3RTXA

Crystal structure of mammalian capping enzyme (mce1) and pol ii ctd complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
343
structure length
262
Chain Sequence
SLKLGAIFLEGITVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIRLLEQKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDKVNGQAVPRYLIYDIIKFNAQPVGDCDFNIRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRPKQFFDINISRKLLEGDGLIFQPIGKYKPGRCDDILKWKPPSLNSAYNTAMAVCNSISNPVTKEMLFEFIDRCAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA-capping enzyme
publication title Structural insights to how mammalian capping enzyme reads the CTD code.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 68
structure length 262
sequence length 343
chains with identical sequence B
ec nomenclature ec 2.7.7.50: mRNA guanylyltransferase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01331 mRNA_cap_enzyme mRNA capping enzyme, catalytic domain
A PF03919 mRNA_cap_C mRNA capping enzyme, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3rtxA01
3.30.1490.430 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3rtxA02
1FVIA 3NBZB 3RTXA 3TY8A 3VNNA 3KYHC 3QWUA 4CC6A 4LH6A 1TA8A 2CFMA 1DGSA 3L2PA 4GLXA 1B04A 4PZ6A 3NC0B 3W1GA 3BAAA 2HVRA 5D1OA 4EFBA 3S24A 4PZ8A 2OWOA 4UCRA 4UCUA 5DISC 4DRFA 3GB8B 4UCVA 3NBYB 3GJXB 4UFZA 3JSNA 2Q2UA 1S68A 1CKNB 4EEQA 1V9PA 2HVQA 5D1OB 2HIVA 3BABA 3W5OA 1TAEA 4EFEA 1VS0A 1A0IA 3W1BA 3JSLA 1XK5A 1XDNA 4E6NA 1P8LA 3GDEA 1P16A 4CC5A 4PZ7A 2HVSA 2Q2TA 4UCOA 3PN1A 2HIXA 2VUGA 1CKOA 3RR5A 3UQ8A 4UCTA 3TY5A 4EQ5A 1CKMA 3BA9A 1X9NA 4UCSA 4LH7A 5FPOA 5D1PA 3BA8A 5FPRA 1CKNA 3TY9A
chains in the Genus database with same CATH superfamily
3K5HA 2FKLA 4EG0A 5EOYA 5BR8H 2GPSA 1S0NA 5KFXA 2W7OA 4XYMB 3GIKA 5KFDA 3BG5A 4WHXA 5KFEA 4A3DG 3T54A 2Z02A 3KYHC 2NVYA 4BWSC 1MZBA 3RV4A 3FKIA 5C44G 3DTFA 4O83A 2NU7B 5HBRB 4YY3H 2COGA 1JDBB 2UXBH 4JUZA 2R8KA 2E2HA 5DG8A 4RB0A 5BYBA 5L1IA 4O7VA 3RAQA 4DL3A 1I94H 3L2PA 2O03A 4MV9A 3N41B 2VQEH 2J6SA 3TW7A 2XGPA 5KT3A 2V59A 2Q7DA 2IBKA 2RGRA 4TM5A 1E4FT 3H4DA 3KTMA 2FPGB 3T1YH 2COJA 2HHHH 3QQMA 1EKVA 4DR3H 4RNOA 3U55A 5JH7F 3H0GG 3RGXA 2BQ3A 2ZDHA 3R9RA 3T9DA 4TVIA 3FMAA 4MV7A 4PZ8A 1RK6A 4O3QA 2C22A 4JV1A 1Z2OX 2VUMG 3TIGA 2NVXA 2V5AA 3NGDA 3GTJA 5KG1A 4MV4A 3UYYA 1M6VA 4JXUA 2A1HA 4UCRA 4CMDA 2QK4A 4YJ2F 3WWJA 4UCUA 5BPHA 1RJRA 4O7WA 3R5HA 2NU6B 3GB8B 3NBYB 5FNVF 4TQRA 4O7NA 2Y0SE 4RCNA 5FLMG 1S68A 2R84A 1I1KA 3SGIA 2MCTA 4I7HA 4QWCA 3KREA 3HOWG 1V9PA 1CQIB 5D1OB 2HIVA 4J9LA 3BABA 1I1LA 5DG9A 5JQWA 3KAJA 4F4WA 3U0GA 5C3EG 1N33H 5KFSA 2I80A 4O7ZA 4RB1A 2ABJA 3PFFA 1VS0A 3HKZA 2JEFA 3C0FB 4QWEA 3W1BA 4TUYF 3RB4A 4O7SA 3T9FA 2W8LA 3U9SA 4ZOLF 3GV7B 2EJ3A 2ZDGA 3K5IA 1RJQA 5KG6A 2COIA 4AYBA 3RIZA 4DV3H 4F50A 1EUDB 4DUYH 3H3VH 4HNVA 3AYHB 4NZNA 3RAXA 4JV2A 4ED8A 2JEGA 4DIMA 4YHHH 2ASDA 1P8LA 2FLLA 3GDEA 4ED3A 3JZ6A 2R7LA 5BWVA 4QW8A 4JI4H 3H4BA 1VKZA 1UC8A 4Q43A 3LP8A 4EYHB 1IBLH 4GLWA 5GONF 3EPIA 4PZ7A 2YW2A 1M0TA 4J9QA 5KG3A 4YB8B 3PW0A 3AW8A 2CNQA 4MV3A 2C35B 3R23A 4BXXG 4GKJH 3SNOA 4UCOA 5IWAH 4ECVA 2DIKA 1WR2A 2FJZA 4C2MA 1T3NA 4O7TA 5KT4A 4ED0A 1XNQH 4FFLA 5KFZA 2UVWA 1S0MA 4NYEA 4RUAA 1N56A 4O3RA 2HDKA 4ZQIA 2UUAH 4CKBA 5DAAA 3EYYA 4I50F 3L4JA 4CKEA 5JUMA 5KG0A 5KT5A 4GC7A 5IYCG 4TQSA 4HN2A 4MV6A 2UUCH 2YRWA 1ZAUA 2AU0A 2VA2A 1JLLB 3SI8A 4JV5H 4O4LF 4FBTA 2WE6A 4UCSA 2XD4A 5I5XA 4LH7A 3U9TA 3MWMA 4YR2A 4J9SA 4I55F 4MA5A 1HR0H 3TINA 3I12A 4DL2A 1A9XA 1ZETA 2AQ4A 1GSOA 4Q4DA 1B33N 3G8CA 1CKNA 2UVUA 2YZGA 1T36A 1ZHSA 5E25A 4F4ZA 4GC6A 4X62H 2CNVA 3NBZB 5BWWA 5KFQA 3HOYG 3KHLA 1TWCA 2C2EA 1I7NA 2QYZA 3QWUA 3H20A 4ECZA 5F9LA 2FMAA 4RUCA 3WO0A 1FJGH 4ZI7F 4LSXA 4IIJF 2JA6A 4J9NA 4EEYA 4RAYA 4M7EA 3MR2A 4IWYA 1Y1WG 4A3FG 2R7MA 2FK2A 3R5XA 3LULA 4CMFA 3H0GA 3OSPA 4LF5H 4A3JG 2JA8G 2WTFA 3T9EA 1ZQ7A 3TIIA 3IN5A 2R7KA 1TWAA 5BWUA 2RF4A 2W8KA 4PZ6A 2HGWA 1K1QA 5I5WA 2WB1E 3T1HH 3GLKA 3M4IA 4J0MA 3J81W 2R8IA 1SCUB 1S03G 4E4TA 1S9FA 4FE2A 5DQGA 2J6TA 2JA5G 4DR1H 2HVRA 5D1OA 5LXTF 4NXMH 5DGIA 1S97A 2W70A 3MFHA 4LFBH 3HOZG 2I87A 4J9OA 1C3OA 1RK5A 1BXRA 1VBGA 3U54A 5C8YF 3N42B 3PW7A 3G6VA 1WSCA 3T7AA 2AGQA 2RDIA 4FFNA 3PR5B 3HOVG 2HG8A 1KJ8A 5IYDG 4X66H 1N34H 4A3LG 2OWOA 2GLTA 1R9TA 3G6XA 4DRFA 3VOTA 3TQ1A 4NLGA 4B3RH 4YR3A 2DPIA 4BBSG 3JSNA 2Q2UA 3H40A 4XZ3B 3Q1KA 2W6QA 3MFIA 4MV1A 5KFWA 4RZRA 5KFGA 2CNUA 1CKNB 3TEKA 2DLNA 4ECQA 4A3CG 5KFOA 5KFCA 5IYBG 4DR7H 2ODTX 2AGOA 5K2MA 3MR5A 2VQDA 4FU0A 2JA6G 2ZGIA 2FK3A 2M05A 5KKNB 5KT7A 3SE7A 2R6FA 5KT2A 3HBLA 3Q8RB 4IR1A 1BJTA 4EYIB 2C2RA 3VPDA 3TW6A 4R8UA 2WAQA 2EIYA 2XCAA 4PWQA 4EBCA 4MTDA 3M9OB 5KX5F 1KJQA 2W9CB 4IRDA 1XDNA 5LA6F 1KJ9A 3MR3A 3RUPA 4ED2A 3L4KA 2JEJA 4C5CA 3QZ8A 2FPIB 4ETSA 4EGQA 1JIHA 2YU9A 1P16A 4A3EG 4CC5A 4QIWA 1I1MA 3KHGA 1VAJA 2OLSA 1IOVA 4Q8EA 4FFOA 1J5EH 1IBMH 4JI0H 2C28A 4PDBA 5C4XG 4IHJF 4BBRG 4O2BF 3V6JA 2Q2TA 1I50A 5L1KA 3FDSA 4JI1H 2V4RA 3BJYA 4LF4H 5J2UF 4BY7G 1ULZA 1Y14B 2GQSA 2FLNA 1EKPA 1IYDA 2VUGA 4LMYA 5KFYA 5BWTA 4ECYA 3GTLA 2W9BA 3Q8SB 1CKOA 3RR5A 3UQ8A 3WWHA 2ASJA 4DL5A 3QFFA 3T9CA 4HNTA 3VMMA 3GILA 5LMUH 4U6PA 5DGAA 1GYFA 4QW9A 3MWEA 1AN7A 5JVLA 4O7RA 2UUBH 3GIMA 2FE3A 1DAAA 4EQ5A 4O86A 5CB4F 1A3GA 3VPBA 5BWRA 5KFUA 1CKMA 2EJ2A 2Y4RA 3JRXA 3RB6A 3Q8QB 2UVVA 1I6UA 5LP6F 2YCHA 4LF7H 2SCUB 2W6PA 5BMVF 3GIIA 4DQNA 4O3SA 1AUXA 4ECTA 1Z2NX 2VOBA 5DQIA 4O7YA 1T94A 1VBHA 5D1PA 2FLPA 5FD5A 2R7ZA 2V58A 5KFJA 1CS0A 2W9AA 3WO1A 4ED1A 5EZYF 1OBDA 5EDWA 4I4TF 2NU8B 1V4YA 4JI5H 4R8UB 2HHFB 3RTXA 1IYEA 1Y1WA 4QWAA 3TY8A 5CE8A 3VNNA 4CE5A 5EWFA 1WH2A 3HXLA 5KG2A 3PZPA 2ZDQA 3MR6A 3BACA 4JI6H 4QJFA 5KFNA 2YZLA 4FGRA 4CC6A 4DR6H 4LH6A 4NXNH 1TA8A 1GSAA 2CFMA 4HNUA 2JA5A 4O4IF 4ECRA 2UVRA 4GLXA 3GTGA 3N40P 4UUGA 4EBDA 1GSHA 1EZ1A 2Z04A 4IZOA 1S0OA 2UXDH 3V4ZA 4DLKA 2NUAB 4QSHA 2R7NA 3V6HA 1HNWH 2PN1A 3K3VA 5BWXA 1CQJB 2Y0SA 2GPWA 3PW4A 1K83A 1KJIA 3BAAA 3E5NA 2RDJA 5I5YA 3GIPA 4RNNA 2XC9A 2W9BB 4WBNF 3N44B 4Y8VB 5KFPA 3JAMW 4O3OA 3UZOA 2YS6A 4U7CA 5LL6b 4J9KA 3PO3G 3RV3A 5KFKA 3TQTA 1RJPA 5I47A 4ED6A 1B6SA 3M9NB 5C5JA 1C30A 4DAAA 4YP3A 2R7ZG 3T9AA 3JRWA 3WWIA 2DPJA 2R92A 1A0GA 2CZGA 3JZIA 5CAEB 5C1OA 5I5VA 3HOXG 4B3TH 3GV8B 2X5RA 2W9CA 1BNCA 1DV1A 3GJXB 2DWCA 4UFZA 1SYXB 5CM0A 2CQYA 1I3QA 4L1KA 3ORQA 4ECUA 3GIQA 5KFIA 2XGQA 4Q4CA 4C5AA 2XCPA 1HNXH 2C00A 4DR5H 5DG7A 3GTKA 2WYOA 3F8NA 2DAAA 2HVQA 3M9MB 1G2WA 3DAAA 4A2BA 5I5TA 5EWGA 4DV0H 1EKFA 2PMZA 3JZFA 1TWHA 1I7LA 5FJ8G 2R8HA 2ZM6H 3W5OA 4C5BA 1GO3E 1TAEA 4DV7H 3PVXA 3OSNA 5LYJF 2FPPB 1ZHQA 4A3KG 1A0IA 2IA6A 2B63G 5KFHA 2BR0A 5HV6A 1SFOA 2V9WA 2I8CA 2W6ZA 2W6NA 1XK5A 1E4GT 5CA0F 4M9UA 3GIDA 2J6UA 3RJ0A 4E6NA 4QIWE 4ME6A 2R87A 2W6MA 4O7LA 3LQSA 4O4HF 1CE8A 3KXYT 5KFRA 4IRKA 3I4NG 2QB5A 1FKAH 1BGWA 3CQZA 4DV5H 1KTAA 4YBZB 2HJWA 4LSAA 3OHBA 1W93A 5JVDF 3GTQA 5KS8A 5FR9A 5LMNH 3T5LA 1UNNC 3LMLA 3HB9A 2KSWA 3Q8PB 2HVSA 2YRXA 3CSWA 2UU9H 2R92G 2YL2A 4M0JA 2GQRA 3G8DA 3HKZE 5FD6A 2BQUA 4A3IG 5KFTA 4Q8FA 3KAKA 1M0WA 1WRVA 3LWBA 4YAJB 4JI2H 3DTGA 2NU9B 5KG4A 4FFRA 4B3SH 1E4EA 4MTEA 4AYBE 2HHFA 3RB0A 4NZMA 4UCTA 3TY5A 1O75A 1GLVA 2F4VH 1KC7A 5L1JA 3RFCA 2YS7A 4ECWA 2BQRA 4LF8H 2FP4B 4RNMA 2VQFH 4ED7A 4DR4H 5CA1F 4YJ3F 4NZOA 5KT6A 1IOWA 4ECXA 4LF6H 1TWGA 2HGSA 1EUCB 5FPOA 1I2KA 2AGPA 4ZHQF 1Z2PX 1DV2A 3ETJA 4EBEA 4JYAH 5DQHA 4ECSA 2W7PA 2CKZB 2XCLA 2FB9A 4O2AF 2WDTA 3BA8A 1KT8A 5FPRA 5KG7A 3V6KA 3RB3A 2UXCH 1W96A 5DGHA 4RB3C 2WB1A 4EGJA 1EHIA 1FVIA 5L1LA 2EJ0A 1KBLA 2E5LH 1JXLA 2CW8A 1V51A 3HT5A 4Q44A 5T14A 4B3MH 2ZJTA 4FFMA 2W71A 2W57A 3KHRA 4MV8A 3AX6A 2R86A 3KALA 1KEEA 5A2QW 1TWFA 3KHHA 2RGVA 4J9RA 3T5KA 4LFCH 3HOUG 5IP7G 4GKKH 3MJFA 2IP4A 3RBDA 1I2LA 3HO8A 5D8DA 4DR2H 4J9MA 1SEIA 5FLXW 5BPFA 4FS2A 2R93A 1DGSA 3J7AK 3Q2OA 4O84A 4OX9H 3UFXB 1B04A 2YWVA 3FKIG 5IP9G 4O82A 4CHIA 1K1SA 1M7JA 3NC0B 4JV0A 4PBCA 3W1GA 2OH2A 4FM9A 2JEIA 2HGXA 4IWXA 5LOVF 2JA7A 2ALZA 2DABA 2J9GA 3GTMA 4K0KH 4FS1A 1WCMA 3PO2G 3GV5B 5EWEA 1E4EB 1N32H 2PBZA 3I4MG 4DV2H 4EFBA 1DIKA 2R82A 3S24A 1IBKH 3GTPA 4DV1H 4AQYH 4A3MG 1GGOA 2YZNA 4RZQA 2VPQA 4WD3A 4DL7A 4R7RA 2PVPA 3IG0A 4HQ6A 4X64H 4DUZH 1Y1VA 1XMOH 5DLGA 2YZMA 3OTOH 5DISC 4IRCA 4UCVA 4JI7H 5BYAA 4O3NA 3RGZA 2QF7A 2X0SA 3R5FA 2ASLA 3VPCA 5KFAA 4YAKB 2PMZE 2VA3A 1JDEA 1RYSA 2E2IA 2B63A 5IT9W 1OWTA 3N6RA 4EEQA 5I60A 4A2AA 4O4JF 3OUUA 4IAJA 3NUAA 4APMA 1PX2A 2DZDA 3ORRA 4YQWA 5F9NA 1B6RA 3BQ0A 3RF2A 5CR5A 2R93G 3RBEA 4EFEA 4O81A 2R85A 5I5SA 2R8JA 3JSLA 1AUVA 4MAMA 2VPSA 4RAZA 3QZ7A 4CKCA 3UZBA 2FK1A 4BY1G 1XMQH 5J2TF 5C1PA 2ATLA 1ET0A 1JKJB 3GIJA 4LF9H 3T5HA 2JA7G 5L9XA 5H80A 4Q45A 1WCMG 5I5UA 3T5JA 4KHPH 1L2ZA 3PR4A 1PK8A 1UC9A 4F4YA 1JX4A 1XNRH 2V4QA 5DGBA 1RYRA 4JI8H 4Q0YA 4J9PA 4O3PA 3EPGA 5DLFA 5KG5A 3PW2A 3K3PA 3OUZA 4QWBA 4DV6H 4F4XA 4HYKA 4JI3H 1A48A 5JQGF 2XIGA 1S10A 1Y1VG 5K3WA 2CW7A 3CVZA 4IR9A 2P0AA 3PN1A 3MWDA 3V4SA 2WAQE 2W6OA 2HIXA 3N43B 1N48A 4QWDA 1OBGA 3N8DA 3ETHA 4A3GG 1HNZH 4XYLB 3BQ2A 4RU9A 4FBUA 5HNEA 3PW5A 4MA0A 4FFPA 3GTOA 4XX0B 4TV9F 3GQCA 3CEBA 4LFAH 5KFVA 2VR1A 4DV4H 3BA9A 1N36H 4DL6A 1KJJA 1EYZA 1X9NA 4DL4A 4A93G 1KUTA 4K6NA 4HR7A 3J80W 3BQ1A 2R8GA 5DMXA 5IYZF 3T99A 5KFBA 3OHAA 3T9BA 3WNZA 3N6XA 2VUMA 2YYAA 4G3IA 5KFLA 4X65H 3DF7A 3VA7A 5KFMA 4RB2C 4TV8F 4YR0A 3G6YA 2C2DA 4A3BG 3TY9A 5KFFA 2IMWP
chains in the Genus database with same CATH topology
4RB3C 5EOYA 5BR8H 4X62H 1FVIA 2E5LH 4JI5H 3NBZB 3RTXA 2CW8A 3TY8A 3VNNA 3KYHC 3H20A 3QWUA 4BWSC 4B3MH 2ZJTA 1MZBA 1WH2A 2W57A 3HXLA 3KALA 5A2QW 1FJGH 4JI6H 4DR6H 4YY3H 4CC6A 2RGVA 4LFCH 2UXBH 4GKKH 4LH6A 4LSXA 4RB0A 4NXNH 1TA8A 4RAYA 2CFMA 4M7EA 4DR2H 1SEIA 5FLXW 4LF5H 1I94H 1DGSA 3L2PA 4GLXA 2O03A 3N40P 4MV9A 4OX9H 3N41B 2VQEH 3J7AK 2UXDH 1B04A 4PZ6A 1HNWH 3NC0B 3K3VA 3W1GA 3T1HH 4FM9A 3M4IA 4J0MA 3J81W 2RGRA 1E4FT 1S03G 3BAAA 3T1YH 2HHHH 4DR1H 2HVRA 4DR3H 4K0KH 5D1OA 4NXMH 3RGXA 3N44B 5LL6b 3JAMW 4LFBH 1N32H 3FMAA 4EFBA 3N42B 4DV2H 3S24A 1IBKH 4PZ8A 4MV7A 4AQYH 1Z2OX 4RZQA 4R7RA 3IG0A 4X66H 1N34H 4X64H 4DUZH 2OWOA 4UCRA 1XMOH 3OTOH 4B3TH 4UCUA 5DISC 4DRFA 3GB8B 4UCVA 3NBYB 3GJXB 4UFZA 4JI7H 1SYXB 3JSNA 2Q2UA 3RGZA 4B3RH 1HNXH 1S68A 4DR5H 2MCTA 4I7HA 1CKNB 2WYOA 5IT9W 4EEQA 4DR7H 1V9PA 3F8NA 2HVQA 5D1OB 4A2BA 4A2AA 2HIVA 4IAJA 4DV0H 4APMA 3BABA 3KAJA 2ZM6H 3W5OA 1BJTA 3RF2A 1TAEA 4DV7H 4EFEA 1N33H 4RB1A 1VS0A 1ZHQA 1A0IA 3C0FB 3W1BA 3JSLA 4DV1H 2VPSA 4RAZA 4MTDA 1XMQH 1XK5A 1E4GT 1XDNA 3RIZA 4DV3H 4LF9H 4DUYH 3RJ0A 4E6NA 3L4KA 3KXYT 4KHPH 1L2ZA 4YHHH 1P8LA 3GDEA 4ETSA 4JI4H 1P16A 1BGWA 4CC5A 4DV5H 1FKAH 4JI8H 1XNRH 1IBLH 4Q0YA 4LSAA 4PZ7A 1M0TA 5LMNH 4DV6H 1J5EH 1IBMH 4JI0H 4PDBA 3LMLA 4JI3H 2UU9H 2KSWA 2HVSA 2XIGA 2Q2TA 4LF4H 2CW7A 3CVZA 4JI1H 4GKJH 4UCOA 5FD6A 3PN1A 5IWAH 1XNQH 2HIXA 3N43B 4LMYA 2VUGA 3KAKA 1M0WA 4JI2H 1CKOA 1HNZH 4B3SH 3RR5A 3UQ8A 4MTEA 2UUAH 3EYYA 4UCTA 5LMUH 3L4JA 3TY5A 1GYFA 1AN7A 2UUBH 1O75A 2FE3A 4EQ5A 4LFAH 2F4VH 2UUCH 1CKMA 4DV4H 3BA9A 4LF8H 1I6UA 1N36H 2VQFH 1X9NA 2YCHA 4LF7H 4DR4H 4JV5H 3J80W 2WE6A 4UCSA 4LF6H 1Z2NX 2VOBA 2HGSA 4LH7A 3MWMA 5FPOA 3N6XA 1Z2PX 4JYAH 1HR0H 5D1PA 4X65H 3DF7A 5FD5A 4RB2C 2WDTA 3BA8A 5FPRA 1CKNA 3TY9A 2UXCH 1ZHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FVI A;  3NBZ B;  3RTX A;  3TY8 A;  3VNN A;  3KYH C;  3QWU A;  4CC6 A;  4LH6 A;  1TA8 A;  2CFM A;  1DGS A;  3L2P A;  4GLX A;  1B04 A;  4PZ6 A;  3NC0 B;  3W1G A;  3BAA A;  2HVR A;  5D1O A;  4EFB A;  3S24 A;  4PZ8 A;  2OWO A;  4UCR A;  4UCU A;  5DIS C;  4DRF A;  3GB8 B;  4UCV A;  3NBY B;  3GJX B;  4UFZ A;  3JSN A;  2Q2U A;  1S68 A;  1CKN B;  4EEQ A;  1V9P A;  2HVQ A;  5D1O B;  2HIV A;  3BAB A;  3W5O A;  1TAE A;  4EFE A;  1VS0 A;  1A0I A;  3W1B A;  3JSL A;  1XK5 A;  1XDN A;  4E6N A;  1P8L A;  3GDE A;  1P16 A;  4CC5 A;  4PZ7 A;  2HVS A;  2Q2T A;  4UCO A;  3PN1 A;  2HIX A;  2VUG A;  1CKO A;  3RR5 A;  3UQ8 A;  4UCT A;  3TY5 A;  4EQ5 A;  1CKM A;  3BA9 A;  1X9N A;  4UCS A;  4LH7 A;  5FPO A;  5D1P A;  3BA8 A;  5FPR A;  1CKN A;  3TY9 A; 
#chains in the Genus database with same CATH topology
 3K5H A;  2FKL A;  4EG0 A;  5EOY A;  5BR8 H;  2GPS A;  1S0N A;  5KFX A;  2W7O A;  4XYM B;  3GIK A;  5KFD A;  3BG5 A;  4WHX A;  5KFE A;  4A3D G;  3T54 A;  2Z02 A;  3KYH C;  2NVY A;  4BWS C;  1MZB A;  3RV4 A;  3FKI A;  5C44 G;  3DTF A;  4O83 A;  2NU7 B;  5HBR B;  4YY3 H;  2COG A;  1JDB B;  2UXB H;  4JUZ A;  2R8K A;  2E2H A;  5DG8 A;  4RB0 A;  5BYB A;  5L1I A;  4O7V A;  3RAQ A;  4DL3 A;  1I94 H;  3L2P A;  2O03 A;  4MV9 A;  3N41 B;  2VQE H;  2J6S A;  3TW7 A;  2XGP A;  5KT3 A;  2V59 A;  2Q7D A;  2IBK A;  2RGR A;  4TM5 A;  1E4F T;  3H4D A;  3KTM A;  2FPG B;  3T1Y H;  2COJ A;  2HHH H;  3QQM A;  1EKV A;  4DR3 H;  4RNO A;  3U55 A;  5JH7 F;  3H0G G;  3RGX A;  2BQ3 A;  2ZDH A;  3R9R A;  3T9D A;  4TVI A;  3FMA A;  4MV7 A;  4PZ8 A;  1RK6 A;  4O3Q A;  2C22 A;  4JV1 A;  1Z2O X;  2VUM G;  3TIG A;  2NVX A;  2V5A A;  3NGD A;  3GTJ A;  5KG1 A;  4MV4 A;  3UYY A;  1M6V A;  4JXU A;  2A1H A;  4UCR A;  4CMD A;  2QK4 A;  4YJ2 F;  3WWJ A;  4UCU A;  5BPH A;  1RJR A;  4O7W A;  3R5H A;  2NU6 B;  3GB8 B;  3NBY B;  5FNV F;  4TQR A;  4O7N A;  2Y0S E;  4RCN A;  5FLM G;  1S68 A;  2R84 A;  1I1K A;  3SGI A;  2MCT A;  4I7H A;  4QWC A;  3KRE A;  3HOW G;  1V9P A;  1CQI B;  5D1O B;  2HIV A;  4J9L A;  3BAB A;  1I1L A;  5DG9 A;  5JQW A;  3KAJ A;  4F4W A;  3U0G A;  5C3E G;  1N33 H;  5KFS A;  2I80 A;  4O7Z A;  4RB1 A;  2ABJ A;  3PFF A;  1VS0 A;  3HKZ A;  2JEF A;  3C0F B;  4QWE A;  3W1B A;  4TUY F;  3RB4 A;  4O7S A;  3T9F A;  2W8L A;  3U9S A;  4ZOL F;  3GV7 B;  2EJ3 A;  2ZDG A;  3K5I A;  1RJQ A;  5KG6 A;  2COI A;  4AYB A;  3RIZ A;  4DV3 H;  4F50 A;  1EUD B;  4DUY H;  3H3V H;  4HNV A;  3AYH B;  4NZN A;  3RAX A;  4JV2 A;  4ED8 A;  2JEG A;  4DIM A;  4YHH H;  2ASD A;  1P8L A;  2FLL A;  3GDE A;  4ED3 A;  3JZ6 A;  2R7L A;  5BWV A;  4QW8 A;  4JI4 H;  3H4B A;  1VKZ A;  1UC8 A;  4Q43 A;  3LP8 A;  4EYH B;  1IBL H;  4GLW A;  5GON F;  3EPI A;  4PZ7 A;  2YW2 A;  1M0T A;  4J9Q A;  5KG3 A;  4YB8 B;  3PW0 A;  3AW8 A;  2CNQ A;  4MV3 A;  2C35 B;  3R23 A;  4BXX G;  4GKJ H;  3SNO A;  4UCO A;  5IWA H;  4ECV A;  2DIK A;  1WR2 A;  2FJZ A;  4C2M A;  1T3N A;  4O7T A;  5KT4 A;  4ED0 A;  1XNQ H;  4FFL A;  5KFZ A;  2UVW A;  1S0M A;  4NYE A;  4RUA A;  1N56 A;  4O3R A;  2HDK A;  4ZQI A;  2UUA H;  4CKB A;  5DAA A;  3EYY A;  4I50 F;  3L4J A;  4CKE A;  5JUM A;  5KG0 A;  5KT5 A;  4GC7 A;  5IYC G;  4TQS A;  4HN2 A;  4MV6 A;  2UUC H;  2YRW A;  1ZAU A;  2AU0 A;  2VA2 A;  1JLL B;  3SI8 A;  4JV5 H;  4O4L F;  4FBT A;  2WE6 A;  4UCS A;  2XD4 A;  5I5X A;  4LH7 A;  3U9T A;  3MWM A;  4YR2 A;  4J9S A;  4I55 F;  4MA5 A;  1HR0 H;  3TIN A;  3I12 A;  4DL2 A;  1A9X A;  1ZET A;  2AQ4 A;  1GSO A;  4Q4D A;  1B33 N;  3G8C A;  1CKN A;  2UVU A;  2YZG A;  1T36 A;  1ZHS A;  5E25 A;  4F4Z A;  4GC6 A;  4X62 H;  2CNV A;  3NBZ B;  5BWW A;  5KFQ A;  3HOY G;  3KHL A;  1TWC A;  2C2E A;  1I7N A;  2QYZ A;  3QWU A;  3H20 A;  4ECZ A;  5F9L A;  2FMA A;  4RUC A;  3WO0 A;  1FJG H;  4ZI7 F;  4LSX A;  4IIJ F;  2JA6 A;  4J9N A;  4EEY A;  4RAY A;  4M7E A;  3MR2 A;  4IWY A;  1Y1W G;  4A3F G;  2R7M A;  2FK2 A;  3R5X A;  3LUL A;  4CMF A;  3H0G A;  3OSP A;  4LF5 H;  4A3J G;  2JA8 G;  2WTF A;  3T9E A;  1ZQ7 A;  3TII A;  3IN5 A;  2R7K A;  1TWA A;  5BWU A;  2RF4 A;  2W8K A;  4PZ6 A;  2HGW A;  1K1Q A;  5I5W A;  2WB1 E;  3T1H H;  3GLK A;  3M4I A;  4J0M A;  3J81 W;  2R8I A;  1SCU B;  1S03 G;  4E4T A;  1S9F A;  4FE2 A;  5DQG A;  2J6T A;  2JA5 G;  4DR1 H;  2HVR A;  5D1O A;  5LXT F;  4NXM H;  5DGI A;  1S97 A;  2W70 A;  3MFH A;  4LFB H;  3HOZ G;  2I87 A;  4J9O A;  1C3O A;  1RK5 A;  1BXR A;  1VBG A;  3U54 A;  5C8Y F;  3N42 B;  3PW7 A;  3G6V A;  1WSC A;  3T7A A;  2AGQ A;  2RDI A;  4FFN A;  3PR5 B;  3HOV G;  2HG8 A;  1KJ8 A;  5IYD G;  4X66 H;  1N34 H;  4A3L G;  2OWO A;  2GLT A;  1R9T A;  3G6X A;  4DRF A;  3VOT A;  3TQ1 A;  4NLG A;  4B3R H;  4YR3 A;  2DPI A;  4BBS G;  3JSN A;  2Q2U A;  3H40 A;  4XZ3 B;  3Q1K A;  2W6Q A;  3MFI A;  4MV1 A;  5KFW A;  4RZR A;  5KFG A;  2CNU A;  1CKN B;  3TEK A;  2DLN A;  4ECQ A;  4A3C G;  5KFO A;  5KFC A;  5IYB G;  4DR7 H;  2ODT X;  2AGO A;  5K2M A;  3MR5 A;  2VQD A;  4FU0 A;  2JA6 G;  2ZGI A;  2FK3 A;  2M05 A;  5KKN B;  5KT7 A;  3SE7 A;  2R6F A;  5KT2 A;  3HBL A;  3Q8R B;  4IR1 A;  1BJT A;  4EYI B;  2C2R A;  3VPD A;  3TW6 A;  4R8U A;  2WAQ A;  2EIY A;  2XCA A;  4PWQ A;  4EBC A;  4MTD A;  3M9O B;  5KX5 F;  1KJQ A;  2W9C B;  4IRD A;  1XDN A;  5LA6 F;  1KJ9 A;  3MR3 A;  3RUP A;  4ED2 A;  3L4K A;  2JEJ A;  4C5C A;  3QZ8 A;  2FPI B;  4ETS A;  4EGQ A;  1JIH A;  2YU9 A;  1P16 A;  4A3E G;  4CC5 A;  4QIW A;  1I1M A;  3KHG A;  1VAJ A;  2OLS A;  1IOV A;  4Q8E A;  4FFO A;  1J5E H;  1IBM H;  4JI0 H;  2C28 A;  4PDB A;  5C4X G;  4IHJ F;  4BBR G;  4O2B F;  3V6J A;  2Q2T A;  1I50 A;  5L1K A;  3FDS A;  4JI1 H;  2V4R A;  3BJY A;  4LF4 H;  5J2U F;  4BY7 G;  1ULZ A;  1Y14 B;  2GQS A;  2FLN A;  1EKP A;  1IYD A;  2VUG A;  4LMY A;  5KFY A;  5BWT A;  4ECY A;  3GTL A;  2W9B A;  3Q8S B;  1CKO A;  3RR5 A;  3UQ8 A;  3WWH A;  2ASJ A;  4DL5 A;  3QFF A;  3T9C A;  4HNT A;  3VMM A;  3GIL A;  5LMU H;  4U6P A;  5DGA A;  1GYF A;  4QW9 A;  3MWE A;  1AN7 A;  5JVL A;  4O7R A;  2UUB H;  3GIM A;  2FE3 A;  1DAA A;  4EQ5 A;  4O86 A;  5CB4 F;  1A3G A;  3VPB A;  5BWR A;  5KFU A;  1CKM A;  2EJ2 A;  2Y4R A;  3JRX A;  3RB6 A;  3Q8Q B;  2UVV A;  1I6U A;  5LP6 F;  2YCH A;  4LF7 H;  2SCU B;  2W6P A;  5BMV F;  3GII A;  4DQN A;  4O3S A;  1AUX A;  4ECT A;  1Z2N X;  2VOB A;  5DQI A;  4O7Y A;  1T94 A;  1VBH A;  5D1P A;  2FLP A;  5FD5 A;  2R7Z A;  2V58 A;  5KFJ A;  1CS0 A;  2W9A A;  3WO1 A;  4ED1 A;  5EZY F;  1OBD A;  5EDW A;  4I4T F;  2NU8 B;  1V4Y A;  4JI5 H;  4R8U B;  2HHF B;  3RTX A;  1IYE A;  1Y1W A;  4QWA A;  3TY8 A;  5CE8 A;  3VNN A;  4CE5 A;  5EWF A;  1WH2 A;  3HXL A;  5KG2 A;  3PZP A;  2ZDQ A;  3MR6 A;  3BAC A;  4JI6 H;  4QJF A;  5KFN A;  2YZL A;  4FGR A;  4CC6 A;  4DR6 H;  4LH6 A;  4NXN H;  1TA8 A;  1GSA A;  2CFM A;  4HNU A;  2JA5 A;  4O4I F;  4ECR A;  2UVR A;  4GLX A;  3GTG A;  3N40 P;  4UUG A;  4EBD A;  1GSH A;  1EZ1 A;  2Z04 A;  4IZO A;  1S0O A;  2UXD H;  3V4Z A;  4DLK A;  2NUA B;  4QSH A;  2R7N A;  3V6H A;  1HNW H;  2PN1 A;  3K3V A;  5BWX A;  1CQJ B;  2Y0S A;  2GPW A;  3PW4 A;  1K83 A;  1KJI A;  3BAA A;  3E5N A;  2RDJ A;  5I5Y A;  3GIP A;  4RNN A;  2XC9 A;  2W9B B;  4WBN F;  3N44 B;  4Y8V B;  5KFP A;  3JAM W;  4O3O A;  3UZO A;  2YS6 A;  4U7C A;  5LL6 b;  4J9K A;  3PO3 G;  3RV3 A;  5KFK A;  3TQT A;  1RJP A;  5I47 A;  4ED6 A;  1B6S A;  3M9N B;  5C5J A;  1C30 A;  4DAA A;  4YP3 A;  2R7Z G;  3T9A A;  3JRW A;  3WWI A;  2DPJ A;  2R92 A;  1A0G A;  2CZG A;  3JZI A;  5CAE B;  5C1O A;  5I5V A;  3HOX G;  4B3T H;  3GV8 B;  2X5R A;  2W9C A;  1BNC A;  1DV1 A;  3GJX B;  2DWC A;  4UFZ A;  1SYX B;  5CM0 A;  2CQY A;  1I3Q A;  4L1K A;  3ORQ A;  4ECU A;  3GIQ A;  5KFI A;  2XGQ A;  4Q4C A;  4C5A A;  2XCP A;  1HNX H;  2C00 A;  4DR5 H;  5DG7 A;  3GTK A;  2WYO A;  3F8N A;  2DAA A;  2HVQ A;  3M9M B;  1G2W A;  3DAA A;  4A2B A;  5I5T A;  5EWG A;  4DV0 H;  1EKF A;  2PMZ A;  3JZF A;  1TWH A;  1I7L A;  5FJ8 G;  2R8H A;  2ZM6 H;  3W5O A;  4C5B A;  1GO3 E;  1TAE A;  4DV7 H;  3PVX A;  3OSN A;  5LYJ F;  2FPP B;  1ZHQ A;  4A3K G;  1A0I A;  2IA6 A;  2B63 G;  5KFH A;  2BR0 A;  5HV6 A;  1SFO A;  2V9W A;  2I8C A;  2W6Z A;  2W6N A;  1XK5 A;  1E4G T;  5CA0 F;  4M9U A;  3GID A;  2J6U A;  3RJ0 A;  4E6N A;  4QIW E;  4ME6 A;  2R87 A;  2W6M A;  4O7L A;  3LQS A;  4O4H F;  1CE8 A;  3KXY T;  5KFR A;  4IRK A;  3I4N G;  2QB5 A;  1FKA H;  1BGW A;  3CQZ A;  4DV5 H;  1KTA A;  4YBZ B;  2HJW A;  4LSA A;  3OHB A;  1W93 A;  5JVD F;  3GTQ A;  5KS8 A;  5FR9 A;  5LMN H;  3T5L A;  1UNN C;  3LML A;  3HB9 A;  2KSW A;  3Q8P B;  2HVS A;  2YRX A;  3CSW A;  2UU9 H;  2R92 G;  2YL2 A;  4M0J A;  2GQR A;  3G8D A;  3HKZ E;  5FD6 A;  2BQU A;  4A3I G;  5KFT A;  4Q8F A;  3KAK A;  1M0W A;  1WRV A;  3LWB A;  4YAJ B;  4JI2 H;  3DTG A;  2NU9 B;  5KG4 A;  4FFR A;  4B3S H;  1E4E A;  4MTE A;  4AYB E;  2HHF A;  3RB0 A;  4NZM A;  4UCT A;  3TY5 A;  1O75 A;  1GLV A;  2F4V H;  1KC7 A;  5L1J A;  3RFC A;  2YS7 A;  4ECW A;  2BQR A;  4LF8 H;  2FP4 B;  4RNM A;  2VQF H;  4ED7 A;  4DR4 H;  5CA1 F;  4YJ3 F;  4NZO A;  5KT6 A;  1IOW A;  4ECX A;  4LF6 H;  1TWG A;  2HGS A;  1EUC B;  5FPO A;  1I2K A;  2AGP A;  4ZHQ F;  1Z2P X;  1DV2 A;  3ETJ A;  4EBE A;  4JYA H;  5DQH A;  4ECS A;  2W7P A;  2CKZ B;  2XCL A;  2FB9 A;  4O2A F;  2WDT A;  3BA8 A;  1KT8 A;  5FPR A;  5KG7 A;  3V6K A;  3RB3 A;  2UXC H;  1W96 A;  5DGH A;  4RB3 C;  2WB1 A;  4EGJ A;  1EHI A;  1FVI A;  5L1L A;  2EJ0 A;  1KBL A;  2E5L H;  1JXL A;  2CW8 A;  1V51 A;  3HT5 A;  4Q44 A;  5T14 A;  4B3M H;  2ZJT A;  4FFM A;  2W71 A;  2W57 A;  3KHR A;  4MV8 A;  3AX6 A;  2R86 A;  3KAL A;  1KEE A;  5A2Q W;  1TWF A;  3KHH A;  2RGV A;  4J9R A;  3T5K A;  4LFC H;  3HOU G;  5IP7 G;  4GKK H;  3MJF A;  2IP4 A;  3RBD A;  1I2L A;  3HO8 A;  5D8D A;  4DR2 H;  4J9M A;  1SEI A;  5FLX W;  5BPF A;  4FS2 A;  2R93 A;  1DGS A;  3J7A K;  3Q2O A;  4O84 A;  4OX9 H;  3UFX B;  1B04 A;  2YWV A;  3FKI G;  5IP9 G;  4O82 A;  4CHI A;  1K1S A;  1M7J A;  3NC0 B;  4JV0 A;  4PBC A;  3W1G A;  2OH2 A;  4FM9 A;  2JEI A;  2HGX A;  4IWX A;  5LOV F;  2JA7 A;  2ALZ A;  2DAB A;  2J9G A;  3GTM A;  4K0K H;  4FS1 A;  1WCM A;  3PO2 G;  3GV5 B;  5EWE A;  1E4E B;  1N32 H;  2PBZ A;  3I4M G;  4DV2 H;  4EFB A;  1DIK A;  2R82 A;  3S24 A;  1IBK H;  3GTP A;  4DV1 H;  4AQY H;  4A3M G;  1GGO A;  2YZN A;  4RZQ A;  2VPQ A;  4WD3 A;  4DL7 A;  4R7R A;  2PVP A;  3IG0 A;  4HQ6 A;  4X64 H;  4DUZ H;  1Y1V A;  1XMO H;  5DLG A;  2YZM A;  3OTO H;  5DIS C;  4IRC A;  4UCV A;  4JI7 H;  5BYA A;  4O3N A;  3RGZ A;  2QF7 A;  2X0S A;  3R5F A;  2ASL A;  3VPC A;  5KFA A;  4YAK B;  2PMZ E;  2VA3 A;  1JDE A;  1RYS A;  2E2I A;  2B63 A;  5IT9 W;  1OWT A;  3N6R A;  4EEQ A;  5I60 A;  4A2A A;  4O4J F;  3OUU A;  4IAJ A;  3NUA A;  4APM A;  1PX2 A;  2DZD A;  3ORR A;  4YQW A;  5F9N A;  1B6R A;  3BQ0 A;  3RF2 A;  5CR5 A;  2R93 G;  3RBE A;  4EFE A;  4O81 A;  2R85 A;  5I5S A;  2R8J A;  3JSL A;  1AUV A;  4MAM A;  2VPS A;  4RAZ A;  3QZ7 A;  4CKC A;  3UZB A;  2FK1 A;  4BY1 G;  1XMQ H;  5J2T F;  5C1P A;  2ATL A;  1ET0 A;  1JKJ B;  3GIJ A;  4LF9 H;  3T5H A;  2JA7 G;  5L9X A;  5H80 A;  4Q45 A;  1WCM G;  5I5U A;  3T5J A;  4KHP H;  1L2Z A;  3PR4 A;  1PK8 A;  1UC9 A;  4F4Y A;  1JX4 A;  1XNR H;  2V4Q A;  5DGB A;  1RYR A;  4JI8 H;  4Q0Y A;  4J9P A;  4O3P A;  3EPG A;  5DLF A;  5KG5 A;  3PW2 A;  3K3P A;  3OUZ A;  4QWB A;  4DV6 H;  4F4X A;  4HYK A;  4JI3 H;  1A48 A;  5JQG F;  2XIG A;  1S10 A;  1Y1V G;  5K3W A;  2CW7 A;  3CVZ A;  4IR9 A;  2P0A A;  3PN1 A;  3MWD A;  3V4S A;  2WAQ E;  2W6O A;  2HIX A;  3N43 B;  1N48 A;  4QWD A;  1OBG A;  3N8D A;  3ETH A;  4A3G G;  1HNZ H;  4XYL B;  3BQ2 A;  4RU9 A;  4FBU A;  5HNE A;  3PW5 A;  4MA0 A;  4FFP A;  3GTO A;  4XX0 B;  4TV9 F;  3GQC A;  3CEB A;  4LFA H;  5KFV A;  2VR1 A;  4DV4 H;  3BA9 A;  1N36 H;  4DL6 A;  1KJJ A;  1EYZ A;  1X9N A;  4DL4 A;  4A93 G;  1KUT A;  4K6N A;  4HR7 A;  3J80 W;  3BQ1 A;  2R8G A;  5DMX A;  5IYZ F;  3T99 A;  5KFB A;  3OHA A;  3T9B A;  3WNZ A;  3N6X A;  2VUM A;  2YYA A;  4G3I A;  5KFL A;  4X65 H;  3DF7 A;  3VA7 A;  5KFM A;  4RB2 C;  4TV8 F;  4YR0 A;  3G6Y A;  2C2D A;  4A3B G;  3TY9 A;  5KFF A;  2IMW P; 
#chains in the Genus database with same CATH homology
 4RB3 C;  5EOY A;  5BR8 H;  4X62 H;  1FVI A;  2E5L H;  4JI5 H;  3NBZ B;  3RTX A;  2CW8 A;  3TY8 A;  3VNN A;  3KYH C;  3H20 A;  3QWU A;  4BWS C;  4B3M H;  2ZJT A;  1MZB A;  1WH2 A;  2W57 A;  3HXL A;  3KAL A;  5A2Q W;  1FJG H;  4JI6 H;  4DR6 H;  4YY3 H;  4CC6 A;  2RGV A;  4LFC H;  2UXB H;  4GKK H;  4LH6 A;  4LSX A;  4RB0 A;  4NXN H;  1TA8 A;  4RAY A;  2CFM A;  4M7E A;  4DR2 H;  1SEI A;  5FLX W;  4LF5 H;  1I94 H;  1DGS A;  3L2P A;  4GLX A;  2O03 A;  3N40 P;  4MV9 A;  4OX9 H;  3N41 B;  2VQE H;  3J7A K;  2UXD H;  1B04 A;  4PZ6 A;  1HNW H;  3NC0 B;  3K3V A;  3W1G A;  3T1H H;  4FM9 A;  3M4I A;  4J0M A;  3J81 W;  2RGR A;  1E4F T;  1S03 G;  3BAA A;  3T1Y H;  2HHH H;  4DR1 H;  2HVR A;  4DR3 H;  4K0K H;  5D1O A;  4NXM H;  3RGX A;  3N44 B;  5LL6 b;  3JAM W;  4LFB H;  1N32 H;  3FMA A;  4EFB A;  3N42 B;  4DV2 H;  3S24 A;  1IBK H;  4PZ8 A;  4MV7 A;  4AQY H;  1Z2O X;  4RZQ A;  4R7R A;  3IG0 A;  4X66 H;  1N34 H;  4X64 H;  4DUZ H;  2OWO A;  4UCR A;  1XMO H;  3OTO H;  4B3T H;  4UCU A;  5DIS C;  4DRF A;  3GB8 B;  4UCV A;  3NBY B;  3GJX B;  4UFZ A;  4JI7 H;  1SYX B;  3JSN A;  2Q2U A;  3RGZ A;  4B3R H;  1HNX H;  1S68 A;  4DR5 H;  2MCT A;  4I7H A;  1CKN B;  2WYO A;  5IT9 W;  4EEQ A;  4DR7 H;  1V9P A;  3F8N A;  2HVQ A;  5D1O B;  4A2B A;  4A2A A;  2HIV A;  4IAJ A;  4DV0 H;  4APM A;  3BAB A;  3KAJ A;  2ZM6 H;  3W5O A;  1BJT A;  3RF2 A;  1TAE A;  4DV7 H;  4EFE A;  1N33 H;  4RB1 A;  1VS0 A;  1ZHQ A;  1A0I A;  3C0F B;  3W1B A;  3JSL A;  4DV1 H;  2VPS A;  4RAZ A;  4MTD A;  1XMQ H;  1XK5 A;  1E4G T;  1XDN A;  3RIZ A;  4DV3 H;  4LF9 H;  4DUY H;  3RJ0 A;  4E6N A;  3L4K A;  3KXY T;  4KHP H;  1L2Z A;  4YHH H;  1P8L A;  3GDE A;  4ETS A;  4JI4 H;  1P16 A;  1BGW A;  4CC5 A;  4DV5 H;  1FKA H;  4JI8 H;  1XNR H;  1IBL H;  4Q0Y A;  4LSA A;  4PZ7 A;  1M0T A;  5LMN H;  4DV6 H;  1J5E H;  1IBM H;  4JI0 H;  4PDB A;  3LML A;  4JI3 H;  2UU9 H;  2KSW A;  2HVS A;  2XIG A;  2Q2T A;  4LF4 H;  2CW7 A;  3CVZ A;  4JI1 H;  4GKJ H;  4UCO A;  5FD6 A;  3PN1 A;  5IWA H;  1XNQ H;  2HIX A;  3N43 B;  4LMY A;  2VUG A;  3KAK A;  1M0W A;  4JI2 H;  1CKO A;  1HNZ H;  4B3S H;  3RR5 A;  3UQ8 A;  4MTE A;  2UUA H;  3EYY A;  4UCT A;  5LMU H;  3L4J A;  3TY5 A;  1GYF A;  1AN7 A;  2UUB H;  1O75 A;  2FE3 A;  4EQ5 A;  4LFA H;  2F4V H;  2UUC H;  1CKM A;  4DV4 H;  3BA9 A;  4LF8 H;  1I6U A;  1N36 H;  2VQF H;  1X9N A;  2YCH A;  4LF7 H;  4DR4 H;  4JV5 H;  3J80 W;  2WE6 A;  4UCS A;  4LF6 H;  1Z2N X;  2VOB A;  2HGS A;  4LH7 A;  3MWM A;  5FPO A;  3N6X A;  1Z2P X;  4JYA H;  1HR0 H;  5D1P A;  4X65 H;  3DF7 A;  5FD5 A;  4RB2 C;  2WDT A;  3BA8 A;  5FPR A;  1CKN A;  3TY9 A;  2UXC H;  1ZHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...