3RTQC

Structure of the mouse cd1d-hs44-inkt tcr complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
203
structure length
203
Chain Sequence
b'TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural and functional characterization of a novel nonglycosidic type I NKT agonist with immunomodulatory properties.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2011-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rtqC02
3W9EB 3LEVL 4L8BB 1KEGL 4JFDB 1B6DA 4NGHH 1INEL 3GMQB 3HI1A 2R2HB 3WN5B 1A0QH 2AK4A 4AMKH 5BCAA 4YDLC 5DLMH 3MNZA 3L5JA 3UJJH 1MFDL 3TNNA 3V9FA 2DM7A 4JPKL 1MLBA 1RZKL 2GI7A 4Z7NF 4HC1L 1U3HB 2V7HA 4UAOC 1RIUL 1OAZL 3HNTH 4NT6B 4I77H 4Y89A 1OAKH 5TE6L 1X6NA 1AFVL 1MFEH 1EGJA 3MZGB 4GG6F 5IFJA 5HHPB 1A7BA 4N0YL 1ZLWK 3L9RB 1GH7A 4J4PD 5MEQB 3QPXL 2EC9U 1N8ZA 3UTZB 2MCPH 4ZAKB 2SEBA 1DQTA 1DLFL 3BQUC 2BNRA 4NJ9H 2GYSA 2J2ZA 2YZ1A 4NC0B 2EE2A 1V3KA 3FN3A 3DVIA 1ACZA 3C6SA 2NLJB 1OHQA 4WU7A 3UDWA 4P2OC 4P2QA 3ZE0E 4ERSH 4PLKC 4RMSA 1QRKA 3RWCA 2AJUH 1T7YA 4KWUA 4XP1L 2ZNXA 1UM6L 4FMFA 3ZT7A 4ZFOB 2F19H 2J6EA 5KG9A 4JZJC 2A1WL 3PWNA 4O4YH 4Z7NE 1B0RA 1EAJA 1NGYB 4ODTL 4HT1L 2BXZA 2P8MA 3RNQA 2CXGA 3ULSA 2D0FA 4YXHL 1OLZA 3QUXD 1RZFL 5KTEL 1KCVH 5IKCA 1EDQA 3DRQB 2ENSA 4EUPH 2YUXA 1NCNA 1J1XH 3HG1D 3UX9B 1KJ2L 3MJ6A 3OJDA 5E6IC 4TTDD 3TN0A 4EEEA 1JTOA 2KQNA 4PR5A 3IU4L 3WDHA 2AK4B 1N3NB 1LO4H 2VDLL 5D96B 3RRQA 3TNNB 1RZIA 1T1ZA 4QRPB 2W9DL 3PWPA 2DLFH 3HAEA 5KW9H 2XKUA 4UIMB 2V7HB 4GRWH 3K2MC 4B5EA 1RZKC 2ERJC 3WBDA 3LKNA 2ITDA 3IDUA 2DQUH 4QOKD 3FQXB 4M1GH 3HE6C 5TPWL 4PG9A 1PYWB 5CD3A 5GS0L 3MLTA 2UUDH 2AJYL 3EHBD 5FO9B 2NZIA 1JL8A 4UNUA 4FQ2H 1N8ZB 3PP3K 4YLQT 3IAQA 5BV7L 2SEBB 3GSOB 1OAXH 3KPQB 3FHAA 1MEXH 2BNRB 4IMLA 2XN9E 3D6GA 3ARGD 4LQFL 4MNHA 1FNAA 2W0PA 3J7HA 4LOUD 3C6SB 1D5BB 4GBXA 3SE4C 4OV6F 4PV9A 4P2QB 3DMMD 2XICA 3ARFB 4FXGA 3RWCB 2QEJA 2XTLA 1BQHA 1H3XA 1Z6JT 4FNLL 4MQXC 4ZUTB 3MLZL 4P2RD 2CO6B 3VCLA 3T0EA 4Z0XB 3WDJA 4OZIA 2H1PL 2VLKE 5DO2C 3V6OA 3GIVB 2EDRA 2OSLB 3BHBA 4L4TD 1IEBB 4R6UA 5GGTH 4JREB 2CGRL 3U7WL 1CD9B 5KSAC 4MAYB 3ARQA 4NN5B 1PEZA 2Z9TA 5I8OH 1K3IA 1AQDB 2UYLA 3B9KB 3O4LA 1OL0A 3SDCC 1NAMA 4XC1L 2IH3A 4HHAA 5MI0B 2AQ2A 5JMRA 1IAIL 4GKNA 1IQDB 3OL2A 3UBXG 4FFWD 5IHUL 3KYKL 3BUYA 2ZSVA 3P40A 4JRWA 3BMWA 4K7FB 3OJDB 2IH1A 1KJVA 3ZKXC 4XPAL 5E9DE 1U58B 3RZCA 1RK0B 2WZPD 3V0AC 4YFLI 1KT2B 3BN9C 5E8OB 4DW2H 3Q5YA 3G9VA 2MKLC 4MLIA 4WNQA 4F7CA 1RZIB 3PWPB 2EE9A 2VXQL 4KUCF 3C8KA 1SJHB 1AQKH 1U8MA 1BP3B 3MACH 4LAJH 4K9EH 1BWMA 2FX8H 4OF8A 4LP4A 3LKNB 4F57L 4LFHD 5C0CA 3QXAA 4P46D 2B4CH 2E9JA 4PG9B 1KEML 1J11A 5CD3B 1E4XH 2ZCHH 3VD3A 1QR4A 1NBQA 1NGPH 4IJ3C 4U1GC 2WWMD 3GO1H 3MLSL 4O2FA 4NM4H 2ADFH 4AM0B 5GS0C 4LMQE 4MQ7B 4XBEL 3SKJH 3SKNA 3W11D 4PRPE 3FOMB 4KXZH 5ETUB 3ISWA 3C9NA 3HS0B 3H2WA 2W0LA 2VR4A 3ARPA 2J5LB 3HRPA 5BV7C 4MHHI 4WFHD 1GRWA 5INDB 3VRJA 4YDIL 4BH8A 3O2DH 4GBXB 1JYWA 3UXFA 4N8VG 4PBVC 1LEGB 1JWMB 5DMYA 4ONHA 1BQHB 1QSFD 5C8JB 3T0EB 2ZPKH 1MF2L 4KMQA 5I1HL 2JCCA 4OBRA 1AD9A 3BHBB 3QCTL 1EHNA 3O6LH 4ZTOH 5CIPA 1VSCA 5K93A 4Z7UA 4JN2A 1INDL 3D3VE 1MRDH 4JPIA 4HF5L 2JJVA 3GM0A 2UYLB 3O4LB 4FQLL 2QSVA 2IH3B 4HHAB 4CMHB 3LHPL 4GKNB 3S8WA 1ZLSH 4M1CD 3VGGA 4M6MH 3VDAA 2ZSVB 4J2XA 1AXTL 1Q0YH 3FQUB 3BKJH 2OL3L 3IFPA 5E2TL 1IGJB 4HXAL 4OLVL 3RZCB 1JWSA 3SOBL 4AIOA 4F9PA 3NFPA 1U8NA 4WW2A 3GI9H 2MMXA 4WNQB 1H5BA 2NY1B 1YNTA 2LU7A 1ZTXL 1NUDA 2VB5A 1EK3A 4FFYH 1AC0A 2XKSA 1U8MB 5FDWA 3P11H 4ALAL 2Y5EA 2I25N 4V2BA 2HJLA 3GI8L 4LARH 5EU6D 1QR1B 1T5XA 3KJ6L 2VL4A 3IDXH 5ANMA 4QTIH 4WFED 1EO7A 3ULVE 5IOPA 4AEIL 3QG7H 5IP4A 3LQAC 4D3CH 1IGCL 3EYFB 4Q6IC 2DQJL 2R0ZH 4M7KH 4O2FB 4RAHA 4I0PA 1R24B 3LPFA 2GQHA 1S9KC 1DN0A 4JGUA 2COQA 5CINL 4XZUA 1JHLL 1ORQB 4WUUA 4QRRB 2B5IC 3NPZB 1LE9B 4GKSA 4WI8A 1JYNA 2BNQD 1W0YT 4JG0H 1P4IL 3CXHK 5BQ7A 3VRJB 3PP4L 4BH8B 5GISH 5GGSY 4ELKA 4ZFGL 4MNGB 1BQLL 5J06A 3QCUL 4FQIL 2BVEA 5I19L 1I1FB 1NCBH 4OGAC 4ODUA 1AD9B 2EZ0D 1FFOA 1WCBA 5DUMH 4E41E 5CIPB 4DFIA 5BW7C 1NKRA 1T1WB 4Z7UB 1I3GH 4JN2B 2E5EA 2ICCA 3FRUA 3WO4B 4MA8H 1JGVL 4HK3N 5D1ZD 2FECL 3DX8B 4NM8H 2DL2A 4MAUH 4UTBL 4PGDB 4RFOH 1XF3B 4HW6A 5EFIA 3CMOH 4QTHA 1CLZH 5D1QD 4S1DC 3HRZA 1ONQA 1ED3A 1N2RA 2AI0L 4QO1A 1EJOL 3IFPB 4DVBA 1UWEH 4N0UE 1JWSB 2PETA 1U8NB 4WW2B 1NCAL 5D7JD 4R90L 1N0XH 1H5BB 3MLVH 3GBML 5E2WH 5HHOD 1X9QA 2NR6C 5FDWB 1M05A 5FO7A 3P2TA 3G5VA 5AAWA 2HJLB 2HRPL 1HHJA 4MWFB 4YHMH 1T5XB 3UYRH 8CGTA 1Z9LA 4WFGD 5ANMB 3AREB 5HYFA 2IANA 4PJGA 1KENH 2DYPD 3IF1A 4J3VA 5I1KL 2BRRL 4X9IA 4EQ3A 3GSWB 3PGCB 3RIAK 4OD3H 4F15C 2EECA 4NC2B 4QRSA 4ZO7A 5T5NG 3UZQA 4PRNA 4I48A 4WI6A 4WUUB 1OF2A 1K6QL 1HHIA 4GKSB 2OJZL 5D93B 4K3JH 5BQ7B 5ENWA 4IRZH 5BJTB 3VG0L 5CEZL 3QQ4A 4L4VD 1KTDB 3SE8H 4G5ZH 3CVIL 5HJ3A 1BZ9A 4ODSL 1FFOB 1WCBB 1I3VA 5TQ2H 3X3FH 1P2CA 3AVEA 1QUNA 4LRNL 4M1DH 1QSEA 3O8XD 3QXVA 5GRXG 3ZT6A 1T80A 1AXIB 1T1XA 3VMNA 3V5KA 1UM4L 4YXLH 1WLHA 2JELH 2NY5L 5JHDA 2Y07H 3GSNL 2L7JA 5CBEB 4TULH 3K8LA 5IROA 3HRZB 2CIKA 1ED3B 3BKML 1N2RB 4ZOBA 2OBGA 2PW1B 4DQOH 3K4ZA 3NABH 3K7UA 1AGEA 3O3DA 5DZNA 4OM1H 4Y1AE 1A1OA 1VPOL 4DCQB 3CCHB 2Q87A 1FFQA 2HFGH 5FO7B 3MV7A 4HLZH 1K8IA 3G5VB 1JRHI 3MBEC 3MQIA 4Z7OF 3V6ZB 1CD8A 4NQUA 1I7TA 1OP3H 5I6XC 1WICA 3MYJB 4JO1H 4G6KH 2IANB 3BGMA 3SGKA 4BFEA 5FF6A 5A1AA 1BFSA 1WT5A 5L0QB 5T3XD 4PRBA 4Y8DC 5T5NF 3WXVH 3C60C 4F37F 3E6FA 5E4EC 4PRNB 5D70H 4I48B 1OF2B 4CADB 3DI2B 4HZAA 1HHIB 1MRFH 5H35A 4S0TD 5HHMB 4EI5D 1CICA 2FIRT 3SE3C 3MRGA 1UJ3A 3KYOB 4ENEC 4KVCH 5SV4A 4ZFFB 4NQCE 3RTQC 1MJJB 1YNKH 2ICWI 3HPLB 5D7KE 5FO8B 1YEIL 5L2KA 1XF4B 2AEQH 4PJ9A 1W72H 1JPSH 3L3GB 5DK0A 5HJ3B 1S7XA 3ELAT 1PEWA 1O0VA 5T3ZD 4PJFF 3ZL4L 1P2CB 5HGBB 1LVEA 1JNNH 2CQVA 4F7PA 4Y2DD 3TO4D 1P1ZA 1S9VA 1J0YA 5L8LB 1T1XB 3IDIA 4TVPL 4ONFL 1AGCA 1FDLH 4CVZA 4W4NA 4WVRA 1F58L 5JHDB 2R4RL 5BZDA 1BX2A 4OIIH 5GGQH 4XP4L 3QIWA 3W5MA 2NY5C 2CIKB 4UINL 3AB0C 3MBXL 1ZGLP 5EBMB 3B5HA 4CN6A 4Q9RL 3QWOA 2VDRL 5LXGL 3AXLA 2WUCL 3VH8G 4YQXH 1AGEB 3O3DB 3T2NH 3WS6A 1V3MA 3WUWG 5GHWH 2A9ML 3MOBL 2DQHH 2VLJD 3MV7B 4L3EA 5DA0B 5IBUG 3HB3C 5I74C 1OTUC 3RU8H 1EVTC 3HHRB 4X4XA 5D8JH 5B8CC 5JMOC 1AH1A 1B3JA 1P84K 3W0WE 4HJ0C 1I7TB 3LV3A 3TPUA 2R69L 2BOCA 5ALCL 3DV6A 1FL3A 5TDNB 2R1YA 3WIHA 3D39E 5C0BD 4PRBB 5L8KB 4PB9L 2AJSL 3E6FB 1AJ7H 1NUNB 3SDDA 4BUHA 5GS3A 5JDJA 2C3WA 5C70A 1DBMH 5E6ZA 1QSVA 2X41A 3DX7B 4YPGA 5H35B 1CICB 1HYSC 5SX5H 3HNVH 2IALA 1HINL 1BZQK 2P42B 3F65A 5I1GL 1DLHA 3RI5F 3CX5K 3U0WH 5L2KB 5HGDB 4PJ9B 5F7EL 5DK0B 5BS0A 3C6LD 4QXTA 3HZVA 2APFA 3ARBC 1T66D 4KKAC 3WLBA 4WWKB 4G8GA 4ZYKB 2P44B 4F7PB 3QAZB 1S9VB 2D4DA 1FAIH 4QXUL 2R15A 3IDIB 3ARDD 4LVHB 1QFUL 3ECBB 4CVZB 5T3XH 2ZSWB 4U1LA 2W0FB 5T1LD 5BZDB 5C9KA 1BX2B 1C1EL 5CKAA 1RZGB 1S78D 4UI2A 3QIWB 4XPHL 5DJ2B 2Q8BH 3MV11 1OLLA 4ZFZA 4F58H 2FBJH 2FEEL 1F90L 3RGHA 1TTUA 3N0PB 5CJQH 5AYUL 3DYOA 4GAGH 3AXLB 2DL9A 4HIIB 3S5LG 1FSKC 3RAJH 4OCSH 3DHJA 2CD0A 3TFKD 1ZSDB 1NJ9A 3CZJA 1MFCL 4L3EB 4X9BA 5C09D 4XRCA 5B4MD 5T3ZH 4X4XB 4OD2A 1KPUA 3OKDA 4OF0A 3NZ8A 3LV3B 3TPUB 2HLAA 4YHLL 2BOCB 5F96L 3DV6B 5DA4A 3SDXF 4KMTL 3TM6A 3ZKSD 2R1YB 4BSWA 5ISZD 3PV7A 3S35H 4KDTA 1IGTA 1I7ZA 4K3DH 3ULUC 1ES0B 1MJUL 2NXYD 5IVXE 4G42A 4ZNEA 5FB8B 1EJ6A 3GHBH 5DJXA 4WHYH 4YPGB 5SWZD 5EULV 4JFED 2QSCL 1W0WB 1UB6A 4IRSD 12E8L 2RB8A 4F80A 2UVFA 4LMQI 3QUYB 3AUVA 5E2UL 5FDYA 2HG5B 3BSZH 3VDBA 4GUPA 4JGMA 3DX9B 1AY1L 3BYYA 4QXTB 1IJ9A 4J6RL 4YGVA 4GLRH 4KI5C 4NP4H 1ADQL 3GFUA 2NY6B 4OB5H 4DK3A 4UIKH 4XCFH 1RPQA 4LSSH 1P7HL 4U3CA 4HG4K 3BGFB 4P23A 1OT1A 2VKWA 1T0MA 5HHXH 4OFPA 5I73C 1RUMH 4I18C 4JANB 3D2UD 5KS9B 3QDHA 4U1LB 1KC5L 2IMMA 2EE3A 3HMXL 4OSUH 3SGEH 3GUTB 4I13B 4ZOCA 3RNKB 4XWOC 4LSVH 4ZFZB 3CLFL 4GQPH 3DI3B 4P4KD 3NH7H 5H94B 4LCWA 3CMGA 3F58L 4KHXL 3T08A 3VXME 5J8OA 2JIXD 1TNNA 5CCKL 1NJ9B 5CZVH 4OGYH 2XZCH 3V7AE 3AY4A 4OD2B 3OKDB 1Q9WA 4HGWA 1TZIA 4X6EA 2HLAB 3X12A 2B1AL 1FIGH 5M94B 3EO0A 1H8SA 1GHFL 5DUPL 5IWLC 3IFOA 5A3ID 5L2JA 4BSWB 1UCBL 1JZ4A 3O45B 2VL5B 2HTLC 1IGTB 1I7ZB 4JB9H 4KJYB 3RWIA 3DXAA 2NX5D 1UCTA 2XQBH 3UZEA 1FZJA 3U30C 1D5IH 5DJXB 1G7HA 3VWKD 1P6AB 5TJWK 2O5ZH 3TCXA 4LIQL 3KWWA 3NOIA 2LABA 1G7LA 1UB6B 3MRJA 1R3JA 3WNOA 4HUWB 3FT2B 5FHAL 1FRGH 5T1DH 3TYGL 1IC5L 4K23L 5I66A 2GIYA 2VC2L 1JNHA 1U8PB 4GUPB 2HH0L 3UJIL 1FYHB 3MR9B 1DQLL 1H0DA 4BZ1H 1YNLL 4M48L 1KTLA 4K3EL 1NANI 3SCMB 5J12C 1A14L 2X1OA 2IGFL 1XZ0A 3SDYH 2R2EB 3NFSL 5D96C 4AQ1B 3TCLB 4U6TA 1FVCA 2B2XL 2IFFH 4G9DB 5KBNC 3IT8D 4J1UA 5HVGB 5DI8A 3RWEA 1G7MA 4HX1A 5HI5C 2P1YA 4O58H 1RUAL 3N85L 5IMKA 2AV1A 2D03H 3GJFA 4M62L 1OP5H 5HVHB 1A6VL 4LCWB 5K9KB 1GYAA 4TNVF 3TJHD 4L9LA 5EA0L 1VEMA 4GW4B 3N1GC 2YN5A 4Y16C 1G9ML 4FQ1H 3GRWL 4ZDHA 4ZODA 1GOGA 2XACC 4PJEE 2BC4A 4ACPA 1P6FA 1INQB 1Q9WB 4HGWB 1TZIB 3X12B 4OFYA 3JTSA 4H88L 1HK6A 5HDQL 4HUKB 5L2JB 2W9EH 4LLQA 4YR6A 3OF6A 3ARFC 4BELD 4OZGE 3WD5H 1EVUA 3FO0H 2XRAH 3RVXD 3CFBB 3UTPE 2HFFA 3MUZ1 5KZCB 3MLYH 4EJ1C 4TSCH 4R97C 2Z31C 5IM7A 3DARA 4JREC 4MX7A 2EKSB 3NCBB 4M4RA 3MTRA 4MB5A 5CZXC 2X4PA 2BHUA 4I9WD 1G7LB 3MRJB 1R3JB 4K94L 2J3SA 25C8H 5EU5A 2GSIA 2IPUK 1KFAL 1MUJB 5MI0C 1DSFL 2I07B 5I66B 2EIDA 3OKLA 4QHLA 3MREB 2PTVA 1N6VA 3DRTA 4K2UH 5B3NA 1IT9L 3DVNA 3QEGH 4N9GA 2QQLH 1H0DB 2J12B 1NFIB 1KTLB 4NQVA 1R3IL 3U36A 3SJVE 4X7CC 2ICEB 5IG7A 2ZUUA 3VGAB 5CSZA 1UWGH 4DAGL 5C3TA 4UU9B 4XMKH 1FVCB 1LP9F 2X5PA 4G3YL 4RAVA 1X5LA 2ORBL 3RWEB 2X4SB 4IIQA 4HX1B 4OCXL 3K0WA 1VGEH 2NW3B 2E6PA 2R56L 4FQCH 5IT2L 2KZWA 2P8LA 2ZUVA 1NLBL 1G7PB 1XCQA 3VRLF 3K80A 3GJFB 1ZVSA 3OR6A 5FGSA 5HYSA 4MGXA 4Y4KB 1VFUA 5MP6L 3V4VL 4PP2B 3WFHB 4PJIA 3HZYA 5GGTA 1J0IA 2NTSP 5EORL 1G9MC 2QV2A 5ERWA 2BC4B 4P4RB 3VA2C 5FK9A 3SKMA 4Y19E 3QHZL 3JTSB 4NC1C 3C09C 5C0AD 3C2AH 1MHPH 5ESVA 4LLQB 3TT3L 4EUPB 3U82B 3V2AR 5E08H 5IB2B 1TETH 1D5XA 2EIZB 4O2CA 3VXRE 2ZJSL 3HMWH 1QBMH 3GDBA 1HCFX 5DEFB 4BFBD 4DTGH 5IM7B 2VZUA 2YPLB 2DKSA 5DJ8A 1IQWH 1AKJA 3OJMB 2FJFA 2X4PB 1T04A 3GSRB 2CR6A 5EU5B 5JA8B 3PWJA 5DC0A 4LCUB 2GSIB 2NY0B 1ULVA 2EH7L 4CMHC 3WE6A 2IG2H 4K94C 2VXTH 4PJAA 4JQXA 5IW1A 3KPSA 2MNUA 1XGTB 3DRTB 4N5ED 4S1RH 2PN5A 4YUEL 3RY6C 2LTQC 3GBNH 2Y06L 3HC0B 3MV9E 4WUKH 1TTFA 4NRYA 4WI9A 5FYJL 3S4SA 5GXBB 1FJ1A 1CYGA 4IRJA 3FRPA 3LD8B 5T5FH 1TITA 2NY1C 2RQ8A 3UP1A 3C5ZA 1XIWC 1ITCA 1YDPA 4XMLH 3MLRH 4IIQB 4TUJA 4KTEH 2MPAL 4AIZA 3O2DA 2P8LB 1XCQB 1EO8H 2XPGA 4F7TA 1NBZA 3QDMD 1OGTB 2BP3A 4KC3B 4JY4A 1S7UA 3GSQA 4PJIB 3WNPA 3MGOB 3QEUB 4EOWH 1FNSL 3QWQB 3B9DA 2X4QA 8FABA 1IGFL 5KVFL 3BPOB 5ERWB 4W70A 4HCRA 3G6JA 3MOAL 1ZWIB 4XAKD 5FK9B 5IJKA 3SKMB 1G9NL 3QIBA 3WFBL 4NRXA 3OXRA 2DQIL 5ESVB 4OAWA 3B4NA 4MJ5A 1D5XB 4KUZL 1EMTH 3D87B 4DN3H 1UEYA 3VGHA 1DFBL 1KJMA 1OT2A 4P49A 4H8WH 1U91A 4P2OD 2DBJA 2ICWA 2NMSA 1JK8B 2XI9A 2X89A 4PLKD 5DT1H 2V2TA 1BVLA 1OAQL 3A6BL 3ESVF 3ZHDA 1T04B 2PUQT 5FUZH 5L88H 3PWJB 2VXSL 2IPKB 2NY4D 3KLAA 2FATH 2HVKA 4F7EA 3WE6B 5DWUH 4QWWC 1HHKA 1Z3GH 4PJAB 3KPSB 5IW1B 3M1BB 5JIKA 5IVNA 1GGYA 2HJFA 2W65A 3EZ8A 3MA7B 4GOSA 3HI5H 3VG9B 2M1KA 1ZK9A 3JV0A 4PJ8A 3TVMC 3WO3B 2NY3D 1RULL 4NRYB 3LRSA 4NQDA 5F88A 2D7TH 4ODVH 3S4SB 2HFEB 1NCDL 3QUXB 4IRJB 1N6QL 2P8PA 5C07E 4Z78B 1KCRH 4NN6B 3HG1B 1D3CA 3JWDL 4KKCC 1HIMH 3C5ZB 1NC2A 4KGLA 1YDPB 3S37H 4GG6A 4D2NA 5A2FA 3FN9A 4AIZB 3JTTA 5MEND 3QUMH 4PUBH 4D8PA 3I2CH 3VXOA 3MRDA 1KIRB 1QG3A 3OKEB 3RPIA 5K33A 2XPGB 2Y9RT 4F7TB 4W4OA 1UM5L 3X3GH 3OX8B 1KB5H 2B8OT 4FQXA 4JY4B 1S7UB 1ETZA 3DVGA 3GSQB 3I6KA 1IL1A 4I3SL 2DJSA 1CFQA 5HI3C 5K9QI 1AHWB 4MJIE 2ATPA 4LKXB 2X4QB 4QOKB 4JO4L 1MCKA 4FTVE 3ARRA 3G6JB 3P9LB 7FABH 2Z91A 2GT9A 2AXHA 5K9JL 3QIBB 2YK1H 4PJXE 4NRXB 3H3BC 1I3RA 1QKZH 4ODHL 1G9NC 1YJDH 4ZXBD 5LCVL 3MLUL 3OAZH 4OAWB 4MJ5B 4DKEL 3ARGB 2IADA 4OKVA 2G2RA 4BH7A 4Z77A 1KJMB 3NAAL 4WHTB 1U91B 3BP4B 3O2WH 4NZDA 4CU7A 1QEWA 1WFTA 4XP9L 4JPVL 5TF1L 3MFFA 4LSQH 1BVLB 2XN9A 5KJRH 4N0RA 4MDIA 5ECJE 3MRHB 5CP7A 3KLAB 2ATKA 2HVKB 3DETC 1HHKB 5HD8C 1TIUA 1V7ML 5CD5C 2E7LA 1TMCB 5FYKL 3PL6D 4KRMB 3CPLB 3SDCD 3QQ9C 3UC0H 5EIVA 2X4RA 1PG7X 4NQDB 3BAEL 2Q6WB 5FKPB 5C71A 3SEPA 3T2PA 2I9LA 4F3FA 1XGPA 4ONOA 1LWRA 4MCZA 3FN0L 4OQTA 3CNKA 3AM8A 3FB5A 1ZANH 3NIDF 5L7XH 4XXCC 1VACA 4GG6B 3JWDC 1BF8A 1F13A 3JTTB 5A2KH 5IR1B 1PFCA 4D8PB 1ZT4A 5GRJH 3WS3A 3VXOB 5B39A 3B3IA 1FBIH 1IC4H 5F1IA 3RPIB 2PR4H 1CR9L 5E9DA 5I1LA 5H2BB 2BX5A 5JXEA 3DVGB 1ETZB 4R8WH 1AI1H 1IL1B 1NL0L 4NZTH 4EI6A 1CFQB 1CK0L 3BJLA 1ZHBB 4KY1L 4KI1A 2DDQH 1UACL 1DQDH 2W9LA 4P46B 1FPTH 4Y7MA 4X6FB 2CKNA 4RAUB 3CFEA 5IESL 1D5MB 1A7OL 2Z91B 2GT9B 5DGQA 2BSSA 1PD6A 4EKXA 2ZG3A 4NNPL 3CJJA 4WTZG 2CMRL 4Y5YA 4OKVB 3MYZA 2GJ6E 2KH2B 3AS0A 1AO7A 3LEVH 1CS6A 4QGTA 1KEGH 4Z77B 1INEH 5TDOB 3TBSA 2YD4A 4OGXH 2WIIB 4GKZA 3MFFB 5DQDL 1MHHB 4KJPC 3QHFL 3W9DA 5CP7B 1MFDH 2R1XA 4JPKH 1RZKH 4HC1H 1SQ2N 3RX8A 5ID1A 1RIUH 5TE6H 2OZ4L 1AGDA 3OKNA 3PDOA 1AFVH 3P4MB 4Z7VE 3VFOB 5DDHB 1FNHA 2Y4SA 5EZIL 1MI5E 4ELME 5D4QA 1FVDA 4OZFG 4DZBB 3QPXH 4RX4D 5JA9A 3D3VA 2K9UA 4MCZB 2A73B 1DLFH 2QLVB 2D0GA 1VACB 3MNVB 3MRBB 5F7DA 3OB0H 5JOEA 5A16B 1C5CL 3B3IB 4L8DA 5F1IB 5D7JA 2VE6B 1B4JH 3TH3T 3BEWB 3VFSA 1EH9A 5I1LB 4XP1H 1Y6NR 2HJKA 3GJFK 5IVOA 1DE4A 1UM6H 1H8OA 4EVNA 2CUMA 5EU6B 4B7LA 2A1WH 4ODXA 1JWUA 3F7QA 1PKQB 5L8JB 4HT1H 2VLLA 4O51B 1J1OH 3TBYA 2WBJD 3I3BA 4YXHH 3QEQA 1RZFH 5KTEH 1VB9A 2BDNL 4FQHB 2P24B 3DECA 4ZS7L 5E7BA 4XWGL 1AO7B 1JPFA 1KJ2H 2BNQB 2V7NA 1ORSA 4RIRA 2VLKD 2FO4A 3TBSB 3IU4H 4JPWL 4GKZB 4EDXA 4JFQA 3ZDYE 3QAZC 4U1HA 2BY3A 4NFCA 2VDLH 5IV2A 2W9DH 3MRLA 3WMSA 5EUOF 3V52H 4NHCL 5CKGA 4LHUD 3LKOA 15C8H 4LAQH 2NPLX 5JW3L 1PG7L 1RHHA 1WWCA 1AGDB 3L3OA 3OKNB 3QRGL 3E6HA 5D1ZB 2J8UF 1JE6A 3FOLB 5TPWH 2ZUXA 4E41A 1WC7B 2N1KA 4Y5XA 2AJYH 3QJFA 3MRRA 2UUDK 3VFTB 3H7LA 3BD5A 4YHIB 4P5TC 5B38G 3NCMA 3GSVB 1C7SA 1HHGA 2EYRA 2PF6A 4L29A 5FFLA 5CEYA 4KGJA 2JK5A 1NDGA 4I3GA 5F7DB 2PNDA 2VLRE 5BZWA 4L8DB 3F7PC 5D7JB 5DZLA 3QP3A 3OPZL 1GAFL 3H3KA 3VFSB 4L3AA 3LIZL 4N0UA 4FNLH 1A2YA 2HJKB 2V5RA 3MLZH 1DE4B 1J18A 4EVNB 1A4KA 5DD3L 4N8VA 4ODXB 1JWUB 4PRPD 2CGRH 4TRPL 2DYPB 3U7WH 3MRQA 1EHLL 2F54E 3VXSD 1WF5A 2VZTA 3TBYB 2P49B 1P7KA 4KVNL 4XC1H 3QUYC 1LNUA 3QEQB 3WSQH 4NQSA 3FCTA 1B2WL 3GMMA 1IAIH 5F7HA 2FJGA 4HPOL 5IHUH 3KYKH 4WI4A 2V7NB 1JPFB 1C8PA 1A3RL 2OYPA 1WIOA 1NC4A 1EZVY 4WO4D 4YXKL 4CKVX 4FQPA 4XPAH 4L4VB 4ZSOA 3UBXB 4QHNB 1WIUA 1U8OA 2XYCA 3BGFC 2VN7A 3QUZD 5I1DB 5JPMA 3T4AA 5IV2B 3EYQD 5LQBL 2VXQH 4GW1A 3D1MC 3RVWC 1CIUA 3MCKA 3MJ9L 2BMKA 3DGCR 4GFTB 1RHHB 4KTYA 5DF0A 3L3OB 3O8XB 3ZSSA 1QA9A 2ZCLL 4JZOA 3TGXA 1KEMH 2XWBB 4HMDA 5BMFL 4W6XB 3KR3L 5KSBE 3TBVA 3MRRB 1A1NA 4XBEH 4UMGA 2KQMA 5E8PB 2MJWA 2RHEA 2EYRB 3LRHA 3WIFA 2E6QA 5CEYB 1NDGB 1QRND 2A83B 4YFEA 5BZWB 2ZOLA 3EJZC 1ZXQA 4JDVB 4YDIH 1WK0A 4KTDL 4PG2C 1B9ZA 2XA8L 4NGHL 3ULVD 4N0UB 4A6YA 4OZHF 1A2YB 2H32H 3MBED 1MF2H 1A4KB 2I5YL 4AMKL 1X5HA 4MA3A 4N8VB 5DLML 2YSSA 2BVUA 4V1DE 2WLYA 1M6OB 3MRQB 3PGDA 3HNTL 4HF5H 1S7TA 4FQLH 4KU1A 3M07A 3EFFA 4NQSB 2AEIT 3CDYA 3GMMB 3LHPH 5C1MB 1YC8A 2FJGB 4DZ8A 2V5YA 4X8JA 3ME0A 4EI5B 1T83A 4ENED 1AXTH 5LGHH 2OL3H 3R8BB 4PJHE 3FQWA 1H3PL 5E2TH 3BN3B 2MCPL 3QO1A 4HXAH 1NQBA 4OLVH 1X5FA 3SCMC 4ZSOB 1TZGL 1U8OB 5JPMB 2DN7A 1ZTXH 4GW1B 3MCKB 1A9BA 4JRYE 4NQCA 1BFOA 3GJEA 2EYTA 5B22A 1LE5A 3W39B 4RMQA 3GI8H 1U8LA 2JJTC 3TO4B 5DJ0A 4YPJA 1QA9B 3AS3A 3OAUL 5SWSE 3ROLA 3R4DA 4AEIH 3JVGC 4KKBD 4NO2B 4MB4A 4QXGL 4P5KB 2WUBL 1IGCH 3LAFA 5F9OL 2DQJH 5D7LD 3MODH 1A1NB 4KI5F 1QPPA 4M02A 1BJMA 4U6VH 3QDGE 3AROA 1Z9SA 2KL6A 5CINH 1HSBA 4ZMAT 1JHLH 3E1F1 5I8CB 1HKLL 1EO5A 1D9KD 3SPVA 3VXNA 1P4IH 4X7EC 2ZOLB 2XZQL 3PP4H 1JI1A 2PTTA 2WK2A 5I1EL 2OJEB 1R0AH 4FQIH 1MHCA 3TBWA 4A6YB 3UPRB 2N4IA 3U46B 2VLJB 1MY5A 5I19H 3ULUE 1OAYL 1JCKA 2A77L 4L9DA 4BM7A 4TSAL 1MCPH 4IS6B 2XOTA 3O3AA 1LO4L 1AP2B 3TLRA 2A2QT 4G9FE 2YSSB 1X5ZA 3HZMA 4M43L 3WCYA 1NCUA 5C0JA 5ISZA 3PGDB 4GAFB 4LHQB 4JKWA 5C0BB 1Z2KA 3I6GA 4RWYL 1A02N 3W0WA 5F1KC 5JDSA 2DQUL 4UTBH 4WY7L 2O5YL 4PJFA 1VFBA 4NSKB 4DN4L 4X8JB 5JTWA 4PJ7F 1WTGT 4JFDE 3FQWB 3JBG7 2AKRB 3D0LB 1MEXL 5C2BL 1NCAH 1K3ZA 1R6VA 3BIBX 4R90H 3ULVH 3MUHL 2OI9B 3C6LB 1FNFA 1FGVL 3ARBD 4X5WB 3GBMH 2IAMD 3UTSA 1MSPA 5IVZA 5I1AA 1JTPA 3KYMA 3GJEB 2EYTB 1LE5B 1CXFA 5CMAA 1BD2A 2HRPH 1U8LB 2AERT 1BLNB 1DANU 5T1MB 3ROLB 3JUYA 5GPRA 3ARDB 3FFCA 4P0DA 1BBDL 3B2UC 4TVPD 3MCLL 2BRRH 1NPUA 3K3QA 2APBA 4U3HA 2WQ8A 2XY1A 4WJ5A 1MLCA 4FS0A 4YHYB 5GZOD 3FONA 1HSBB 4QRUA 4N9OB 1D6VH 1QO3A 2H3NA 1K6QH 3IXAB 5C08D 3DX6A 4GS7C 4P57A 5D71L 4G8IA 4LLUA 4FZ8H 4POUB 1CXIA 3VG0H 4HPYL 5CEZH 4XCCL 3TBWB 3L5IA 2VWEE 3P77B 4DKFL 5C09B 3H3PL 3L6FB 3CVIH 3O3AB 1I8KB 1PQZA 1EFXA 3QIUC 4ODSH 3HZMB 4I8DA 4YHPA 4KJQC 3C5SB 4LRNH 1O7VA 4Y4FC 1J0HA 5ISZB 5TGBA 3WHE0 1LMKA 1YMHB 2A0LC 3EO1A 3ZE2F 3QZWG 2NX5A 1HXMA 2NXYB 3VGDA 5AD0A 1NH6A 2GEEA 2B4CL 3GSNH 5EZOL 4PJFB 5D7KD 1VFBB 5SWZB 1GGTA 3DGGB 3NA9L 3O3BB 3IFNL 3BKMH 1M7DA 5TF0A 3SKJL 1XAUA 2AK4E 1BZ7B 1Z5LA 1A7NL 1ZHNA 3U9PH 5D5MF 2P45B 4KI5D 5AZ2L 2JJSC 4YGAB 1VPOH 4QRPE 2R8SH 1PZ5A 3RWJA 4R96A 3UTSB 1NAKH 5I1AB 5J6HB 1R3HA 2NY7L 5GGRA 4LLYA 1BD2B 4BFIB 2X05A 2FO1A 3VH8A 5D1XA 3QXUA 3FFCB 4D0DB 1A6AA 1UEMA 4J12A 1MY7A 1OP3K 5MEPB 1E27B 1Z9OA 2D7PA 3FQNA 2D0HA 4E42A 4WJ5B 3QPQD 1MLCB 3OAYK 2D2OA 3FONB 5DFWH 2H3NB 3QQNA 1KIPB 4P4KB 1FFPA 2LVEA 1I85A 4RGMC 4J4PC 1QFWL 4JVPA 2JIXB 2YD8A 4P2QE 1Q0YL 1YEIH 4X80L 4HSQA 4ZPVA 3RWHB 1AD0B 5FUOL 3D39D 1MFBL 4RGNC 4OIAA 3T3ME 3GI9L 5IQ7L 1PQZB 3VXMA 1EFXB 1FP5A 3ZL4H 4N90E 4YHPB 1BM3L 1RK1A 4KKLD 4HWBH 2HKHL 3RJQB 4FFYL 3EO1B 4W6WB 5DHYA 2AK1H 4TVPH 2NX5B 4ONFH 4LARL 5AD0B 3MLXL 3T77A 5K59E 1F58H 4QTIL 2L7UA 2R4RH 2DD8L 5HDBE 3VWKB 4R2GC 4XP4H 2QJDA 5J11C 4QF1B 2UZXB 2B4CC 3DO3A 3OTTA 4UINH 4M7KL 2R0ZL 5DSCA 4I2XA 2AEPL 3QWRA 2EDLA 4UT9L 1V05A 4APQD 2V2XA 4UILL 4AJ0A 4Q9RH 3KPOA 1ZHNB 3FT4A 3QUXC 2VDRH 3H9SD 3QNXB 5LXGH 5GGVL 4BZ2L 5EOCJ 1QPXA 1PZ5B 3RWJB 4R96B 5JOFB 2A9MH 1R3HB 3MOBH 2A38A 5GGRB 5SX4H 1WCQA 1FE8L 1XF2A 4DEPB 3VH8B 3S5LA 2C1PA 3BO8A 5ALCH 1KG0B 1A6AB 3WUWB 1I4FA 2WV3A 5ESQA 5IBUB 4P3CL 3HLAA 1OSPL 3FQNB 4QEGA 2NY2C 1DVFD 4X9FA 1KBGL 4PB9H 4PB0L 2XQYG 4JAMA 1AHWC 4KAQL 4NM8L 5LWYL 4Z7WF 1PVHA 3OR7A 3SDXB 2J6EL 4JQVA 1HINH 3EHBC 1CLZL 4Y16D 5I1GH 5SX5K 4BK5A 1BEYL 5F7EH 2VO5A 1UVQB 3T0EE 3RWGB 4LOUC 5T33L 2H8PA 1VADB 1N0XL 5DMIL 2G60L 5A43C 3DMMC 1RK1B 1J8HA 1KV3A 1KCKA 3C5JA 2X4OB 5DHYB 3HTLX 3PHOA 4PJEA 5DRNA 4Y5VA 3WNLA 4YHML 3T77B 2X4TA 3L3KB 3O4OC 3O4LE 4GJTB 2EC9T 1C1EH 4XPTL 3QUMA 1GGIL 5CZXD 1X5GA 4JRXD 1G0XA 4I2XB 4R26L 4LSTL 1KB5A 2XG4A 3KGRA 1B0GB 2V2XB 2FLRT 5AYUH 4Z7WE 1D5ZA 1JV5A 1IBGL 4FFWC 3CAFA 5F6IB 4K3JL 4NNYA 4YEEA 4H20L 1EUTA 3G5YA 4R0LC 1MFCH 3T3PE 3VGFA 3MFGB 4GRLA 3IGAA 3MRPA 1HQRA 3S5LB 2BCKA 1T22A 4F9LC 4YHLH 2C1PB 3BO8B 1I4FB 3AAZB 3PV6A 4AY0A 5JW4N 5ESQB 3HLAB 4LPWA 5EBWA 1TQBC 3SJVA 1FZOB 3ALXA 4OCMC 3BZFA 5I17A 1GSMA 3BH8A 4JAMB 2RCSL 5HGAA 2YKLL 2HT4D 4P46C 1NMCB 3OR7B 4QRRE 1KIQA 4PY7B 2JELL 1JVKA 4ZTPL 1A4JA 1RIHH 4H5SA 1GGUA 2QSCH 3ZHLA 2WWMC 1R5WA 4JFOB 5E2UH 3TA3D 3W11C 1OW0C 4MNGE 1MRCH 2EDTA 1HOCA 3VFGH 2R9HD 2YZ8A 4J6RH 1NAML 2FR4A 3NABL 1RUPL 3I85A 4JCMA 1ADQH 1OVZA 2E9WA 2H8PB 3TO2A 4M61A 5L9DL 5EIIA 2BSRA 1MCJA 2AAVA 4U1KA 1J8HB 3BQUA 4Z7UE 3RHWF 1CD1B 3PHOB 1WAAF 5DRNB 2X4TB 2D7MA 3O6MH 4Y19A 5CWSA 1KC5H 1RZ8A 5DS8A 5LVEA 3EDKA 4P2OA 3U9UA 3QUMB 3HMXH 5CZKA 4C58B 3BZ4B 3VXRA 4UOW1 3CLFH 5J1TC 5TFSH 1KB5B 4JZJA 3S35X 2BK8A 1D5ZB 1F2QA 1WUNT 4OFKA 5IBTH 4AEFA 4BQ6A 2HT2D 4M1CC 1T2XA 4YBLC 4NNYB 2BVOA 5FYJE 5CCKH 1TXKA 3SKOB 4CDHA 4FFZL 4JJ5A 3DBXA 4GRLB 1FO0A 3MRPB 5FCSH 5HYQA 2BCKB 1UQSB 2B1AH 1W72L 5IB1A 2IQ9L 1GHFH 5ANME 2PCPA 4CVXA 2NNAB 3H9HA 1UCBH 5E6IA 3CU1A 1XIWD 3SJVB 1CGWA 1ZT1A 4TSBL 1JNNL 3BDYH 5K9OA 2G9HA 3BZFB 4YDLB 3BH8B 5EC1A 5HGAB 3AFLA 3B6SA 3AMKA 1FDLL 2E7BA 4PLJD 2CLZB 1A4JB 3QEHA 4LIQH 4X83A 1H15A 1J86A 1R5WB 1S7VA 4OCWL 5GGQL 3LCYA 4OCLC 1OOAA 4Y4HD 3TYGH 3GZKA 1IC5H 4IOFC 4K23H 1QLFB 2VC2H 3HE6A 4KFZC 2HH0H 4NFDA 3REVA 3UZVB 1FCGA 4BFGA 2QBWA 2FR4B 4JKKA 4F37K 1DQLH 5I1IL 4C56A 4LSRL 3CH8A 3TO2B 4M48H 3UTPD 1PX3A 4M61B 1CFNA 4PGCA 2AQ1A 4K3EH 3L3HA 4HIXL 1A14H 4XNMB 4FXKB 2VLME 3D5OF 3IDYC 5GJTL 2IGFH 2XV6B 3NFSH 4BQCA 5A2LH 3QUKB 2UZIL 4JVUA 2B2XH 4OIBA 5CWSB 1RZ8B 5DS8B 3SE4A 4P2OB 3U9UB 2HMID 3MNWA 1D6EA 1G6RH 1RUAH 1KCLA 1I9IL 4LDOB 3VD7A 1FG9C 2LV4A 2X10A 1NGZA 3H7BA 2NY4B 1FVEA 2H9GA 3LS5L 3EDEA 3GGWA 1A6VH 4JZJB 3UROR 1OP5K 2VZOA 3BRFA 3Q2CA 1LP9B 1OTTC 5IFAL 4HJJL 5EA0H 2MQ3A 5EO9A 3JV4A 1P7QD 2AP2A 1HH6A 4U1IA 1G9MH 5D1QC 5KSAA 4C57C 4NQED 3SE9L 3NBNA 3V5DB 3VXUD 3GRWH 1TTGA 3DBXB 3IDGA 1BBJA 1N4XL 4KRNA 4PREB 3QI9D 3VWJD 4DWHA 2JLLA 5IW6A 1CLOH 1S7QA 3MJ8A 2Z4QB 3MO1A 5KVEL 5IB1B 4H88H 4CVXB 2R0WL 5HDQH 1T0NA 1HSAA 3H9HB 2IANE 5EOCL 4GAYB 2V5SA 4Q0XL 1ZT1B 5B3JE 3ARXA 1FNLA 2G9HB 5MENB 5EC1B 2Y23A 5C0EA 1NMAL 4IHOB 3OXSB 3B6SB 5HYJD 4X4ZA 5D2NB 3WKNA 2KZ1B 1EXUA 3ARUA 5T3XL 3BIAX 1JHTB 5HHME 1H15B 2ERJB 4K94H 1YUHB 4J7RA 1KFAH 1CWVA 3STLA 3HE6B 2VAAA 3REVB 3W2DL 4Y88A 3EBAA 5EU4A 4C56B 2YD9A 4DKAA 1I8IB 3RAJL 3S96A 4KV5F 1R3IH 2PO6D 1U92B 4XXDA 4NBYB 5CP3H 4DAGH 5T3ZL 3F6IA 3RI5K 1MWAH 4Z5RB 1IILE 4G3YH 4HS8L 1B4RA 3G5ZA 2ORBH 2VZ1A 4HFUL 5AYQA 5JHDE 3MNWB 2HVJB 4LEXH 3S35L 2R56H 3O8XC 3IXTB 2FHFA 5IT2H 3EOTL 4K3DL 1NLBH 3D25A 3H7BB 2I26N 3GGWB 3OHXA 5FYKE 3MV9D 3QNYA 5MP6H 3X13A 3V4VH 3WDIA 5EO9B 3JV4B 4NBXB 4OZ4A 3FJTA 2H41A 4U1IB 5HHQA 4P5MA 5KSAB 4AIXA 2FRGP 3QQ9D 5EORH 3SDCB 1O5DT 5FV2A 3RX7A 4JDTL 1FL5B 3MV7E 5GRUH 1BBJB 1X5IA 1S7QB 3PF2A 4U31A 1E28B 3I6LD 3QHZH 3JZ7A 3WXWL 1JN6A 1T0NB 3SGJC 1HSAB 3GMNA 5ESAA 3ZKXB 4OB5L 4MSWA 1S9XB 1KJ2B 2DJUA 4XNYL 2ZJSH 1VCAA 4KK9C 5C0EB 1CGSL 1G7IA 1RUML 1IM3A 2YD2A 2OLDA 4D0BA 5FYLE 4U33A 4JE4B 4OSUL 3O6FD 2EH7H 1A6TA 1KJ3L 5L2KE 4A2LA 2VAAB 3NH7L 4YUEH 4U1GB 4IJ3B 4EI5C 4Q6IA 4DUVA 2Y06H 4LLMB 1T89C 3S96B 2AV7B 4WTXA 5AWNL 3S97C 4XXDB 5CZVL 4OGYL 2FZ3A 3VXPA 2BERA 5BV7B 5MHSD 1NEUA 4HWEL 2H2SC 5IB4A 4QCIA 2E7MA 1PGRB 3UTQB 1QLRA 4HD9A 2IBZY 3J8F7 4PGEA 4F8QA 1RD6A 4Y2DC 4JB9L 4WENB 1TCRA 2GJ6A 2DRUA 2XQBL 4I0CC 1M7IB 3VFNA 3P9MB 3OHXB 2FEDC 4R3SA 4X9HA 1PX4A 4UV7L 5BW7A 4GMSH 3EYOA 1RUKH 1JF6A 3HC3L 5HHQB 1SJEB 1FNSH 4P5MB 4PV8A 5C07D 2IMNA 35C8H 5FGCB 1BJ1H 1IGFH 4JFHE 4L3EE 4LLDA 3MOAH 3DO7B 2R39A 3EKCA 4WIQA 1IARB 4HGMA 1G9NH 2DB8A 2LU3A 1CFTB 4MCYA 5KS9F 3QULB 4FG6D 3V79C 3WFBH 4K7PY 3IRZA 4BZ1L 4MSWB 4XAWL 4UQ2A 3TIEA 5CJ8A 4TTGA 1Y18A 4KUZH 1CT8A 3LB6D 2V9TA 1G7IB 5E8NA 1DFBH 3SDYL 1T2JA 5F1OB 3PABA 4MJID 5JW5A 4RMWA 1IC7L 3FZUD 2LAAA 4LSPL 1OAQH 3A6BH 5FUCC 1GZPA 4D9QE 4H25A 4JR9L 2O93L 4RNRA 4O58L 2VXSH 2XZAL 4RBPH 1A6TB 3VA6A 2D03L 5GGRY 5CJOH 1HXYA 1F6AA 4Q9QL 1IGML 1DN2A 3VU2A 2A9NL 1NGWA 2DM3A 2WBJB 1RULH 5J1AA 3QG6A 2CIIA 4FQ1L 1BHGA 1NCDH 3L5HA 1BAFL 1N6QH 2B5IB 3VI4E 5MERA 3VXPB 3Q1SL 2RAMA 4XPGH 4G80A 2FL5B 4D0CA 4N8CH 2X1WL 3C6LC 3JWDH 3IJYB 5KS9E 1EEUA 4QCIB 5CGYD 1T66C 3KXFA 2OX5A 3UTTD 4PGEB 2Z0BA 3CVHA 3IDNA 1TCRB 3FO0L 3CDFA 3FB7A 3ARDC 3Q6FA 1A6WL 1MVFA 2OS7A 5F89B 4R3SB 1UM5H 2H32B 3U48A 4TSCL 1I75A 4UDTB 1W8NA 2ZOKA 3EYOB 3P3YA 4I3SH 5INCA 4BQ8A 4PV8B 1OWWA 5JW4Q 3WIHL 2WM0A 4NJAL 5DD6B 1IKNC 4YHYC 5J4MA 4JO4H 3K8MA 1ZLUH 2FH6A 3R8QA 3AS2A 1WT5C 3O0RH 1TFHA 4MCYB 1GPOL 4YAQB 2F53A 5IHLB 4ODHH 4TNVK 3TFKC 4F2MB 5LCVH 3MLUH 2C1OB 4DKEH 4UQ2B 1VFMA 3TIEB 1SBBA 3OAZK 1CT8B 2OL3B 4EN3D 2VR5A 4E5XA 3VFVB 2AXGA 4ZNEE 2P5ED 3PABB 5JW5B 3RDTA 4JPVH 5TF1H 2V9RA 4WTZA 3RL1B 1GZPB 5IQ9A 4H25B 3S36H 4RNRB 1ZA6B 2VITA 2VLRA 4FQCL 2GJJA 5BRZD 3N50A 1I1AD 1LO2L 2ESVD 3S37X 1HXYB 4X98A 3SY0A 1KPRA 1V7MH 3ARZA 4NCC2 5EO0A 2FJHB 5DEGB 3VXSB 1B88A 4LLVA 2XWJA 5IMLB 2KKQA 1C16B 4WHDA 1NGWB 4F15B 4IRSC 5FEBA 4M8VA 3LEYH 3C60A 5KOMC 4DFHA 5J1AB 3BAEH 2CIIB 4EUPG 5EUOA 4HKZB 1NUGA 4ZO9A 2BY1A 1JZ2A 4G80B 2F54A 1QVOA 2YEZB 1UWXK 3T8XA 3FN0H 3V7MA 5D72L 3P73A 3KXFB 4WO4B 3C2AL 4NO5A 3RTQA 1MHPL 3E3QC 4OZFA 4CAGA 3IDNB 1X5XA 3S9DB 5E08L 2GJZA 2ZKHL 2DLTA 1CE1H 1FORL 3E2HB 3RVWD 3WS6C 1F45A 5CBAB 4YDKL 1TZHB 4JO2H 4LCWE 1TVBB 1RJZA 1MI5D 2ZOKB 5HDLA 4M3JA 1XF5A 1NL0H 2EDWA 1CK0H 3IFLL 1ZA3A 4YZFE 1S5HA 2XKNA 5DRXA 4Z7QE 1JGUL 3HE7D 4PRHA 2PXYD 4F7MB 4P4KC 3OKMB 5IESH 1JGDA 1A7OH 1QSZA 4HUNB 5EU3B 3GSNA 2F53B 4NNPH 1Q0XL 3F7YA 3RL2A 5GSRB 2CMRH 1L0QA 3IS0X 1QRNB 4E5XB 3EJZD 3IDMB 4XVTH 2AXGB 3PWUB 4TUOA 1GL4B 2Z8WC 4F33A 5A3IC 4OFDA 4PY8I 3AS1A 4M7ZC 3VMPA 1HQ4A 2UZYB 5B8CA 3MBEB 1SBSL 4KTEL 3RVVD 3PWVA 3OKKA 2HWZL 2Q7YA 3WFZA 3D0VB 4LF3A 4X98B 3SY0B 5EO0B 5F1NA 2A6DB 3WKMH 4LLVB 2RGSA 4PJDF 5LGJA 3C60B 5GZNC 5EZIH 5E4EB 2OXGA 2ZG2A 4V1DA 1W8OA 5EUOB 4B50A 5I8EA 1QVOB 5HGHA 3T04D 1CGYA 4X0KA 4NUGH 3P73B 4N0FA 4NO5B 3RTQB 2J8UB 3KPRA 3S6CA 4OZFB 3FO9B 4CGTA 4U6HA 1ZE3C 5IIEB 2GJZB 1C5CH 3MGTA 3OB0K 1N5YL 4HFWB 2Q3AA 5B38A 3H0TA 1EMTL 4GRWF 4MS8D 2J4WL 4DN3L 5HPMA 5FOBB 1DR9A 2QADD 4PJHA 4X99A 1CZ8H 4XX1G 1RJZB 1G1YA 4QRQA 3T09A 4JJHA 1XF5B 4PRIA 2B39A 3D18A 1ZA3B 1DUZB 1TJIL 3QQ3B 4HV8B 2XKNB 2YWZA 5DRXB 4JG1L 4PRHB 1A1MA 4LCIL 4JRYA 3FQRA 5F9WC 3TJHC 2BRQA 5I71C 3PHQB 4OZHA 1EA9C 5SWSA 3GSNB 1CDHA 4PJDE 1IM9D 3AB0B 4XHQA 3RL2B 2BDNH 1DBJL 1OY3B 5IHZB 4OBSA 4ZS7H 3QDGA 4RRPG 4C55A 2QQKH 5T1KA 4L8CA 4G8EB 3IKKA 1DEDA 4JPWH 2YWYA 1RVFH 2Y5TB 2YPLE 3OGCA 2N7BA 4IOSD 1IRAY 4WW1A 1MJ7L 1HQ4B 3NFNA 2G75B 5TE4L 5B8CB 1IVLA 4LGSB 1EPFA 1J12A 3TZVD 3PWVB 4PUBL 3OKKB 3MV8A 2DQEL 4MNQE 1C08A 1CXLA 4NHCH 5DRZA 7CGTA 1YEEL 4LF3B 1PG7H 4HBCH 2EXWD 5F1NB 3QRGH 1EEYA 4X7TB 3QRFM 4EBQL 5EUKA 1GGBL 2XWTB 3M17A 4OLZL 4JM2A 4G9FA 4OLUL 4XCYA 3KS0J 5ADPL 3RVUD 1GXEA 2XFXA 5I8EB 4JKMA 1U8KB 2CLRB 5HGHB 1L7TL 4JHAL 4X0KB 2YRLA 3KPRB 3CDGA 4XVJL 2YMXL 1MCQA 5DD1L 1B0WA 2E3VA 3MGTB 2GHWB 3KPTA 5B38B 3H0TB 4AT6B 3RA7H 3OPZH 3ARBB 1GAFH 4JFDA 3CK0H 2IAMB 1J05B 4X99B 3LIZH 3GMQA 3VW3H 5CSBA 3EAKA 1S7SB 4PRIB 1KTRL 4PJIE 3D18B 4XI5D 5KJRL 4LU5L 4H8WC 3DURA 1YY8B 4I18A 1A1MB 3B2UD 1U3HA 3QXTA 1BQUA 1EHLH 3UMTA 4NT6A 1FGNH 1MCOH 3F7VA 4AENB 4OZHB 3LZFH 4KVNH 3CSBA 3KDMB 1DBKH 1B2WH 2NTFB 5IMOA 1YPZF 4FHBD 1RHFA 5E6YA 2FWOA 1A9EB 5C08B 5SWQA 4X8XA 3ZDZF 1A3RH 5H8DA 1MCCA 1FYTA 1FSKB 4YXKH 5T1KB 4L8CB 3NFNB 3O9WD 5GGUB 3RGVD 2CUHA 3ILPA 4PBWD 3BD3A 3QIUD 3MV8B 3PP3H 2WP3O 1C08B 2ZCKH 3VXTA 4KJQD 4XX1E 5DJZB 3MJ9H 5I2IB 5IWLA 4PJ7A 2BVTA 5KOVC 1DEEB 1SY6A 4LFHG 4PJAE 3KPSE 5FIEA 3OB8A 3LRGA 1E4KC 2EDHA 2IJ0C 2ZCLH 1AXSB 2I9TB 5BMFH 4XCYB 4KJWC 4R4BB 1DQDL 3VI3F 1NGYA 4N5EC 1ZGLM 4HUUB 3IU3B 1RURL 3HG1E 2NQCA 1ZVHA 1CN4A 3CDGB 1OD7A 3D85A 5LKNA 3H9SA 1PY9A 3ZYIA 4KTDH 3ZDZE 2XG5A 1BWWA 5GJSL 5DQ9B 1YJDC 2XA8H 4NO3A 4OGXL 1HILB 3CUPA 3VMOA 2I5YH 2PYEA 3DURB 1N3NA 5EO1A 3C8HA 3ZDXF 5I73B 3T0VA 4I18B 4QOKE 1AIFA 3N06B 4QRPA 4UIMA 3DNKA 4N8PA 3G6JE 1BFVL 3F7VB 5FA4A 3BP5A 2W38A 3GB7B 4PS4L 1KN2L 1SVZA 3FQXA 4I3RL 3SDAC 3KLHD 1JBJA 3GIZH 1F2XK 2X2YA 5IMOB 3D69A 3EDFA 1PYWA 2FWOB 3UJTL 5SWQB 2FX7H 2WSKA 2YUWA 4NHUA 5FO9A 1FYTB 1ZLVK 2P5WD 1H3PH 1T03L 3LN9A 1WSST 3GSOA 3KPQA 2C26A 1TZGH 5D2LF 3WFCH 1Y6MR 4NZUL 3T0AA 3CLEL 4RGND 3ILPB 2A74A 5DTFA 1D5BA 3VXTB 4PJ7B 1TNMA 4HS3A 2Q20A 1B4JL 2YA2A 3ARFA 1CTOA 1RIVL 1U2HA 4ZUTA 3OAUH 5JHLH 4RSVA 4KHTH 4Z0XA 1CFSA 3UAJD 2NY4C 3GIVA 1K4CA 5D5MA 1AR1C 1JZ5A 1MIEL 2OSLA 4MXVF 4QXGH 1IEBA 3U30B 4NQDE 3FTGB 2WUBH 3NACL 2Z31A 3DLQR 1R3LB 4R2GD 5F9OH 2X4NA 1I1YA 4WCYL 4IMKC 1J1OL 4MAYA 2VOTA 3GMRA 1AQDA 1JRHL 3B9KA 1HKLH 1MAML 2E8ZA 4LVOB 1Q1JL 3K8KA 2NY3C 4GG6E 3V4UH 1U3JA 3D85B 4RQQB 3ZE1F 1IQDA 2XZQH 3H9SB 4BSVA 2E9BA 2O61A 3CH1B 5I1EH 4K7FA 4HCRL 4NO3B 4HLZG 4LBEA 1U58A 3G9AB 5J12B 3L5XH 1OAYH 1RK0A 2A77H 2WP3T 3CUPB 4TSAH 5H37G 1OGAA 4MDJA 1KT2A 1RMFL 2PYEB 5E8OA 5EO1B 4M43H 1AIFB 5HBBA 5D2NC 1SMAA 4XVSL 1ZMYA 1CQYA 3V52L 4UZGA 1SJHA 2BSTA 1PY4A 4Q9CA 4M00A 4J3UA 15C8L 4LAQL 2NY2D 3O2VL 5JOPD 3ZKND 4RWYH 4Q58C 5FA4B 1K2DB 3BP5B 3LKPA 3T1FA 2Z92A 5F6HI 1JZ7A 4WY7H 2O5YH 1L7IL 2DBLL 4CMMA 4PJ5D 3D69B 4DN4H 3QDJD 4Q2ZA 3QZWA 4NHUB 4OJFH 1UZ8A 4Y16B 4AM0A 4MQ7A 5EPMA 3A67H 5KAQG 1WZKA 3FOMA 5ETUA 4FQQB 4X4MA 3HS0A 4ZXBC 5C2BH 3NIFF 4N0CD 1ZT7A 5EC2B 1CG9A 1FGVH 2A74B 5INDA 4HK0B 5DTFB 3B8SA 2C9AA 4GG8B 4HS3B 1LEGA 1JWMA 2HFTA 4RMRA 2EEDA 5C8JA 1IAMA 4OZIF 1JNLL 1CFSB 4FMKA 3GMPB 3ROOB 3GSXA 1K4CB 1BBDH 5D5MB 1MVUA 4R97B 2Z31B 3MCLH 3IYLW 2AK4D 1I1YB 2X4NB 4WEBH 3RBSA 2OM5A 4JRXB 3GMRB 3PL6C 1JGEA 1T6VN 4JFFD 3PQYD 1WITA 3WSQL 4UBDD 1QFWM 1ZHLA 5D71H 4BSVB 1WBYA 5DJAA 1Q9LA 4HPYH 2O61B 4XCCH 3FQUA 4LBEB 4DKFH 1IGJA 3H3PH 1HI6A 4Z7WA 1OGAB 4MDJB 5EU6E 3VGBA 1LDPL 1VDGA 2C3GA 4WFEE 5CP3A 1PKQE 1XIWA 2BSTB 2BNRD 5HI4C 3ZTJH 3PDDA 1ACYL 1QR1A 3LKPB 1MIML 3T1FB 2Z92B 3BW9A 4FABH 4P2QD 4YEFA 1RJLB 4J3SA 4NDMB 5EZOH 4CMMB 4RFNC 3KLSA 1IKFL 1WBZB 4Q2ZB 3NPSC 3EYFA 3NA9H 4PJBF 1AO7E 3QZWB 2BNQE 3IFNH 4NOBA 5KAQF 1UZ8B 5GS1B 4LKCB 1JIBA 3F7RA 1R24A 1MAJA 5EPMB 2QHLA 4N90D 2OTWA 1CF8H 1A7NH 1ORQA 4QRRA 5I30L 4FQJL 1LE9A 1ZT7B 1CG9B 5AZ2H 1TVHB 2V17L 4PJ8C 1PBYA 5GIRB 3C09B 1MOEA 2NY7H 4MNGA 2DWEB 4YHNA 4OQTL 2XTJD 4JKPL 5EBGA 1I1FA 1FCCA 2JCCF 2IBGA 1TLKA 3GSXB 1JFQL 5E2JA 3TN0D 3OSKA 4YC2C 1YMMA 1MVUB 4ZPTA 5E8EA 3ET9F 1T1WA 3TESA 2K7PA 4NPYA 2JB5H 1OARL 4HBQA 4W68A 4G7YL 1JGEB 3DX8A 5C0FB 1OPGL 1LGVA 3CXDL 3PWPD 5D7SH 3TP4A 3P4OA 5HTSA 4PGDA 2L4OA 1XF3A 1ZHLB 1QFWH 1WBYB 4LCCB 2XZZA 5DJAB 1Q9LB 2LTQB 2HT3D 3TVMA 5LGHL 1BF2A 1F8TH 4N1EA 3VXUA 4X80H 1KYOJ 3HCVB 5FUOH 1MFBH 1F4YL 1HI6B 4Z7WB 5IQ7H 4G6ML 5F93C 3E8UL 5EB9A 1BM3H 1QBBA 2HKHH 1FNGA 4X6CF 1XIWB 2ADJA 5DVMA 2FYYA 5ICZB 4MWFA 3MLXH 4QLRA 3BW9B 1E4WL 4GBXD 3AREA 2G5RA 3QEQE 4WHYG 2DD8H 1EUUA 4XBGA 4LRIA 1C7TA 3LPGA 3MRCB 4XHJD 3GSWA 3MODL 3PGCA 4U6VL 3T0ED 2AEPH 1WAAA 4UT9H 3H9YA 4IOFD 2WBJC 4Y4HB 2QL1A 4UILH 2OTWB 4L4VE 5GGVH 4KZEL 1L6ZA 4BZ2H 3R0MA 3NGBC 5BJTA 1G6VK 2YA1A 5I1CH 3O4LD 4BA8A 3MZTA 4HULB 1FE8H 4CDGC 4YHNB 1R0AL 2CKBL 3MRMB 4LP5A 3CC5A 1KTDA 2AJXL 1MCPL 1OP9A 3KHOA 1NMBH 1YMMB 4P3CH 1KELL 3BP6B 3GK8L 1OSPH 4ZPTB 1O7SA 4ORGB 5E8EB 3RZCD 1QQDB 4NPYB 1KBGH 4PB0H 5IEKA 4KAQH 1G7QB 4JY5L 5LWYH 2C4FU 2WMPA 3MXVL 3P4OB 1OTTD 2J6EH 1LO0H 4CW1B 5JXEC 5CBEA 1P7QB 3OV6A 5I1JL 3TVMB 5FHBH 4NQEB 3VXUB 5C0CD 1HWGB 1BEYH 2PW1A 1NDMB 2APVA 1U41A 4G8FA 4AEEA 2GY7B 5T33H 2FIKA 3ULVL 2OQJA 3EJYC 5DMIH 1Z0MA 3L3DA 2G60H 1FNGB 4DCQA 3CCHA 4XXCA 2ADJB 2FYYB 4Y5YC 1HCVA 3V6ZA 3MYJA 4PJGF 5HYJB 4XPTH 4XBGB 2AEWA 3RWDB 1OD9A 1GGIH 3VE0B 3QFJA 4KZDL 4YHOL 3HAEH 4QRTB 4R26H 4LSTH 3U4BL 5BOZG 2DAVA 3OZ9H 1D6VL 1V8HA 4ZSOE 1A7PL 1CGTA 1IBGH 4CADA 5TDPB 4OV5B 4O9HH 4H20H 4FZ8L 3KYOA 1LO3L 4WO4C 4G6FB 4ZFFA 1MJJA 3HPLA 4NIKB 5FO8A 3QT2A 4P59L 1I3UA 1XF4A 2H2PD 2YPVL 3CC5B 4DK6A 3L1OL 1LEIA 2GCYA 4QNPF 3L3GA 3QUZC 2C7UB 4Z8FL 3E2HC 3EYQC 3MUGB 5DK2A 2XXMB 2R23A 3KPNB 2Q3ZA 5HGBA 4HXBL 5IEKB 5F21B 2RCSH 1X5AA 2WANA 2YKLH 3BI9X 5IF0B 1E4XI 4UTAL 1ND0B 1AGFB 4ZTPH 1L0XA 3NCCB 5C6PB 1KULA 1TENA 3Q5OA 3QBTB 3MSPA 3O6KL 4KXZI 4D9RD 2VLJE 3RWFA 5EBMA 2VDOH 1NAMH 4G8FB 1RUPH 4Z95L 2MFNA 2FIKB 2WNGA 2OQJB 3U9PL 3L3DB 4I0PD 5L9DH 2R8SL 1DUYA 3JWNC 1NAKL 3ULVC 4WUUD 3V8CA 2YRPA 5C0BE 4KK9D 5H37H 4K71C 6FABL 1MCIA 1A6PA 4YK4C 43C9A 5TDNA 4L8SC 5F7KC 1AE6L 4RMUA 4M03A 3GSUB 3QFJB 2R0KL 2UY6A 4AG4L 3EIFA 3CD4A 3NIGF 4MJ4A 5TH2B 1IAKB 2BVPB 3DX7A 5KANG 3VFUB 4PGJA 2VLMD 1WZMA 4XVUD 2CRYA 4MMXC 2VERN 2X1PA 4FFZH 2D7NA 3MUJA 4OLXL 1CDCA 5HGDA 4Y5XC 1LEIB 2GCYB 2EDOA 1GJIA 2IQ9H 2H2SD 5KVDH 5DK2B 2DOCA 4WWKA 4B7IA 3R1GL 1S7WA 3M45A 2R23B 2DM4A 1RJYA 4ZYKA 4HWBL 4TSBH 4HIHA 4FFVD 1XH3A 4LVNC 4NO0A 2AK1L 4Z7OE 3EFDL 3ECBA 2FEDD 2ZSWA 2W0FA 1FIEA 4KKBC 3TNMB 4JFZL 5I76A 1XR9B 1RZGA 1IC1A 4OCWH 2YPKB 5CIPH 5DJ2A 4U0RC 5CHNA 3DSNA 1R3KB 5JLZA 3D9AH 2OZ4A 3RWFB 5DJCA 5C09E 1D9KC 5DMJB 3V8OA 2ZZUT 5I1IH 4LSRH 1UT9A 4O00A 4WEMB 4HIIA 1BFTA 4P5TA 4GRMB 1DUYB 1MPAL 4HIXH 1ZSDA 5ISZE 4WU5B 5GJTH 1V3LA 5HHMD 3F5WB 5JNYA 1KPVA 2UZIH 1KNOA 3IS1X 3KPMA 1SJXA 4X7SL 4ZUUA 1X7QA 43C9B 1FL6A 3ARTA 3VGEA 4PJFE 3PWLB 1I9IH 5SWZE 1YYLL 1ES0A 3S7GA 1E4JA 5IEHB 3LS5H 5E2VL 3MJGX 3MRNA 4K8RL 5FB8A 5IFAH 4HJJH 1QSED 3WNKA 3SE9H 3C08L 1U9KA 1W0WA 3UTSE 3U2SA 3QUYA 2H26B 1N4XH 3E3QE 2HG5A 5JHDD 2BVQB 4CN1A 1ZEAH 1BD2E 1BIIA 5KVEH 4PJCF 3DX9A 2AW2A 3QFDA 2R0WH 3FFCE 2YD5A 2VR9A 5EOCH 2IAMC 1TPXC 1S7WB 3GMOA 4Q0XH 3HR6A 1RJYB 4Z76B 1NFDF 3UTTB 4HJGA 3S98A 1PW3A 4HIHB 4WI2A 4U1MA 1MCBA 1NMAH 1XH3B 4NO0B 1PJ9A 5BXFA 2EDEA 5ID0A 4JANA 5KS9A 3G5XB 5A2IH 3BP7A 4HKXA 3UYPA 3MV7D 5I76B 3GUTA 4OLYL 3RNKA 5CHNB 1I7RB 5JLZB 1J87A 5GZOC 1IZKA 1ZKAA 5DJCB 5H94A 3W2DH 4MVBD 3QH3A 1WV7T 4P5TB 1HH9B 3B5GA 4HKJA 5DR5L 5HY9A 5C0NC 4HUMB 1U42A 4AZ8A 5JNYB 2NX5E 4BK4A 4LLWA 1KPVB 4R7DB 1KNOB 4HS8H 3KPMB 5E94A 4ZUUB 4M5YL 2P5EB 1X7QB 2O26U 4HFUH 1FL6B 4PG2A 3RKDD 5DHVH 5JUEL 4B0MM 2OMNA 5L2KD 3O45A 3WL9B 3WLWD 1FC1A 2VL5A 3FAWA 4HUXB 2UY7A 3WFEH 3EOTH 4PJ9D 2A6KB 5DUBB 4KJYA 1P4BL 3ZTNL 1QLEL 4MHHG 1QHOA 1R5IA 2F58L 4R4NC 2ESVB 1VERA 3MRNB 3MRKB 3ETBF 5CFHA 3CSYB 5IK3B 1RIHL 5JR1L 2VXVH 4HUWA 3U2SB 3FT2A 4JDTH 1J0KA 2B0SL 4OFVA 1I8MB 1MRCL 1BIIB 5DMGD 1U8PA 3VFGL 1U3ZA 1YEHL 2Y6SD 3QIWD 3L5WB 3U0TB 3QFDB 4LLAA 4PRAA 3WXWH 3C8DA 3MR9A 4MYWB 3ZKQD 4UUJA 2CK2A 2M8XA 3GMOB 4HJGB 3SCMA 4XNYH 2UWEF 2WINB 2AGJH 4U1MB 3VXQA 1CGSH 5BXFB 2R2EA 1C12A 3SHSA 5ID0B 4RWHA 3TCLA 3O6ML 4M8QB 2ZP0T 3SO3B 4WGVB 3BP7B 4G9DA 4HKXB 4YFLF 4L3ED 3SDXE 2EYSB 2HN7A 5D6DA 2JJTA 1SHMA 1BJ1J 2OR9L 3QPQC 4WTWA 3OG6B 2CRIA 1KJ3H 5TFSL 2XQYK 4AL8L 3JVGA 5E8DL 3P9WB 5K9KA 3LKQA 5IBTL 3QH3B 1HDMA 4RISL 4GW4A 1R5VB 2E27L 5AWNH 1DANT 4XB8A 5J6GA 1UH4A 3SDDD 1EX0A 3K1KC 4HKJB 5HY9B 4XGZB 1RY7B 3PNWA 1RZ7H 1A5FL 1INQA 1FZMA 4LLWB 4HWEH 5E94B 4KK6D 4KKLC 2BJML 3NZHL 2BFVL 5FKAB 5BS0D 3BDYL 3CFBA 3DUSB 4I2XE 2UVEA 3TJEL 1R5IB 2ZG1A 2YR3A 5GRVL 1SM3L 2NY6D 3RHWK 4FA8A 4UV7H 4G8GD 4M7LL 3EUUA 3HC3H 1JF1A 5DXWA 2EKSA 2WBKA 2OK0L 3GKWH 1J7VR 5EN2A 3MXWH 5GZND 4LVOC 1MCWW 4APQC 1MUJA 4WGWB 4HK3J 2I07A 4FOMA 1T0PB 2EDKA 3MREA 3UBXI 2X9YA 43CAA 3VFRB 4PRAB 4OM0L 4JVWA 4NWUL 1NFIA 4QHUB 4UUJB 4NRZA 4G6AC 4XAWH 2YD1A 2VQ1B 3P0VL 4GAJH 2X42A 2VNCA 3ILQD 2ICEA 4J8RA 2DQDL 2IF7A 3VXQB 1Q94B 1C12B 4UU9A 1IC7H 2QHRL 3SO5A 4EIGB 4LSPH 5L6YL 2HN7B 4CNIB 2E6JA 4JR9H 5IGXL 3EYVA 2X4SA 1A7QH 1G6RL 1DVFC 2NW3A 2XZAH 3KPPA 1G7PA 3HPJA 4YWGL 4RBPK 1DQJA 5HYSG 4Y4KA 1RZJL 3LKQB 4Q9QH 2E9IA 1IGMH 4PP2A 2A9NH 3B5TA 3WFHA 1HDMB 3X11A 3DSFL 2DM2A 3O3EB 4HDIB 5J6GB 4CUCA 2MHAA 5EOTB 1J8HE 1BAFH 3Q1SH 4O2EB 3PNWB 3UPCA 2AABH 1CLOL 1FZMB 4P4RA 5D9SA 1BREA 4TOYL 1CFVH 1K5NB 3QISA 4PJDA 4EUPA 3WFDL 2FGZA 1JMXA 5IB2A 3K4DA 2EIZA 4EDWL 3S3PA 1A6WH 3QIUA 3PIQB 5DMKB 2VABA 4JQIL 5DEFA 4LEOA 4Y4FA 3RKPA 1JF1B 2YPLA 4TNWF 1DP0A 4P23D 3WIHH 4TUKH 4NJAH 3GSRA 5EN2B 4KDVA 4LCUA 3I9GH 4MNQA 1A8JH 3BKCL 5ICXA 5AEAA 1S3KH 5FGBC 1XGTA 43CAB 4JZNA 5J89A 3V0WL 3EOBA 3MUY1 1GPOH 3B2VH 4NRZB 1QBLL 5GGSB 3HC0A 3QCVL 4ZO6A 4LCWD 4ZNCD 4J8RB 3M8OL 1MWAL 2JJSA 4E0RA 4LSUL 2RFXA 1YQVL 4LHJB 3GNMH 3EYVB 3FHQA 4XC3L 4LEXL 1I9EA 1NBVL 1LO2H 4JLRA 3KPPB 3HPJB 2F8VA 1E6OL 3QA3A 1UH2A 2HT4C 1DQJB 3F6LA 3O81A 4M4PA 4MMZC 2MSPA 1XR8A 4LPVA 1DL7H 4JFYB 5JORA 5I0ZA 1OGTA 3DXAD 3MGOA 3QEUA 3V0VA 3X11B 2A6IB 5GS1C 1RZJC 3TA3C 2MHAB 1ZGLB 5CJXC 5GRUL 2R9HC 4GLRI 2ARJA 1GIGL 4GS7B 4BKLB 1ZWIA 5D9SB 5DRWB 4J4PA 1BGXH 4MJ6B 5D72H 2PW2B 4HAGA 2DKUA 4PJDB 5HHVL 3OJVC 4H26A 3O9WB 3RGVB 2GTZA 2ZKHH 3B9AA 3PXHA 1FORH 1NEZB 4YX2L 3HUJB 3QIUB 4S11A 5GS2D 2VABB 2IC2A 4YDKH 5CGTA 4LEOB 1II4E 4Y4FB 1JK8A 1LP9E 3SGEI 3ZLQC 1C5DA 4NWTL 3U1SL 1MJ8L 3IFLH 2QQNL 1PAMA 1FFRA 1JGUH 2IPKA 4MNQB 4KJWD 4GRWB 3VRLE 5ICXB 3S36X 2VSDA 3M1BA 2HT2C 4JZNB 4LCCC 3LDBC 3MA7A 3EOBB 1MCFA 1X4YA 1T7VA 4U1SB 3E0GA 4KK5D 4NKOA 2R2BA 1Q0XH 5JQ6L 3HR5B 2HFEA 5D7IF 3QUXA 1F3DH 5MENE 3TWCL 4Z78A 3QXWA 3HG1A 4E0RB 5MEOA 1CDBA 5D2NE 2RFXB 3B9EA 1GCFA 2NCMA 2ED8A 1SBSH 2QR0B 4JLRB 4RRPA 5JXAL 5EWIL 4JY6B 2HWZH 4OFYD 1KIRA 3QA3B 3OKEA 4K3HA 1XR8B 4PLJC 3OX8A 5JORB 3BWUC 1MREL 2VDNL 4GMSL 4Z0BH 4C56E 1RUKL 3V0VB 1P9MC 4Y5VC 1NGQL 1AHWA 4Y4HC 1PG7W 35C8L 2ZUSA 4LKXA 3SDAD 4QOKA 1MNUL 1MFAL 3NVQA 4RGMB 1K4DB 2ARJB 3LMJL 4YBQC 1PZUB 3P9LA 2DIAA 2P5WB 3VFMA 1TQCC 4BYHA 4XNQB 5C0DA 4H26B 5TQ0L 1N26A 2GTZB 3ARGA 4RGNB 1N5YH 2J4WH 5IJVA 1FO0L 4LK4A 4WHTA 1T7ZA 3BP4A 1UB5A 2MQ0A 4TVSa 5GRWA 2HMIC 3DMMA 4OD1L 1C5DB 4UQ3A 4GMTH 1TJIH 2XIDA 3LVEA 2DQTH 4P2RA 3MRHA 3MPCA 4RCAA 4JG1H 3ZE0F 1AR1D 4LCIH 2VJXA 3NN8A 4L4TA 3H8NA 5CJOL 3EO9L 4R2GB 5J11B 1XGYL 5JW4M 1JGLL 4GKOA 4MD0A 3CPLA 4NKOB 2R2BB 1DBJH 4JFFA 4AYFA 3PQYA 4X6DB 2Q6WA 3BT2L 4NQXA 2V6HA 3QI9C 3VWJC 5FKPA 3JV5A 2VUYA 1V5JA 4MXWH 4XPGL 4N8CL 4XCNA 1T7WA 5MEOB 4ZUVA 4R0LA 4DVRH 1MJ7H 5GS2H 4S1QL 4LHUG 5TE4H 3BGAA 5IR1A 1YPZB 2X09A 5KSVA 4F9LA 2DQEH 1YEEH 3QYCA 5B39G 3BIKB 1MH5B 1KSRA 5EZLB 3VFWB 5H2BA 5D2LA 1CL7I 2NY2B 1A6UL 4EBQH 1GGBH 4OLZH 1ZVYA 4OLUH 1ZHBA 2VUOA 5JO5B 1KIUA 5ADPH 4P46A 1JNJA 4X6FA 3DV4A 4PJ5B 5GSVB 5KANI 4RAUA 1AKJD 3GJFH 1MCSA 1D5MA 3QDJB 1L7TH 3FO2B 4JHAH 3O0RL 4XP6L 5DJYB 2AJZB 3VFMB 5KVGH 5C0DB 1OW0A 2FHCA 2QSTA 4XVJH 4OTXL 1P4LB 2PO6C 2YMXH 5DD1H 3IAPA 3KPSD 4BUGA 4I0KA 5M7QA 1YZZA 4W6YB 3ALPA 1UADC 1JPGA 3NA4A 3VJ6A 2NYYD 5CJBA 4WI5A 5IJVB 5TDOA 1UB5B 3DMMB 2WIIA 4UQ3B 5FCUL 4IRJD 4ZUWB 4OI8A 1MHHA 4LU5H 4WFFD 1EFQA 1QSFA 4H0GA 3S36L 4P2RB 1KLFA 3O4OB 1WEJL 5FGCE 3BX7C 4POZC 3C5ZD 3WEXA 3NN8B 5FM5O 4L4TB 3HI1B 3MMEA 4JKLA 3JXAA 4ODBD 4BSJA 4P3DA 4MD0B 3MNZB 3P4MA 2I24N 3VFOA 5DDHA 1EIBA 1MLBB 3LEYL 4JFFB 3PQYB 5GQBA 4NQXB 1X5YA 5HYIA 4DZBA 1NLDL 2Z8VC 1F4HA 4XCNB 1KCUH 4NN7B 4XNXL 3S3JA 4XB7A 1HWHB 2A73A 2O5XL 4ZUVB 5IFJB 4R0LB 2NXZC 4S1SL 2BHYA 3O11A 3MNVA 4C83A 3MRBA 5A16A 5KSVB 5F1SA 1QD0A 3QIBD 5I15L 2VE6A 1G9EA 1CE1L 3CFCL 3WJJC 3BEWA 4JO2L 4LPTA 1U0QA 3SQOL 5HI4D 1BJ8A 1TQBB 5D2LB 3HNSL 3BRDA 1FG2A 2W1NA 5EU6A 1YECL 2IPTL 3O6FC 4ZO8A 3BMVA 3RZWA 4WU7B 2R29L 2X89D 3DV4B 1PKQA 1RURH 4O51A 4FP8L 2R2CA 1Y0LA 5KG9B 5E1HB 3PWNB 5DYOA 1B0RB 1EEZA 4FQHA 3ARSA 2P24A 3ZYZA 1JPGB 2MCG1 2BNQA 5GJSH 2P8MB 3VJ6B 4PJ8D 4XVTL 3RNQB 4R7NA 1ZOXA 3ULSB 1DQMH 3NIDE 4NQDD 1WTLA 5IKCB 1QSFB 2XTJB 3IJHA 1IFHH 4MXQD 3MRIA 1QFHA 3EGSA 3WEXB 3BEVA 3TN0B 1XF1A 1NC2D 4HLJA 3MMEB 1BFVH 3RFZC 4PR5B 4P3DB 4UDUA 5I18L 1OB1A 3WKML 1XGUA 1M71A 3I84A 4OLWH 3AGVA 2X9WA 2X6MA 4PS4H 1LDSA 5D1ZA 1KN2H 1HNFA 4I3RH 1T1ZB 3FOLA 1FV1A 5F7WC 3HAEB 1WC7A 5EU7C 4XNUL 4FQXD 3UJTH 3T0XA 5LBSL 3VFTA 5F7FA 4YBLB 4YHIA 5D1QA 1T03H 4FG6C 4DOHB 4YO0A 2ITDB 3LQAL 2K1MA 3GSVA 4NUGL 1X4XA 2YC1A 3O11B 4NZUH 3CLEH 3RBGA 4C83B 3MLTB 3CFDA 3BISA 5EBLA 2EXYD 3DROA 3LB6C 4RZCA 5C2UB 1WVZA 4PJBA 1YC7A 2R4SL 1LK2A 1SVCP 1KTKE 3FZUC 1W72A 5F9DC 5HHOA 1CZ8L 1RIVH 4IMLB 3HA0A 3VXSE 4MNHB 2HAZA 5DZOA 1FG2B 1IEAA 1I9RL 4YJZL 3FKUS 1MIEH 1JHKL 4WHCA 3NACH 4PV9B 3ABZA 3DYPA 1Q38A 2VN4A 1A47A 4FXGB 2DYPA 4AH2A 5HSFA 2XN9D 4U6XA 4WCYH 3VCLB 2W59A 1CGUA 1JRHH 1MAMH 4OZIB 1Y0LB 1Q1JH 3KXFE 3ULVF 3NTCH 3BOVA 3KNBA 5DYOB 1EEZB 4NNXA 5AAMA 2F5BL 5J1SC 1IEHA 1FZKA 1L0YA 4R7NB 4HCRH 5CGYC 5JIIA 1CLCA 2QQKL 4GXVH 1NAMB 4PD4J 3DVFA 1RVFL 3CXHJ 4L4VA 3UBXA 4QHNA 1RMFH 3DWTA 3IDYB 3IJHB 3KYAA 5I1DA 1VEPA 2FLBT 3C2SA 3FQTA 1G84A 3JUZA 3BUYB 3MRIB 3EGSB 4XVSH 2IH1B 3BEVB 1KJVB 3L95A 2XT1B 3O2VH 4HBCL 4UDUB 5CAYB 1OB1B 2XA3A 3O8XA 1XGUB 1M71B 1RAMA 2GKIA 1YY9D 4F7CB 2F53E 1L7IH 2DBLH 1FV1B 2XWBA 3C8KB 4KRPC 5E9DD 2D9CA 4X6CA 5JXED 1QRNE 1W2KT 3IETA 1H3VA 1NFKA 5D1QB 2YUZA 4YO0B 1CDGA 5E8PA 3Q5TA 4IDJL 2YC1B 2PYFA 4O5LL 5C0CB 3QXAB 3VRIA 4RGOL 3U4AA 4NZRL 1CBVL 1F5WA 4OQ1A 3CFDB 5EBLB 2A83A 3DROB 4RZCB 4EN3C 5ITBL 4JDVA 1U2CA 2VDQL 4PJBB 3EJYD 4HS6A 1LK2B 3RA7L 3SGJA 3SKNB 2DQGH 5DURD 3CK0L 5HHOB 1W72B 4JO3L 3C9NB 3VW3L 4YHKL 1QNZL 3T65A 4Z6AT 1JNLH 4PD4K 3I50L 1AO7D 1IEAB 1EV2E 4K07A 5E0QA 1GOFA 3CVHL 1I1AC 3KHQA 4OUOA 4JN1L 5EUOE 1M6OA 4AH2B 4U6XB 5EOQL 4ONHB 4D94A 3GHEH 4DGVL 1FGNL 1MCOL 1JZ8A 1U8QA 3WJLC 4MB3A 3LZFL 3AC0A 2J88L 2JCCB 2MTPA 3KNBB 1DBKL 5BVPL 2FGWL 2J8UE 3O41A 4PBXA 2VAJA 5JQHC 4NNXB 3CGTA 3KS0H 5CEZE 4GH7B 4EI5A 4JPIB 1FZKB 4ZQKA 2X44D 1T89A 4G7VL 1KXQE 4MZ2A 5DFTA 3HC4L 4KUCD 1LDPH 3D3VD 3FQTB 1GC1L 2D4FA 1IGIL 4LDEB 4PRHE 3SO3C 2ZCKL 1C5BL 3L95B 4YHZL 5LGKA 5ICYA 3BPCA 1UENA 3UO1H 3W39A 3NFPB 2W91A 5D7LE 4Y2DA 5I8KL 3TO4A 1ACYH 1MIMH 5F72S 2NZ9D 4FZEH 3ZT5A 5DHVA 1JPTL 4ISVA 1YNTB 1F4AA 3HE7C 2PXYC 4ONGL 4NO2A 4P5KA 1IKFH 4XTRD 4X6CB 5I0DA 3IETB 2X9XA 2AS5M 1DTUA 3L3JA 1WISA 2PYFB 3VRIB 2C4XA 1DBBL 4EXPX 5I8CA 5IOPB 4MJ2A 5I30H 4FQJH 2RBLA 4QGYA 4YDVA 5C7XH 2V17H 1DQQA 4HS6B 4I0PB 2Q76A 1DN0B 2OJEA 2E8YA 3QEQD 3BE1L 4XZUB 5CJ5A 4GXUN 3UPRA 4OQTH 3U46A 2VLJA 4JKPH 3T65B 3P30H 3MA9L 4IS6A 3RVVC 1JFQH 1WWBX 1AP2A 1V7NH 1NCWL 4ELKB 2ITCA 1H8NA 2FD6H 1OAUL 3MGAA 3ARYA 1SJVA 4N1HB 3PGFL 5C0BA 1OARH 1U8QB 4G7YH 5J57B 1JTTA