3RTXA

Crystal structure of mammalian capping enzyme (mce1) and pol ii ctd complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
343
structure length
262
Chain Sequence
b'SLKLGAIFLEGITVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIRLLEQKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDKVNGQAVPRYLIYDIIKFNAQPVGDCDFNIRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRPKQFFDINISRKLLEGDGLIFQPIGKYKPGRCDDILKWKPPSLNSAYNTAMAVCNSISNPVTKEMLFEFIDRCAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA-capping enzyme
publication title Structural insights to how mammalian capping enzyme reads the CTD code.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 68
structure length 262
sequence length 343
chains with identical sequence B
ec nomenclature ec 2.7.7.50: mRNA guanylyltransferase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01331 mRNA_cap_enzyme mRNA capping enzyme, catalytic domain
A PF03919 mRNA_cap_C mRNA capping enzyme, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3rtxA01
3.30.1490.430 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3rtxA02
3NBYB 3W1GA 3S24A 2HIXA 4LH6A 3UQ8A 2VUGA 4EFEA 3PN1A 3GJXB 3KYHC 4UCVA 4LH7A 5D1OA 1TAEA 4PZ8A 1CKMA 2CFMA 3GDEA 3QWUA 2HIVA 4PZ6A 1B04A 3NC0B 3BABA 4GLXA 3W1BA 1CKNB 5D1PA 1P8LA 3TY5A 4UCUA 5FPOA 1P16A 1XDNA 4UFZA 1DGSA 2HVSA 1S68A 1V9PA 4DRFA 4EEQA 4E6NA 3RR5A 1X9NA 3JSNA 3GB8B 1CKOA 3BAAA 1A0IA 2OWOA 2HVQA 5D1OB 2Q2TA 1FVIA 2Q2UA 3TY8A 3NBZB 5FPRA 4UCSA 3L2PA 4PZ7A 4CC5A 1VS0A 4UCTA 1TA8A 4UCOA 3TY9A 3JSLA 1XK5A 4EFBA 3RTXA 5DISC 1CKNA 4CC6A 2HVRA 3BA8A 4EQ5A 3W5OA 3VNNA 3BA9A 4UCRA
chains in the Genus database with same CATH superfamily
3GTLA 2DLNA 3W1GA 5BYAA 3V6JA 3GIMA 4O84A 2Q7DA 4R7RA 2YZMA 5LMNH 4XZ3B 5KFMA 4ECZA 4NZOA 1I6UA 1M6VA 3G6XA 4LF8H 3N40P 4WHXA 4ED3A 3AYHB 4TUYF 3UZBA 3GIDA 3R5HA 1RYSA 4HYKA 2X5RA 3MFIA 4UCVA 5KT6A 3E5NA 2ASJA 2W9CB 1I2KA 4LH7A 3T5JA 4FU0A 2YU9A 3UFXB 4A3BG 3RB4A 2R7ZA 3K3PA 4PZ8A 3PO3G 3J81W 2OLSA 3FDSA 1CKMA 2NU9B 4TVIA 3PVXA 4FS2A 3R23A 2XCAA 1VKZA 3U54A 2WB1A 3G6YA 3GTJA 3FKIG 5D8DA 4APMA 3KREA 5DLFA 4LF4H 1T94A 5IP7G 2DAAA 2YRWA 4FS1A 1S97A 1AN7A 1ZAUA 3RB6A 1JX4A 4NXMH 1S03G 2GQRA 1JLLB 3DF7A 5I47A 4ECWA 3RAXA 4IIJF 4YY3H 1GGOA 3MWDA 4J9SA 2R8GA 1ZETA 4JI4H 2R93G 3RJ0A 3T1YH 4ETSA 1IOVA 2R8IA 5C8YF 5DGHA 3V4ZA 4DV4H 1GLVA 2FMAA 2FLPA 1Z2NX 3W1BA 4LF7H 2NU7B 2CNVA 4B3RH 2HGSA 1RJRA 2WTFA 3VPDA 1XNQH 1WSCA 4F4YA 2AGOA 1M7JA 4DV3H 2OH2A 4Q4DA 4RCNA 1OWTA 1RK6A 4GC6A 2C28A 3GTMA 5BWTA 1B6RA 1ZHQA 4DL3A 2YZNA 3JZ6A 2FK1A 1GSHA 5I5SA 5I5XA 2FB9A 3I12A 2CQYA 4UFZA 1A48A 2HVSA 2VPQA 3V6KA 2W70A 4Q4CA 5JQWA 2WE6A 5KFCA 4MV7A 2FP4B 3MWEA 4MA0A 1TWGA 2NVYA 4E6NA 4DQNA 2QB5A 3RR5A 1I7NA 4HNTA 1X9NA 3M4IA 4RB3C 3OTOH 4IWYA 1S0MA 1KJ8A 1CKOA 3U0GA 2R8JA 3TW7A 3Q8QB 5KS8A 3HOUG 2OWOA 2ODTX 5KFQA 4O3SA 2UXDH 2PMZA 2XCLA 2UUCH 2Q2TA 5I5WA 4BY7G 2B63A 1FVIA 5KFBA 1B6SA 5BWUA 2ATLA 3N41B 2EIYA 3KHLA 1EUCB 3ORRA 4MV1A 2KSWA 4LSXA 1E4EA 3RUPA 2YYAA 2I80A 4MAMA 2BQ3A 4ECXA 1KJQA 4QIWE 5DMXA 2NVXA 1N33H 4DLKA 2GPSA 1C30A 5KT7A 3PR4A 3HKZE 5IYZF 2ZJTA 2CW7A 3JSLA 4A3LG 5H80A 3SE7A 2DPIA 4EFBA 3RV3A 5KFGA 3JRWA 3RAQA 3BJYA 1BNCA 4U6PA 3MR6A 4A2BA 4RB2C 4RUCA 5C1OA 3TINA 4X66H 1FJGH 3K5HA 4O7NA 1CKNA 3TQTA 2GPWA 4CC6A 5KFLA 4K0KH 2R82A 5BWWA 2UVWA 5FR9A 3OHAA 1N48A 3WWJA 4DL4A 1N34H 2YRXA 4EQ5A 2JA7G 2VQEH 3H40A 1Y1VG 1GYFA 3VNNA 5LOVF 3T7AA 1KEEA 4LMYA 4ECSA 2R92A 4DR7H 1IBMH 2PN1A 4NZMA 4DR5H 3LULA 2V4QA 4MV4A 4YAJB 3S24A 1XMOH 4IRDA 2VPSA 4LH6A 5FJ8G 3HBLA 4DL2A 4G3IA 2VQDA 5I5UA 3SNOA 3WO1A 4EGQA 2YW2A 4DV2H 3F8NA 3GV8B 5J2TF 4WD3A 3TQ1A 2CKZB 5KFTA 4K6NA 2VUGA 2W9BB 4O7VA 3BQ1A 3HOWG 1EKFA 3MR3A 2VUMA 4QWBA 5L9XA 3T5HA 2YS6A 4EG0A 3T5LA 4XX0B 1RYRA 2R7MA 2P0AA 3GQCA 1CS0A 4JV1A 2FK2A 2C00A 4NYEA 5D1OA 3U9SA 5KFXA 4JI0H 1JDBB 4O7SA 1TAEA 2DPJA 2WYOA 2ZDGA 3N8DA 5DGAA 3CEBA 1KJ9A 2CFMA 2HHFB 4M0JA 5KG4A 4QWEA 2CW8A 2YWVA 2R86A 5KG6A 3GIJA 4PWQA 4IRCA 4IRKA 4JI5H 1EKPA 5KG5A 2IMWP 1Z2PX 4RU9A 3BQ2A 4PZ6A 1B04A 4DL5A 4B3TH 1RJPA 3LWBA 5DAAA 3OUUA 1WH2A 2I8CA 2XGQA 3H3VH 2E2HA 4Q43A 4JI3H 2RDJA 2C2EA 3RGZA 2UVRA 2WAQE 4F50A 4QWAA 2YZGA 3LMLA 2W6PA 3NC0B 4NZNA 3T1HH 3HOZG 3DTFA 4ED6A 3OHBA 1JKJB 4BBSG 1DAAA 1EHIA 2GLTA 1W93A 1VBGA 5D1PA 3WWIA 4Y8VB 3L4JA 1IBLH 4PBCA 4YJ2F 3K3VA 5BWXA 4Q45A 4JI8H 2IA6A 1P8LA 3JRXA 3PO2G 3SGIA 4O4HF 4UCUA 2J6UA 1VAJA 5L1LA 4HNVA 2R8KA 2R7ZG 2W7OA 2E2IA 5L1KA 3H20A 4DV0H 3I4NG 2YS7A 1DGSA 4YR0A 1N32H 1M0WA 1MZBA 2NU6B 4UUGA 4F4XA 2C22A 3VMMA 2Y4RA 4JI1H 2DWCA 3J80W 3WWHA 4J9NA 2W6OA 4DL7A 4YP3A 5C44G 2J6TA 4I4TF 3T9EA 5JVDF 1PK8A 1IOWA 4O2AF 4DL6A 1HR0H 2HVQA 4J9MA 4O7WA 5L1IA 5CR5A 3FKIA 5BYBA 4I7HA 5KFFA 1VBHA 1CQJB 4RZQA 2W9AA 3PW0A 5KT3A 4R8UB 5BWRA 2Q2UA 3ORQA 4O81A 2RGVA 3TW6A 5EWEA 2W9CA 2JEFA 4IR1A 1IYDA 3NGDA 4B3MH 4LF6H 1K1QA 5EZYF 5CB4F 5HV6A 4YR2A 2A1HA 4QIWA 4PZ7A 5BMVF 4DV7H 3M9MB 2CNUA 4O7RA 2M05A 3HKZA 1KTAA 1I1LA 3ETJA 4E4TA 4QW8A 3V6HA 4EBEA 5CM0A 2XC9A 4RNOA 2AQ4A 3QZ8A 2JA8G 5KFJA 4FFMA 1XK5A 1SFOA 4BWSC 4RB0A 2AGQA 2VA2A 3H0GA 3BG5A 1TWFA 4NXNH 5C4XG 4ED1A 1T3NA 3HT5A 5DQGA 3MR2A 1I1KA 2ZGIA 3RF2A 3T9CA 3U55A 5CE8A 5BWVA 1RJQA 4J9RA 2VA3A 2QF7A 5GONF 4A3IG 2ZM6H 3RFCA 1E4EB 3KALA 2AU0A 4FBUA 3OSNA 4EYIB 2C2RA 2FPPB 3CVZA 1S10A 3OSPA 3DTGA 3GIPA 3W5OA 1OBGA 5BPHA 3HOXG 3BQ0A 3H4BA 3RBDA 5FLXW 3RIZA 3Q1KA 4CKCA 2XIGA 5KFNA 1WRVA 2XCPA 5IYCG 1R9TA 4ECRA 2RGRA 3HXLA 3N6RA 2R85A 4JI2H 4JV5H 2HIXA 3T9DA 3UQ8A 3VA7A 4LFCH 2VQFH 1DV1A 1KT8A 1UC9A 5KFUA 5A2QW 3KHGA 3VPBA 1S0OA 4OX9H 4MV9A 2Z02A 4ZHQF 4ED0A 3TEKA 3FMAA 3WO0A 1ZQ7A 3GIKA 2ALZA 3PN1A 3GJXB 2FPIB 2XD4A 1J5EH 2FLNA 4FE2A 4DUYH 3G8DA 3C0FB 2COIA 4YBZB 5FNVF 4BY1G 4O7ZA 1KJIA 4FGRA 5HBRB 2V5AA 2CZGA 3LQSA 4I55F 5JVLA 3KTMA 1IBKH 4RZRA 1V51A 3GDEA 1N56A 3QWUA 1E4FT 4ZQIA 5JH7F 2IBKA 1FKAH 1I2LA 1GSOA 4O82A 4FFPA 4A2AA 1XMQH 2FLLA 2HIVA 2R7LA 4HQ6A 1TWAA 5LMUH 5KKNB 1EZ1A 1K1SA 4LFBH 1WCMA 4X64H 5J2UF 1K83A 2W71A 5KFZA 4GKKH 4MV8A 4RNMA 4O3NA 1TWHA 2I87A 2R6FA 3GV7B 2HJWA 3Q8PB 1JIHA 2W8KA 4GLXA 3BABA 1A9XA 3MWMA 4JV2A 3J7AK 4MA5A 1Y1VA 2FJZA 3QZ7A 4JYAH 5C3EG 3GTOA 5EOYA 3HOVG 2UU9H 2V9WA 2VUMG 2XGPA 2Y0SE 3GIQA 1IYEA 4CHIA 2JA6A 5K3WA 2CNQA 1C3OA 3PFFA 3TIIA 1GSAA 2UXCH 5K2MA 3JZFA 2DABA 1SCUB 1P16A 2JA5A 1XDNA 2PBZA 4GKJH 4JXUA 3GTGA 2R7NA 4FFNA 4QSHA 5I5VA 1V9PA 1ZHSA 2RF4A 4DRFA 4ZOLF 3WNZA 2YCHA 4EEQA 5IYDG 3T54A 5LA6F 3T9AA 4Q0YA 4M7EA 1AUXA 3RB0A 5IP9G 5FD6A 3QFFA 3GB8B 3MJFA 2JEIA 4KHPH 4U7CA 2BQRA 3UZOA 3BAAA 5DGBA 2QYZA 4O3QA 1HNZH 4GLWA 5L1JA 1CE8A 2HGXA 4ECTA 4A3GG 2F4VH 4A3DG 2EJ0A 4DUZH 5I60A 2FK3A 1Y1WA 3T9FA 4O83A 4RUAA 2R7KA 3M9OB 5KFDA 4Q8FA 3CSWA 2DZDA 1G2WA 1A3GA 1Z2OX 2V58A 2W7PA 3PW5A 1A0GA 5KG2A 3N44B 1S0NA 3T5KA 4IR9A 3JZIA 3T99A 4CC5A 2O03A 4ZI7F 5KG1A 3L4KA 3K5IA 4I50F 1EUDB 5DG9A 4DR6H 2C35B 4UCOA 1TWCA 3TY9A 1PX2A 4CMDA 2RDIA 4AYBE 5KFEA 5LL6b 4DV1H 5E25A 2V59A 1UC8A 5LP6F 4NLGA 2ZDHA 4QWCA 3M9NB 3IG0A 3R5XA 4YJ3F 2UVVA 4O7LA 3OUZA 4HNUA 5KFRA 2C2DA 3KHHA 5DISC 4DIMA 2YZLA 1ET0A 2QK4A 3VOTA 1E4GT 2W6ZA 5CAEB 1ULZA 4C5CA 1Y14B 1WR2A 5F9LA 3HB9A 3G6VA 3GIIA 2YL2A 4TQRA 2ASDA 4O4LF 4B3SH 4ECUA 2FE3A 1UNNC 4O7TA 3BA9A 4J9OA 5LXTF 4RNNA 4UCRA 1O75A 5KFSA 4O2BF 2ASLA 3ETHA 1CQIB 3PW4A 2AGPA 4YB8B 4AQYH 2E5LH 5BPFA 3NBYB 2COGA 2R93A 2BQUA 2W6MA 4EBDA 1KBLA 1BJTA 3GLKA 4O7YA 4C5BA 3GV5B 4CE5A 2MCTA 5FD5A 1I50A 4DV5H 3AW8A 4O3PA 4LF9H 5CA0F 3KHRA 4O3RA 4TV8F 4EFEA 1OBDA 3AX6A 4DR2H 4ECYA 3Q2OA 4TM5A 3Q8SB 2R87A 4EGJA 2HG8A 3KYHC 5FLMG 4O3OA 2J9GA 3JAMW 1XNRH 4Q44A 2ZDQA 5KFAA 3PR5B 1EYZA 1M0TA 3H0GG 5JUMA 2UVUA 2W57A 4X62H 2X0SA 1EKVA 1JDEA 5IYBG 1BGWA 3GTQA 4R8UA 3N42B 2EJ2A 3IN5A 4J9KA 2COJA 2UUBH 4ED7A 5EDWA 5CA1F 4JI7H 3RB3A 4ECVA 3V4SA 2WB1E 5KT2A 2B63G 1W96A 4A3FG 5KFOA 1I94H 2NU8B 3RGXA 2JEJA 5EWGA 1GO3E 1N36H 1KUTA 4DR1H 3MFHA 4BBRG 4A3MG 1I3QA 5KFYA 2VR1A 5KT5A 4JI6H 3GTKA 4MV3A 4YR3A 5EWFA 4FM9A 2UXBH 3CQZA 3HOYG 3VPCA 2GQSA 4JUZA 2R8HA 2SCUB 1CKNB 3N6XA 4XYMB 4J9LA 1S9FA 4O4JF 4ED2A 2HDKA 5LYJF 4HN2A 2Y0SA 1I7LA 1T36A 3QQMA 4YHHH 5IT9W 4EYHB 4IHJF 5C5JA 3PW7A 4DR4H 3T9BA 1I1MA 3KAJA 3TY5A 4CKEA 5FPOA 2NUAB 4MTEA 1HNXH 4ECQA 3N43B 4GC7A 3I4MG 5JQGF 3HO8A 2W6NA 2Z04A 4O86A 4EBCA 2ABJA 4A3JG 5DGIA 3MR5A 3GILA 1S68A 2IP4A 4X65H 4C2MA 4MV6A 3EPGA 4CMFA 1KJJA 5KG7A 4J9PA 4A3EG 2R92G 3JSNA 2WAQA 4YAKB 4QJFA 4WBNF 1AUVA 1RK5A 1A0IA 1WCMG 4JV0A 4IAJA 3PW2A 5KFKA 2J6SA 2JEGA 4TQSA 4A93G 5KFIA 2JA7A 5D1OB 4M9UA 4QW9A 3EPIA 5T14A 3U9TA 3DAAA 3KAKA 2PMZE 5KFPA 5BR8H 4LF5H 4ME6A 1L2ZA 3TY8A 1JXLA 4FFLA 5F9NA 4MTDA 5KFVA 3PZPA 4XYLB 3NBZB 4F4ZA 5FPRA 1DIKA 5DQHA 1DV2A 4UCSA 3BACA 4O4IF 3L2PA 4IWXA 1KC7A 4QWDA 4J0MA 3R5FA 5C1PA 4C5AA 5I5TA 4RAYA 1VS0A 1BXRA 1TA8A 2PVPA 3LP8A 4UCTA 4AYBA 5IWAH 4YQWA 4Q8EA 2JA6G 3GTPA 5KG0A 4DR3H 2JA5G 2WDTA 4F4WA 4A3KG 4A3CG 3NUAA 2VOBA 3G8CA 5HNEA 3RBEA 1HNWH 4FBTA 4CKBA 2R84A 3Q8RB 4LSAA 2HGWA 2FKLA 5KFWA 5DG7A 3TIGA 3RV4A 3KXYT 2W9BA 4LFAH 3RTXA 2EJ3A 2FPGB 4FFOA 4BXXG 2DIKA 1SEIA 4RAZA 4J9QA 4DV6H 2BR0A 5I5YA 5KT4A 5DLGA 1V4YA 2HVRA 4PDBA 3H4DA 1SYXB 3BA8A 2V4RA 4TV9F 3UYYA 4L1KA 4ED8A 2HHHH 3SI8A 3EYYA 4RB1A 4IZOA 1Y1WG 4FFRA 3R9RA 5DQIA 2W8LA 4HR7A 1B33N 4DAAA 5DG8A 5KX5F 2HHFA 2W6QA 4EEYA 5KG3A 5KFHA 2UUAH
chains in the Genus database with same CATH topology
4AQYH 2E5LH 4DR5H 3NBYB 3W1GA 3HXLA 3S24A 1XMOH 4JI2H 2RGRA 2VPSA 2HIXA 4LH6A 3UQ8A 4LFCH 1BJTA 4R7RA 2VQFH 5LMNH 4OX9H 5A2QW 5FD5A 2MCTA 3F8NA 4MV9A 4DV2H 4DV5H 4LF8H 3N40P 4LF9H 1I6UA 2VUGA 4EFEA 3FMAA 4DR2H 1J5EH 3PN1A 3GJXB 4DUYH 3KYHC 3C0FB 3JAMW 1XNRH 4UCVA 4LH7A 1M0TA 5D1OA 2W57A 4JI0H 4X62H 1TAEA 2WYOA 4PZ8A 1BGWA 1IBKH 3J81W 3N42B 1CKMA 2CFMA 3GDEA 3QWUA 1E4FT 2CW8A 2UUBH 4JI7H 1FKAH 4JI5H 4APMA 4LF4H 1Z2PX 4A2AA 1XMQH 1S03G 2HIVA 1AN7A 4PZ6A 4NXMH 1B04A 5LMUH 4B3TH 1I94H 3DF7A 3RGXA 4LFBH 1N36H 4DR1H 1WH2A 4X64H 4YY3H 4GKKH 4JI3H 4JI4H 3RGZA 3RJ0A 4JI6H 3T1YH 4ETSA 4FM9A 2UXBH 3LMLA 4DV4H 3NC0B 3BABA 4GLXA 3MWMA 1Z2NX 3W1BA 3T1HH 1CKNB 3N6XA 4LF7H 3J7AK 4JYAH 4B3RH 4YHHH 2HGSA 5D1PA 5EOYA 1XNQH 2UU9H 5IT9W 3L4JA 4DR4H 1IBLH 4DV3H 3K3VA 4JI8H 1P8LA 3KAJA 3TY5A 4UCUA 2UXCH 4MTEA 5FPOA 1ZHQA 1HNXH 1P16A 2UUAH 1XDNA 3N43B 3H20A 4DV0H 4GKJH 4UFZA 1DGSA 2HVSA 1N32H 1M0WA 1MZBA 1S68A 4X65H 4JV5H 1V9PA 1ZHSA 2YCHA 4DRFA 2WE6A 4JI1H 4EEQA 4MV7A 4Q0YA 3J80W 4M7EA 4E6NA 3RR5A 3M4IA 5FD6A 1X9NA 4RB3C 3JSNA 3OTOH 3GB8B 1CKOA 4KHPH 3BAAA 1A0IA 1HNZH 2OWOA 4IAJA 1HR0H 2HVQA 2UXDH 2F4VH 2UUCH 5D1OB 4DUZH 4I7HA 4RZQA 2Q2TA 3KAKA 4LF5H 5BR8H 1FVIA 2Q2UA 2RGVA 1L2ZA 3TY8A 3N41B 4MTDA 1Z2OX 4LSXA 4B3MH 3NBZB 2KSWA 4LF6H 5FPRA 4UCSA 3L2PA 3N44B 4PZ7A 4CC5A 4J0MA 2O03A 4DV7H 4RAYA 3L4KA 1N33H 1VS0A 4UCTA 1TA8A 5IWAH 4DR6H 4UCOA 3TY9A 5LL6b 2ZJTA 2CW7A 3JSLA 4DV1H 4DR3H 2WDTA 1XK5A 2VOBA 4EFBA 1HNWH 4BWSC 4RB0A 3IG0A 4NXNH 4LSAA 4LFAH 3KXYT 4A2BA 4RB2C 3RTXA 3RF2A 1FJGH 5DISC 1SEIA 4X66H 4RAZA 1E4GT 4DV6H 1CKNA 4CC6A 2ZM6H 2HVRA 4K0KH 4PDBA 3KALA 1SYXB 3BA8A 2HHHH 3CVZA 3EYYA 4EQ5A 4RB1A 1N34H 4B3SH 3W5OA 2FE3A 2VQEH 1GYFA 3VNNA 3BA9A 4UCRA 1O75A 5FLXW 3RIZA 4LMYA 2XIGA 4DR7H 1IBMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBY B;  3W1G A;  3S24 A;  2HIX A;  4LH6 A;  3UQ8 A;  2VUG A;  4EFE A;  3PN1 A;  3GJX B;  3KYH C;  4UCV A;  4LH7 A;  5D1O A;  1TAE A;  4PZ8 A;  1CKM A;  2CFM A;  3GDE A;  3QWU A;  2HIV A;  4PZ6 A;  1B04 A;  3NC0 B;  3BAB A;  4GLX A;  3W1B A;  1CKN B;  5D1P A;  1P8L A;  3TY5 A;  4UCU A;  5FPO A;  1P16 A;  1XDN A;  4UFZ A;  1DGS A;  2HVS A;  1S68 A;  1V9P A;  4DRF A;  4EEQ A;  4E6N A;  3RR5 A;  1X9N A;  3JSN A;  3GB8 B;  1CKO A;  3BAA A;  1A0I A;  2OWO A;  2HVQ A;  5D1O B;  2Q2T A;  1FVI A;  2Q2U A;  3TY8 A;  3NBZ B;  5FPR A;  4UCS A;  3L2P A;  4PZ7 A;  4CC5 A;  1VS0 A;  4UCT A;  1TA8 A;  4UCO A;  3TY9 A;  3JSL A;  1XK5 A;  4EFB A;  3RTX A;  5DIS C;  1CKN A;  4CC6 A;  2HVR A;  3BA8 A;  4EQ5 A;  3W5O A;  3VNN A;  3BA9 A;  4UCR A; 
#chains in the Genus database with same CATH topology
 3GTL A;  2DLN A;  3W1G A;  5BYA A;  3V6J A;  3GIM A;  4O84 A;  2Q7D A;  4R7R A;  2YZM A;  5LMN H;  4XZ3 B;  5KFM A;  4ECZ A;  4NZO A;  1I6U A;  1M6V A;  3G6X A;  4LF8 H;  3N40 P;  4WHX A;  4ED3 A;  3AYH B;  4TUY F;  3UZB A;  3GID A;  3R5H A;  1RYS A;  4HYK A;  2X5R A;  3MFI A;  4UCV A;  5KT6 A;  3E5N A;  2ASJ A;  2W9C B;  1I2K A;  4LH7 A;  3T5J A;  4FU0 A;  2YU9 A;  3UFX B;  4A3B G;  3RB4 A;  2R7Z A;  3K3P A;  4PZ8 A;  3PO3 G;  3J81 W;  2OLS A;  3FDS A;  1CKM A;  2NU9 B;  4TVI A;  3PVX A;  4FS2 A;  3R23 A;  2XCA A;  1VKZ A;  3U54 A;  2WB1 A;  3G6Y A;  3GTJ A;  3FKI G;  5D8D A;  4APM A;  3KRE A;  5DLF A;  4LF4 H;  1T94 A;  5IP7 G;  2DAA A;  2YRW A;  4FS1 A;  1S97 A;  1AN7 A;  1ZAU A;  3RB6 A;  1JX4 A;  4NXM H;  1S03 G;  2GQR A;  1JLL B;  3DF7 A;  5I47 A;  4ECW A;  3RAX A;  4IIJ F;  4YY3 H;  1GGO A;  3MWD A;  4J9S A;  2R8G A;  1ZET A;  4JI4 H;  2R93 G;  3RJ0 A;  3T1Y H;  4ETS A;  1IOV A;  2R8I A;  5C8Y F;  5DGH A;  3V4Z A;  4DV4 H;  1GLV A;  2FMA A;  2FLP A;  1Z2N X;  3W1B A;  4LF7 H;  2NU7 B;  2CNV A;  4B3R H;  2HGS A;  1RJR A;  2WTF A;  3VPD A;  1XNQ H;  1WSC A;  4F4Y A;  2AGO A;  1M7J A;  4DV3 H;  2OH2 A;  4Q4D A;  4RCN A;  1OWT A;  1RK6 A;  4GC6 A;  2C28 A;  3GTM A;  5BWT A;  1B6R A;  1ZHQ A;  4DL3 A;  2YZN A;  3JZ6 A;  2FK1 A;  1GSH A;  5I5S A;  5I5X A;  2FB9 A;  3I12 A;  2CQY A;  4UFZ A;  1A48 A;  2HVS A;  2VPQ A;  3V6K A;  2W70 A;  4Q4C A;  5JQW A;  2WE6 A;  5KFC A;  4MV7 A;  2FP4 B;  3MWE A;  4MA0 A;  1TWG A;  2NVY A;  4E6N A;  4DQN A;  2QB5 A;  3RR5 A;  1I7N A;  4HNT A;  1X9N A;  3M4I A;  4RB3 C;  3OTO H;  4IWY A;  1S0M A;  1KJ8 A;  1CKO A;  3U0G A;  2R8J A;  3TW7 A;  3Q8Q B;  5KS8 A;  3HOU G;  2OWO A;  2ODT X;  5KFQ A;  4O3S A;  2UXD H;  2PMZ A;  2XCL A;  2UUC H;  2Q2T A;  5I5W A;  4BY7 G;  2B63 A;  1FVI A;  5KFB A;  1B6S A;  5BWU A;  2ATL A;  3N41 B;  2EIY A;  3KHL A;  1EUC B;  3ORR A;  4MV1 A;  2KSW A;  4LSX A;  1E4E A;  3RUP A;  2YYA A;  2I80 A;  4MAM A;  2BQ3 A;  4ECX A;  1KJQ A;  4QIW E;  5DMX A;  2NVX A;  1N33 H;  4DLK A;  2GPS A;  1C30 A;  5KT7 A;  3PR4 A;  3HKZ E;  5IYZ F;  2ZJT A;  2CW7 A;  3JSL A;  4A3L G;  5H80 A;  3SE7 A;  2DPI A;  4EFB A;  3RV3 A;  5KFG A;  3JRW A;  3RAQ A;  3BJY A;  1BNC A;  4U6P A;  3MR6 A;  4A2B A;  4RB2 C;  4RUC A;  5C1O A;  3TIN A;  4X66 H;  1FJG H;  3K5H A;  4O7N A;  1CKN A;  3TQT A;  2GPW A;  4CC6 A;  5KFL A;  4K0K H;  2R82 A;  5BWW A;  2UVW A;  5FR9 A;  3OHA A;  1N48 A;  3WWJ A;  4DL4 A;  1N34 H;  2YRX A;  4EQ5 A;  2JA7 G;  2VQE H;  3H40 A;  1Y1V G;  1GYF A;  3VNN A;  5LOV F;  3T7A A;  1KEE A;  4LMY A;  4ECS A;  2R92 A;  4DR7 H;  1IBM H;  2PN1 A;  4NZM A;  4DR5 H;  3LUL A;  2V4Q A;  4MV4 A;  4YAJ B;  3S24 A;  1XMO H;  4IRD A;  2VPS A;  4LH6 A;  5FJ8 G;  3HBL A;  4DL2 A;  4G3I A;  2VQD A;  5I5U A;  3SNO A;  3WO1 A;  4EGQ A;  2YW2 A;  4DV2 H;  3F8N A;  3GV8 B;  5J2T F;  4WD3 A;  3TQ1 A;  2CKZ B;  5KFT A;  4K6N A;  2VUG A;  2W9B B;  4O7V A;  3BQ1 A;  3HOW G;  1EKF A;  3MR3 A;  2VUM A;  4QWB A;  5L9X A;  3T5H A;  2YS6 A;  4EG0 A;  3T5L A;  4XX0 B;  1RYR A;  2R7M A;  2P0A A;  3GQC A;  1CS0 A;  4JV1 A;  2FK2 A;  2C00 A;  4NYE A;  5D1O A;  3U9S A;  5KFX A;  4JI0 H;  1JDB B;  4O7S A;  1TAE A;  2DPJ A;  2WYO A;  2ZDG A;  3N8D A;  5DGA A;  3CEB A;  1KJ9 A;  2CFM A;  2HHF B;  4M0J A;  5KG4 A;  4QWE A;  2CW8 A;  2YWV A;  2R86 A;  5KG6 A;  3GIJ A;  4PWQ A;  4IRC A;  4IRK A;  4JI5 H;  1EKP A;  5KG5 A;  2IMW P;  1Z2P X;  4RU9 A;  3BQ2 A;  4PZ6 A;  1B04 A;  4DL5 A;  4B3T H;  1RJP A;  3LWB A;  5DAA A;  3OUU A;  1WH2 A;  2I8C A;  2XGQ A;  3H3V H;  2E2H A;  4Q43 A;  4JI3 H;  2RDJ A;  2C2E A;  3RGZ A;  2UVR A;  2WAQ E;  4F50 A;  4QWA A;  2YZG A;  3LML A;  2W6P A;  3NC0 B;  4NZN A;  3T1H H;  3HOZ G;  3DTF A;  4ED6 A;  3OHB A;  1JKJ B;  4BBS G;  1DAA A;  1EHI A;  2GLT A;  1W93 A;  1VBG A;  5D1P A;  3WWI A;  4Y8V B;  3L4J A;  1IBL H;  4PBC A;  4YJ2 F;  3K3V A;  5BWX A;  4Q45 A;  4JI8 H;  2IA6 A;  1P8L A;  3JRX A;  3PO2 G;  3SGI A;  4O4H F;  4UCU A;  2J6U A;  1VAJ A;  5L1L A;  4HNV A;  2R8K A;  2R7Z G;  2W7O A;  2E2I A;  5L1K A;  3H20 A;  4DV0 H;  3I4N G;  2YS7 A;  1DGS A;  4YR0 A;  1N32 H;  1M0W A;  1MZB A;  2NU6 B;  4UUG A;  4F4X A;  2C22 A;  3VMM A;  2Y4R A;  4JI1 H;  2DWC A;  3J80 W;  3WWH A;  4J9N A;  2W6O A;  4DL7 A;  4YP3 A;  5C44 G;  2J6T A;  4I4T F;  3T9E A;  5JVD F;  1PK8 A;  1IOW A;  4O2A F;  4DL6 A;  1HR0 H;  2HVQ A;  4J9M A;  4O7W A;  5L1I A;  5CR5 A;  3FKI A;  5BYB A;  4I7H A;  5KFF A;  1VBH A;  1CQJ B;  4RZQ A;  2W9A A;  3PW0 A;  5KT3 A;  4R8U B;  5BWR A;  2Q2U A;  3ORQ A;  4O81 A;  2RGV A;  3TW6 A;  5EWE A;  2W9C A;  2JEF A;  4IR1 A;  1IYD A;  3NGD A;  4B3M H;  4LF6 H;  1K1Q A;  5EZY F;  5CB4 F;  5HV6 A;  4YR2 A;  2A1H A;  4QIW A;  4PZ7 A;  5BMV F;  4DV7 H;  3M9M B;  2CNU A;  4O7R A;  2M05 A;  3HKZ A;  1KTA A;  1I1L A;  3ETJ A;  4E4T A;  4QW8 A;  3V6H A;  4EBE A;  5CM0 A;  2XC9 A;  4RNO A;  2AQ4 A;  3QZ8 A;  2JA8 G;  5KFJ A;  4FFM A;  1XK5 A;  1SFO A;  4BWS C;  4RB0 A;  2AGQ A;  2VA2 A;  3H0G A;  3BG5 A;  1TWF A;  4NXN H;  5C4X G;  4ED1 A;  1T3N A;  3HT5 A;  5DQG A;  3MR2 A;  1I1K A;  2ZGI A;  3RF2 A;  3T9C A;  3U55 A;  5CE8 A;  5BWV A;  1RJQ A;  4J9R A;  2VA3 A;  2QF7 A;  5GON F;  4A3I G;  2ZM6 H;  3RFC A;  1E4E B;  3KAL A;  2AU0 A;  4FBU A;  3OSN A;  4EYI B;  2C2R A;  2FPP B;  3CVZ A;  1S10 A;  3OSP A;  3DTG A;  3GIP A;  3W5O A;  1OBG A;  5BPH A;  3HOX G;  3BQ0 A;  3H4B A;  3RBD A;  5FLX W;  3RIZ A;  3Q1K A;  4CKC A;  2XIG A;  5KFN A;  1WRV A;  2XCP A;  5IYC G;  1R9T A;  4ECR A;  2RGR A;  3HXL A;  3N6R A;  2R85 A;  4JI2 H;  4JV5 H;  2HIX A;  3T9D A;  3UQ8 A;  3VA7 A;  4LFC H;  2VQF H;  1DV1 A;  1KT8 A;  1UC9 A;  5KFU A;  5A2Q W;  3KHG A;  3VPB A;  1S0O A;  4OX9 H;  4MV9 A;  2Z02 A;  4ZHQ F;  4ED0 A;  3TEK A;  3FMA A;  3WO0 A;  1ZQ7 A;  3GIK A;  2ALZ A;  3PN1 A;  3GJX B;  2FPI B;  2XD4 A;  1J5E H;  2FLN A;  4FE2 A;  4DUY H;  3G8D A;  3C0F B;  2COI A;  4YBZ B;  5FNV F;  4BY1 G;  4O7Z A;  1KJI A;  4FGR A;  5HBR B;  2V5A A;  2CZG A;  3LQS A;  4I55 F;  5JVL A;  3KTM A;  1IBK H;  4RZR A;  1V51 A;  3GDE A;  1N56 A;  3QWU A;  1E4F T;  4ZQI A;  5JH7 F;  2IBK A;  1FKA H;  1I2L A;  1GSO A;  4O82 A;  4FFP A;  4A2A A;  1XMQ H;  2FLL A;  2HIV A;  2R7L A;  4HQ6 A;  1TWA A;  5LMU H;  5KKN B;  1EZ1 A;  1K1S A;  4LFB H;  1WCM A;  4X64 H;  5J2U F;  1K83 A;  2W71 A;  5KFZ A;  4GKK H;  4MV8 A;  4RNM A;  4O3N A;  1TWH A;  2I87 A;  2R6F A;  3GV7 B;  2HJW A;  3Q8P B;  1JIH A;  2W8K A;  4GLX A;  3BAB A;  1A9X A;  3MWM A;  4JV2 A;  3J7A K;  4MA5 A;  1Y1V A;  2FJZ A;  3QZ7 A;  4JYA H;  5C3E G;  3GTO A;  5EOY A;  3HOV G;  2UU9 H;  2V9W A;  2VUM G;  2XGP A;  2Y0S E;  3GIQ A;  1IYE A;  4CHI A;  2JA6 A;  5K3W A;  2CNQ A;  1C3O A;  3PFF A;  3TII A;  1GSA A;  2UXC H;  5K2M A;  3JZF A;  2DAB A;  1SCU B;  1P16 A;  2JA5 A;  1XDN A;  2PBZ A;  4GKJ H;  4JXU A;  3GTG A;  2R7N A;  4FFN A;  4QSH A;  5I5V A;  1V9P A;  1ZHS A;  2RF4 A;  4DRF A;  4ZOL F;  3WNZ A;  2YCH A;  4EEQ A;  5IYD G;  3T54 A;  5LA6 F;  3T9A A;  4Q0Y A;  4M7E A;  1AUX A;  3RB0 A;  5IP9 G;  5FD6 A;  3QFF A;  3GB8 B;  3MJF A;  2JEI A;  4KHP H;  4U7C A;  2BQR A;  3UZO A;  3BAA A;  5DGB A;  2QYZ A;  4O3Q A;  1HNZ H;  4GLW A;  5L1J A;  1CE8 A;  2HGX A;  4ECT A;  4A3G G;  2F4V H;  4A3D G;  2EJ0 A;  4DUZ H;  5I60 A;  2FK3 A;  1Y1W A;  3T9F A;  4O83 A;  4RUA A;  2R7K A;  3M9O B;  5KFD A;  4Q8F A;  3CSW A;  2DZD A;  1G2W A;  1A3G A;  1Z2O X;  2V58 A;  2W7P A;  3PW5 A;  1A0G A;  5KG2 A;  3N44 B;  1S0N A;  3T5K A;  4IR9 A;  3JZI A;  3T99 A;  4CC5 A;  2O03 A;  4ZI7 F;  5KG1 A;  3L4K A;  3K5I A;  4I50 F;  1EUD B;  5DG9 A;  4DR6 H;  2C35 B;  4UCO A;  1TWC A;  3TY9 A;  1PX2 A;  4CMD A;  2RDI A;  4AYB E;  5KFE A;  5LL6 b;  4DV1 H;  5E25 A;  2V59 A;  1UC8 A;  5LP6 F;  4NLG A;  2ZDH A;  4QWC A;  3M9N B;  3IG0 A;  3R5X A;  4YJ3 F;  2UVV A;  4O7L A;  3OUZ A;  4HNU A;  5KFR A;  2C2D A;  3KHH A;  5DIS C;  4DIM A;  2YZL A;  1ET0 A;  2QK4 A;  3VOT A;  1E4G T;  2W6Z A;  5CAE B;  1ULZ A;  4C5C A;  1Y14 B;  1WR2 A;  5F9L A;  3HB9 A;  3G6V A;  3GII A;  2YL2 A;  4TQR A;  2ASD A;  4O4L F;  4B3S H;  4ECU A;  2FE3 A;  1UNN C;  4O7T A;  3BA9 A;  4J9O A;  5LXT F;  4RNN A;  4UCR A;  1O75 A;  5KFS A;  4O2B F;  2ASL A;  3ETH A;  1CQI B;  3PW4 A;  2AGP A;  4YB8 B;  4AQY H;  2E5L H;  5BPF A;  3NBY B;  2COG A;  2R93 A;  2BQU A;  2W6M A;  4EBD A;  1KBL A;  1BJT A;  3GLK A;  4O7Y A;  4C5B A;  3GV5 B;  4CE5 A;  2MCT A;  5FD5 A;  1I50 A;  4DV5 H;  3AW8 A;  4O3P A;  4LF9 H;  5CA0 F;  3KHR A;  4O3R A;  4TV8 F;  4EFE A;  1OBD A;  3AX6 A;  4DR2 H;  4ECY A;  3Q2O A;  4TM5 A;  3Q8S B;  2R87 A;  4EGJ A;  2HG8 A;  3KYH C;  5FLM G;  4O3O A;  2J9G A;  3JAM W;  1XNR H;  4Q44 A;  2ZDQ A;  5KFA A;  3PR5 B;  1EYZ A;  1M0T A;  3H0G G;  5JUM A;  2UVU A;  2W57 A;  4X62 H;  2X0S A;  1EKV A;  1JDE A;  5IYB G;  1BGW A;  3GTQ A;  4R8U A;  3N42 B;  2EJ2 A;  3IN5 A;  4J9K A;  2COJ A;  2UUB H;  4ED7 A;  5EDW A;  5CA1 F;  4JI7 H;  3RB3 A;  4ECV A;  3V4S A;  2WB1 E;  5KT2 A;  2B63 G;  1W96 A;  4A3F G;  5KFO A;  1I94 H;  2NU8 B;  3RGX A;  2JEJ A;  5EWG A;  1GO3 E;  1N36 H;  1KUT A;  4DR1 H;  3MFH A;  4BBR G;  4A3M G;  1I3Q A;  5KFY A;  2VR1 A;  5KT5 A;  4JI6 H;  3GTK A;  4MV3 A;  4YR3 A;  5EWF A;  4FM9 A;  2UXB H;  3CQZ A;  3HOY G;  3VPC A;  2GQS A;  4JUZ A;  2R8H A;  2SCU B;  1CKN B;  3N6X A;  4XYM B;  4J9L A;  1S9F A;  4O4J F;  4ED2 A;  2HDK A;  5LYJ F;  4HN2 A;  2Y0S A;  1I7L A;  1T36 A;  3QQM A;  4YHH H;  5IT9 W;  4EYH B;  4IHJ F;  5C5J A;  3PW7 A;  4DR4 H;  3T9B A;  1I1M A;  3KAJ A;  3TY5 A;  4CKE A;  5FPO A;  2NUA B;  4MTE A;  1HNX H;  4ECQ A;  3N43 B;  4GC7 A;  3I4M G;  5JQG F;  3HO8 A;  2W6N A;  2Z04 A;  4O86 A;  4EBC A;  2ABJ A;  4A3J G;  5DGI A;  3MR5 A;  3GIL A;  1S68 A;  2IP4 A;  4X65 H;  4C2M A;  4MV6 A;  3EPG A;  4CMF A;  1KJJ A;  5KG7 A;  4J9P A;  4A3E G;  2R92 G;  3JSN A;  2WAQ A;  4YAK B;  4QJF A;  4WBN F;  1AUV A;  1RK5 A;  1A0I A;  1WCM G;  4JV0 A;  4IAJ A;  3PW2 A;  5KFK A;  2J6S A;  2JEG A;  4TQS A;  4A93 G;  5KFI A;  2JA7 A;  5D1O B;  4M9U A;  4QW9 A;  3EPI A;  5T14 A;  3U9T A;  3DAA A;  3KAK A;  2PMZ E;  5KFP A;  5BR8 H;  4LF5 H;  4ME6 A;  1L2Z A;  3TY8 A;  1JXL A;  4FFL A;  5F9N A;  4MTD A;  5KFV A;  3PZP A;  4XYL B;  3NBZ B;  4F4Z A;  5FPR A;  1DIK A;  5DQH A;  1DV2 A;  4UCS A;  3BAC A;  4O4I F;  3L2P A;  4IWX A;  1KC7 A;  4QWD A;  4J0M A;  3R5F A;  5C1P A;  4C5A A;  5I5T A;  4RAY A;  1VS0 A;  1BXR A;  1TA8 A;  2PVP A;  3LP8 A;  4UCT A;  4AYB A;  5IWA H;  4YQW A;  4Q8E A;  2JA6 G;  3GTP A;  5KG0 A;  4DR3 H;  2JA5 G;  2WDT A;  4F4W A;  4A3K G;  4A3C G;  3NUA A;  2VOB A;  3G8C A;  5HNE A;  3RBE A;  1HNW H;  4FBT A;  4CKB A;  2R84 A;  3Q8R B;  4LSA A;  2HGW A;  2FKL A;  5KFW A;  5DG7 A;  3TIG A;  3RV4 A;  3KXY T;  2W9B A;  4LFA H;  3RTX A;  2EJ3 A;  2FPG B;  4FFO A;  4BXX G;  2DIK A;  1SEI A;  4RAZ A;  4J9Q A;  4DV6 H;  2BR0 A;  5I5Y A;  5KT4 A;  5DLG A;  1V4Y A;  2HVR A;  4PDB A;  3H4D A;  1SYX B;  3BA8 A;  2V4R A;  4TV9 F;  3UYY A;  4L1K A;  4ED8 A;  2HHH H;  3SI8 A;  3EYY A;  4RB1 A;  4IZO A;  1Y1W G;  4FFR A;  3R9R A;  5DQI A;  2W8L A;  4HR7 A;  1B33 N;  4DAA A;  5DG8 A;  5KX5 F;  2HHF A;  2W6Q A;  4EEY A;  5KG3 A;  5KFH A;  2UUA H; 
#chains in the Genus database with same CATH homology
 4AQY H;  2E5L H;  4DR5 H;  3NBY B;  3W1G A;  3HXL A;  3S24 A;  1XMO H;  4JI2 H;  2RGR A;  2VPS A;  2HIX A;  4LH6 A;  3UQ8 A;  4LFC H;  1BJT A;  4R7R A;  2VQF H;  5LMN H;  4OX9 H;  5A2Q W;  5FD5 A;  2MCT A;  3F8N A;  4MV9 A;  4DV2 H;  4DV5 H;  4LF8 H;  3N40 P;  4LF9 H;  1I6U A;  2VUG A;  4EFE A;  3FMA A;  4DR2 H;  1J5E H;  3PN1 A;  3GJX B;  4DUY H;  3KYH C;  3C0F B;  3JAM W;  1XNR H;  4UCV A;  4LH7 A;  1M0T A;  5D1O A;  2W57 A;  4JI0 H;  4X62 H;  1TAE A;  2WYO A;  4PZ8 A;  1BGW A;  1IBK H;  3J81 W;  3N42 B;  1CKM A;  2CFM A;  3GDE A;  3QWU A;  1E4F T;  2CW8 A;  2UUB H;  4JI7 H;  1FKA H;  4JI5 H;  4APM A;  4LF4 H;  1Z2P X;  4A2A A;  1XMQ H;  1S03 G;  2HIV A;  1AN7 A;  4PZ6 A;  4NXM H;  1B04 A;  5LMU H;  4B3T H;  1I94 H;  3DF7 A;  3RGX A;  4LFB H;  1N36 H;  4DR1 H;  1WH2 A;  4X64 H;  4YY3 H;  4GKK H;  4JI3 H;  4JI4 H;  3RGZ A;  3RJ0 A;  4JI6 H;  3T1Y H;  4ETS A;  4FM9 A;  2UXB H;  3LML A;  4DV4 H;  3NC0 B;  3BAB A;  4GLX A;  3MWM A;  1Z2N X;  3W1B A;  3T1H H;  1CKN B;  3N6X A;  4LF7 H;  3J7A K;  4JYA H;  4B3R H;  4YHH H;  2HGS A;  5D1P A;  5EOY A;  1XNQ H;  2UU9 H;  5IT9 W;  3L4J A;  4DR4 H;  1IBL H;  4DV3 H;  3K3V A;  4JI8 H;  1P8L A;  3KAJ A;  3TY5 A;  4UCU A;  2UXC H;  4MTE A;  5FPO A;  1ZHQ A;  1HNX H;  1P16 A;  2UUA H;  1XDN A;  3N43 B;  3H20 A;  4DV0 H;  4GKJ H;  4UFZ A;  1DGS A;  2HVS A;  1N32 H;  1M0W A;  1MZB A;  1S68 A;  4X65 H;  4JV5 H;  1V9P A;  1ZHS A;  2YCH A;  4DRF A;  2WE6 A;  4JI1 H;  4EEQ A;  4MV7 A;  4Q0Y A;  3J80 W;  4M7E A;  4E6N A;  3RR5 A;  3M4I A;  5FD6 A;  1X9N A;  4RB3 C;  3JSN A;  3OTO H;  3GB8 B;  1CKO A;  4KHP H;  3BAA A;  1A0I A;  1HNZ H;  2OWO A;  4IAJ A;  1HR0 H;  2HVQ A;  2UXD H;  2F4V H;  2UUC H;  5D1O B;  4DUZ H;  4I7H A;  4RZQ A;  2Q2T A;  3KAK A;  4LF5 H;  5BR8 H;  1FVI A;  2Q2U A;  2RGV A;  1L2Z A;  3TY8 A;  3N41 B;  4MTD A;  1Z2O X;  4LSX A;  4B3M H;  3NBZ B;  2KSW A;  4LF6 H;  5FPR A;  4UCS A;  3L2P A;  3N44 B;  4PZ7 A;  4CC5 A;  4J0M A;  2O03 A;  4DV7 H;  4RAY A;  3L4K A;  1N33 H;  1VS0 A;  4UCT A;  1TA8 A;  5IWA H;  4DR6 H;  4UCO A;  3TY9 A;  5LL6 b;  2ZJT A;  2CW7 A;  3JSL A;  4DV1 H;  4DR3 H;  2WDT A;  1XK5 A;  2VOB A;  4EFB A;  1HNW H;  4BWS C;  4RB0 A;  3IG0 A;  4NXN H;  4LSA A;  4LFA H;  3KXY T;  4A2B A;  4RB2 C;  3RTX A;  3RF2 A;  1FJG H;  5DIS C;  1SEI A;  4X66 H;  4RAZ A;  1E4G T;  4DV6 H;  1CKN A;  4CC6 A;  2ZM6 H;  2HVR A;  4K0K H;  4PDB A;  3KAL A;  1SYX B;  3BA8 A;  2HHH H;  3CVZ A;  3EYY A;  4EQ5 A;  4RB1 A;  1N34 H;  4B3S H;  3W5O A;  2FE3 A;  2VQE H;  1GYF A;  3VNN A;  3BA9 A;  4UCR A;  1O75 A;  5FLX W;  3RIZ A;  4LMY A;  2XIG A;  4DR7 H;  1IBM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...