A 1P53A 4I5BB 2MOVA 4PJ9D 1IKNA 1N59B 3GO1H 2GUOB 3GM0A 4N8CL 4Y7MA 3V0AC 5HDOA 4CUCA 2A77H 1QSFA 1H15A 2VISA 2R1WA 1N64L 1VACB 3BWUC 5DK0B 4UAOC 3C8HA 3RWFA 1I7UA 2DTSA 1ZEAL 5EU3A 3B9DA 5KSAB 5D1QA 4WO4B 5DZLA 4PJEA 1Z3GL 5C08D 1OW0C 3J7HA 3QFDA 1A1MA 4L8BB 4ALAH 2E7LA 5DD3H 1TJHL 5ACZA 1LVEA 4YO0B 5CEZE 2X9YA 3BIKB 3DX8A 4GG6A 4WTXA 4LASH 3BE1L 5CSZB 2R0KH 2ZZUT 1I3GH 1C16B 4M7ZC 3OF6A 4UBDC 4G9DA 4KMTH 2XNAB 3RWHB 1KLFA 4Y19B 3RIAF 2BSSA 1DQJB 4KQ4L 5J11B 4KDVA 1ZE3C 1Z9MA 1FGVH 2Y9RT 4OLUH 1XF5A 2CLRB 4TSCL 4CJ1A 4DEPB 3KPSD 3VXQB 4F7PA 43C9A 4I18C 1RUQH 4MJ6B 3IXTA 4O4YL 3SBWC 1U3HA 4ZUSB 1U8JB 5F71A 2IEPA 5IB5B 3DYOA 3T4YA 5TF0A 1IQDB 2FATL 5B38A 1JN6B 2OR9L 3NAAL 4Y1AD 3GMQA 4N0UA 1Q0XL 1HDMA 2ARWA 2OTPA 2Y6SD 1A7RL 3DTXA 1INQA 1TDQA 4TTDD 5IMMA 3W11D 1HHIA 5IQ9B 1B2WL 4IEFB 1WFUA 2G60L 1EFXB 3LPGA 2YZ1A 3WJLA 4AENB 2J7LA 4P5TC 5KOVC 1U36A 5CBEB 3VJ6A 4FZEH 1A21A 1S78D 4JRXD 1OD7A 3MACL 3I50H 3AAZB 2EEBA 1V7ML 1MEXL 3VW3L 1QTYT 2X4SB 2GITB 4D0BB 4F7CB 3LN9A 4OZ4B 5TE6H 3G6DL 2NY7H 3L3HB 1RFDH 5J12B 4JVPA 4IMKC 3NCJH 1BVKA 1RUMH 2ESVE 4LNRB 4K23L 5E94A 3GSRA 1XCTB 4WEMB 4XI5C 5GGUB 4XCYB 1BQUA 2J8UE 3MLVL 1LO4L 3ARFA 4MJ5A 5F7LB 3KJ4C 4GAGH 4Z7WA 5LCVH 4XC1H 1F3JB 1D5IH 1CLYL 3VGAB 3WXVL 1B0WA 3BRDA 1I9IH 2JJTA 4K9EL 5DJDB 3O3AA 4F2MB 4R7NA 4KTYA 4L8SC 4WWKD 5I1LA 2D7OA 3VFWB 5DEGA 4GKZA 3SQOH 1UA6L 1YC8A 4JDTL 4G6JL 5CP3A 5MEOB 3DNKA 2NXYC 3C9NB 4PYGA 2C4FT 3BEWB 4NN6B 4N5EA 5D5MA 5K9JH 1NBQA 5T5NG 1IEAB 1FP5A 1RZFL 8FABA 5C0ND 4JKPH 1DQTA 4M8VA 2CKBA 3WFHB 2EDTA 5JORA 4ORGA 4NT6A 3OSKA 4E5XB 5AG8A 3WO3B 3SE8L 4M6MH 1S8DB 3NTCL 4Y4KD 1NMAH 2C1PB 4NCDA 1AKJD 1FGNL 2DBLL 3ULSB 3V6FB 2Z8WC 4CW1B 4CAGA 5KSVA 1A2YB 1FV1B 5HJ3A 1PGRB 4KZEH 4PS4L 5ICZB 3RP1A 4NQDB 4PJBA 2CUIA 2L0DA 1P7HL 1SY6L 4M5YH 1X5HA 2VL5B 2A73B 1CXFA 3VXMB 5DSCB 1KFAL 4KY1L 4YHYB 1ERNA 3IGAB 1ADQH 4TRPL