3RTXA

Crystal structure of mammalian capping enzyme (mce1) and pol ii ctd complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
343
structure length
262
Chain Sequence
SLKLGAIFLEGITVKGVTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIRLLEQKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDKVNGQAVPRYLIYDIIKFNAQPVGDCDFNIRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRPKQFFDINISRKLLEGDGLIFQPIGKYKPGRCDDILKWKPPSLNSAYNTAMAVCNSISNPVTKEMLFEFIDRCAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights to how mammalian capping enzyme reads the CTD code.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords mRNA-capping enzyme
total genus 68
structure length 262
sequence length 343
chains with identical sequence B
ec nomenclature ec 2.7.7.50: mRNA guanylyltransferase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01331 mRNA_cap_enzyme mRNA capping enzyme, catalytic domain
A PF03919 mRNA_cap_C mRNA capping enzyme, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3rtxA01
3.30.1490.430 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3rtxA02
1CKMA 4PZ7A 2VUGA 4PZ6A 5D1OB 5D1PA 1XDNA 5D1OA 3W5OA 4EQ5A 3PN1A 3S24A 3UQ8A 3VNNA 3L2PA 1VS0A 3GJXB 4UCUA 3TY9A 3NC0B 3W1GA 3QWUA 4PZ8A 4UCVA 2HVSA 1FVIA 3NBYB 1P16A 1TA8A 4UCTA 4LH7A 4DRFA 1V9PA 3GDEA 4EFBA 5FPRA 3GB8B 2CFMA 3JSLA 2HVRA 1CKNB 2Q2TA 4LH6A 1TAEA 2HVQA 3BABA 1A0IA 4GLXA 4UCSA 4UCRA 3TY5A 3W1BA 4EEQA 1S68A 3RR5A 3TY8A 3BA8A 4CC5A 2Q2UA 5FPOA 2OWOA 1CKNA 3NBZB 1DGSA 1B04A 3JSNA 4CC6A 2HIVA 3RTXA 3KYHC 4UFZA 3BA9A 4EFEA 1XK5A 4E6NA 1X9NA 5DISC 1P8LA 1CKOA 2HIXA 4UCOA 3BAAA
chains in the Genus database with same CATH superfamily
5KFIA 1E4EA 4IHJF 3WO0A 5K3WA 5FD6A 2HGWA 4ECQA 3H3VH 3DTGA 1XNQH 4O83A 2Q7DA 1SFOA 4O3QA 4ECUA 3WWIA 4F4ZA 4LH7A 1V9PA 3GDEA 4QW8A 4G3IA 4O4JF 2CFMA 4YHHH 4FFNA 3RGXA 3HOWG 4YJ3F 5I5SA 2Q2TA 3PW2A 4JI5H 3RV3A 4C5BA 4UCRA 2FPGB 3RB6A 3HOVG 2R7MA 1WCMA 5L1IA 1N56A 1ZQ7A 2I87A 3KHGA 2WE6A 2W9CB 2YL2A 2VOBA 2J6TA 2Y0SE 4YR0A 2ASJA 1VKZA 1CKOA 2NU7B 1K1SA 4J9SA 1M0WA 3GTJA 2VQDA 4HNUA 4J9LA 2ATLA 3VMMA 3U0GA 3T5KA 2Y0SA 3PN1A 1JDEA 4F50A 3UFXB 4UUGA 1VS0A 3JAMW 1S03G 4AYBE 4RNMA 3QWUA 4M9UA 4MV6A 5FR9A 4DIMA 2HVSA 4RAYA 3NBYB 2CNQA 3OUUA 3F8NA 4DL5A 1HNXH 2V9WA 4CMDA 1I6UA 4XYMB 2RDIA 1UC8A 5LA6F 2NVXA 1I1LA 2V5AA 2YS7A 4EG0A 4U6PA 3Q8SB 4A3FG 4JYAH 3RJ0A 4X62H 3ETJA 1V51A 4O82A 4J9MA 4O3SA 2E2IA 4DV6H 2VPQA 2RF4A 4ED2A 4RNNA 3NGDA 5A2QW 4F4WA 5I5YA 2R8JA 2XGQA 1AUVA 1Y1VA 5KT6A 4X66H 2VQEH 1I7LA 4YAKB 4A93G 3BAAA 1OBDA 5DGHA 2NU9B 3N6XA 4Q44A 2X5RA 4Q43A 4DQNA 5KFNA 4Q4CA 4QIWE 5EWGA 4MV4A 2YS6A 2ZGIA 1TWFA 1VBHA 3QQMA 5LL6b 4B3RH 4LF5H 4FS2A 3ORRA 5H80A 1Y1WG 2GQSA 4R8UB 1J5EH 5KFJA 1IYEA 5L1LA 2W71A 4O7WA 4DAAA 5CR5A 3GB8B 2IP4A 4YB8B 3L4KA 5IT9W 4YAJB 1GGOA 3RB3A 1C30A 3ORQA 4DR7H 4FFRA 3QZ8A 4ED6A 2W7PA 1RYSA 1UC9A 2W8LA 2UVUA 2W6MA 3NBZB 2COIA 1XMOH 4CC6A 3AYHB 2FLNA 1Z2OX 3KHHA 5DQIA 1M7JA 2J6UA 2FK2A 2UXBH 2NU8B 4GC7A 2UXCH 2R85A 1S9FA 2AGQA 4UCOA 5F9LA 4O7NA 4EFEA 2W8KA 2WTFA 3WNZA 4O2AF 3U54A 4PZ6A 2UUCH 2JA6A 4QWAA 4RB0A 3W5OA 3G6YA 3U9SA 3VPDA 5IP7G 3KHRA 3GIQA 2NU6B 2R82A 5HV6A 4PWQA 4QW9A 2V4QA 5KFFA 4RNOA 3GTQA 2C28A 4PDBA 1A9XA 3K3VA 4L1KA 3BQ0A 3HOUG 1WR2A 3KREA 1RJQA 4ECTA 3T5HA 2O03A 5LMNH 5IYZF 4YY3H 3GIPA 2HVQA 2R7LA 2CKZB 4RB2C 3JZFA 2C00A 2DAAA 5EDWA 4FFMA 1KEEA 2HHFA 4DL6A 2VA3A 1KJQA 3JZIA 3RUPA 2WAQE 4A3CG 3Q1KA 2CW8A 3R5HA 5EOYA 3BA9A 2OLSA 1X9NA 3EPIA 2SCUB 3MWMA 4I7HA 3T5JA 5KFGA 2BQRA 5I5TA 1A48A 1A0GA 2A1HA 1EZ1A 3BG5A 3TW7A 1ZHQA 3IN5A 5DGBA 3JZ6A 3BACA 3KTMA 3KAKA 3NC0B 3MR3A 2IBKA 1WSCA 5IP9G 4JI2H 4EBCA 2ASDA 3OUZA 3N42B 3PW0A 5I5XA 1CQJB 2JA7G 2EJ3A 1WH2A 2HVRA 5IYCG 1T36A 4Q4DA 2OH2A 3UYYA 4JV5H 5KG6A 4GLXA 4IWYA 4FM9A 2YRXA 4O7LA 3BA8A 1ET0A 2R7KA 3SE7A 4MA0A 3IG0A 2W6PA 4O4HF 2BR0A 4O7VA 5BPFA 3MR6A 5KG7A 2W9BA 3M9NB 3U9TA 4DV3H 1IBLH 3DF7A 4HNTA 5J2UF 4B3TH 3HO8A 2BQ3A 2R8KA 4RB1A 4IZOA 2QB5A 2YYAA 5DLGA 1CS0A 3GIIA 3BJYA 5JQWA 2FK3A 2UVVA 4FFOA 1CKMA 2VUGA 5KG1A 2XCPA 3GILA 5C1PA 4RAZA 5KFHA 4A3GG 3GJXB 2UUAH 1E4EB 4NYEA 3W1GA 1BNCA 4PZ8A 3KXYT 2ODTX 1Y1WA 2PN1A 4A3JG 4UCTA 4Q0YA 3AX6A 3KALA 3RIZA 4QWBA 1BJTA 1T94A 4AYBA 2W57A 5LMUH 1VAJA 4EBDA 3BABA 1GSOA 5JVLA 4DV2H 1JDBB 3PFFA 4O3NA 2HDKA 1S68A 4CC5A 3EYYA 4QJFA 4A3LG 1G2WA 4J9OA 1GYFA 5DG8A 5IYDG 4EYHB 5BR8H 1Z2PX 5JUMA 1W96A 3N6RA 4I50F 4TV9F 3VOTA 2DLNA 3VA7A 1RK6A 4ECYA 2WYOA 4O2BF 4XX0B 1N34H 4E6NA 4ECSA 5I47A 3SNOA 5D8DA 1TWHA 1SCUB 1ZETA 2W9CA 4IIJF 2UVRA 3RF2A 4K6NA 4K0KH 2YRWA 1OWTA 4GC6A 1C3OA 1XDNA 4EQ5A 3H20A 3UZBA 3UQ8A 1KTAA 3HKZA 4J9NA 4ECXA 2XD4A 4DR6H 4QWCA 5CA0F 3GIJA 1N48A 4XYLB 2YZGA 2YW2A 1I7NA 1CE8A 2CNUA 5KFLA 3NUAA 2WDTA 3MFIA 2VUMA 2NVYA 2Y4RA 2PMZA 1IBMH 3J80W 2JA8G 3H0GG 2GPWA 2GPSA 1TAEA 5EWFA 3OSNA 2UUBH 2R84A 4O3OA 3QFFA 3GIDA 4F4YA 2VA2A 4UCSA 5C4XG 4C5AA 3J7AK 4LF4H 3TY8A 4O4IF 2OWOA 4O3PA 4LF6H 5DAAA 4JI0H 4YP3A 1M6VA 3TEKA 4MV9A 5E25A 2FPPB 2W6ZA 5KFWA 3Q8PB 1XK5A 1PX2A 3DTFA 4FFPA 3R5FA 1TWGA 2W7OA 2HIXA 5DLFA 1RYRA 5DG9A 1L2ZA 2R87A 5JH7F 4YBZB 4ECVA 2YU9A 3KHLA 2COGA 3CEBA 3GLKA 4WD3A 3TY9A 4DLKA 3G6XA 2FLPA 4YJ2F 4A3BG 1JKJB 1GSHA 1ULZA 5KFQA 1P16A 1MZBA 3ETHA 4QWDA 4ZQIA 2CZGA 1B6RA 4CKEA 3GV8B 4FBUA 2DWCA 4LH6A 4MV8A 4NXNH 4RU9A 4JXUA 3TY5A 2W9AA 4FE2A 2NUAB 1WCMG 1BGWA 1TWCA 2BQUA 4QWEA 2R92G 2ALZA 2AGPA 5GONF 2R7NA 3RBEA 4MTEA 5L9XA 3TINA 5BWTA 3LP8A 4JV2A 2JEJA 4DL7A 3AW8A 1GSAA 4EBEA 4B3SH 5D1OB 2FJZA 5D1OA 2FE3A 3WWJA 4DL3A 4JUZA 3RAQA 3GTMA 3V4SA 2PBZA 1IYDA 3RGZA 4O7YA 3BQ1A 4UCVA 3GTOA 5F9NA 1ZHSA 2J9GA 4PBCA 1T3NA 5KFTA 1XNRH 2DZDA 2PVPA 1S10A 2C2DA 3GTGA 4ECWA 4RB3C 1VBGA 5BPHA 2VQFH 2HGXA 3K5IA 1ZAUA 3FDSA 5IWAH 4JI3H 2B63A 3MFHA 3T9EA 3Q8QB 2EIYA 2FKLA 2IA6A 1UNNC 3G8DA 4TM5A 5C44G 3HOXG 3I12A 3V6HA 4FGRA 5CM0A 3T54A 1B33N 2E2HA 5KFYA 4JI8H 1KC7A 4LFAH 4PZ7A 5D1PA 4BBRG 2HGSA 2I8CA 1EKPA 1DAAA 2JEIA 3JRXA 5KS8A 3HT5A 2GQRA 2FMAA 3VPCA 4Q45A 2C22A 4ZHQF 3C0FB 4IRDA 2YZNA 4ED8A 4DV1H 5KX5F 3H4DA 3WWHA 4CHIA 2P0AA 3QZ7A 1EKFA 5KFXA 4NLGA 4GLWA 4EGJA 5J2TF 4A2AA 5T14A 4Q8FA 5KKNB 5LXTF 4TQSA 4GKJH 2B63G 1I3QA 5KFDA 3R5XA 4TVIA 1Y14B 2JA5A 5KFPA 2C2EA 4APMA 4J9QA 2HIVA 4O4LF 3CQZA 2J6SA 2HG8A 5DISC 2W9BB 3HKZE 2CNVA 4LSXA 4RZRA 4J9RA 2UXDH 4HYKA 3T9CA 3MR2A 3TW6A 4IAJA 3V6JA 3U55A 2RDJA 3SI8A 4HQ6A 3R9RA 2R8HA 4FBTA 2R8GA 2Z04A 3GV7B 2R93G 4UCUA 3Q2OA 1AN7A 4A2BA 4DV5H 1V4YA 2DABA 5KFOA 1R9TA 4DRFA 1A3GA 3DAAA 3TQTA 4CE5A 4C2MA 4EFBA 4YQWA 4JI1H 4MAMA 4JI4H 4LFCH 3OTOH 3M4IA 2E5LH 2XCAA 4MV7A 5FLMG 2HJWA 1HR0H 3PO2G 2PMZE 5KT2A 5KG4A 4DV7H 4ECRA 3GTKA 2QF7A 2UVWA 3RTXA 3EPGA 2R92A 2C35B 2CW7A 5K2MA 5KFBA 3BQ2A 4ME6A 3WO1A 1KJ8A 3M9MB 4O3RA 5C8YF 4RUAA 4X65H 5IYBG 2COJA 3RBDA 2FP4B 3HB9A 3LMLA 3MWDA 2DIKA 4OX9H 5DGAA 2VPSA 3H0GA 5KT4A 4HR7A 3V6KA 1RJRA 2YWVA 3T99A 4J0MA 1KJJA 3E5NA 3VNNA 3TIGA 1N32H 3FKIG 1DIKA 4JI7H 3RB0A 4NZNA 4QSHA 2ZM6H 5KFKA 5I5UA 1E4GT 1JIHA 1JLLB 5CE8A 3HXLA 3UZOA 4MV3A 2WB1E 5KFRA 4B3MH 5BWRA 1CKNB 3GIMA 2R6FA 4O7ZA 2ZJTA 1HNWH 5KFZA 4EGQA 5KG2A 3LWBA 3N8DA 4C5CA 1RJPA 1EYZA 4LMYA 3PW7A 2R93A 5KFCA 1GLVA 5BWVA 3VPBA 5CB4F 1JXLA 3JSNA 1IOWA 3LQSA 2V58A 3PR5B 4UFZA 1XMQH 1DV1A 2Z02A 4CKCA 2DPJA 1I2LA 3TQ1A 3PZPA 4A3MG 2AU0A 2HHHH 3V4ZA 3N43B 4U7CA 4RUCA 4DUYH 5KG0A 3N44B 2XC9A 2YCHA 5EWEA 4ED1A 3S24A 3K3PA 3PVXA 5CAEB 5KG3A 3Q8RB 1FJGH 5KFEA 1M0TA 1RK5A 4X64H 4YR3A 3H40A 4Y8VB 4DR5H 3HOYG 2R7ZA 4A3IG 4DR1H 1K83A 2JA7A 4E4TA 1EHIA 4MV1A 4WHXA 2HHFB 3GQCA 4LF8H 3PO3G 2JA6G 4R8UA 4M0JA 5KT5A 1I1MA 1KJ9A 2YZLA 4MTDA 4A3KG 5DGIA 3OSPA 1KT8A 4J9KA 2AQ4A 2MCTA 5CA1F 3RAXA 5LYJF 3T9AA 4ED7A 2JEFA 4DR2H 2XCLA 3GIKA 2XGPA 4DL4A 2EJ2A 2EJ0A 1SYXB 2CQYA 3M9OB 4FS1A 5C3EG 4LFBH 4YR2A 4BXXG 5KG5A 4DR3H 1IBKH 5FNVF 1S0OA 2QK4A 4AQYH 4F4XA 1CQIB 2V59A 2M05A 5KFSA 3L2PA 5DQHA 3T1YH 4IR9A 3H4BA 1HNZH 2ASLA 1PK8A 3I4MG 3RV4A 5I5WA 3RB4A 4FU0A 3J81W 4LF7H 5KFAA 3JSLA 5BWWA 3I4NG 4TUYF 4WBNF 2FK1A 2XIGA 2W6QA 1B6SA 2FLLA 3SGIA 1EUCB 3T9FA 5I60A 3L4JA 4IRKA 3N41B 2Q2UA 4RCNA 4CKBA 3MJFA 1O75A 3GV5B 4IRCA 3HOZG 4GKKH 4NZMA 1DGSA 3KAJA 3LULA 5I5VA 3MR5A 4IR1A 3K5HA 3KYHC 5HNEA 2ZDHA 1KBLA 2X0SA 4NZOA 4HNVA 4ETSA 5FJ8G 4QIWA 5BYAA 5LP6F 5BMVF 1BXRA 1I1KA 3TIIA 4CMFA 2DPIA 2RGRA 1I2KA 1W93A 2AGOA 3HBLA 4JV1A 3GTLA 2YZMA 4M7EA 5KT3A 3N40P 4EEYA 3FKIA 3OHBA 5BWXA 1FVIA 4O7RA 4FFLA 4I55F 2W70A 2VUMG 3CSWA 5DMXA 3JRWA 5FPRA 4O7SA 4I4TF 2KSWA 1Y1VG 1IOVA 4O84A 1OBGA 4IWXA 5KT7A 1AUXA 5BWUA 5LOVF 3OHAA 5L1KA 3T5LA 1A0IA 4ED3A 1JX4A 3G6VA 3GTPA 1SEIA 3W1BA 4Q8EA 4EEQA 4ECZA 3RR5A 1Z2NX 2C2RA 5FPOA 2W6NA 2ZDQA 1CKNA 5L1JA 4MA5A 2RGVA 3PW4A 3R23A 2GLTA 4ZI7F 1E4FT 2IMWP 1EUDB 4A3EG 2JEGA 5KFMA 4KHPH 3MWEA 4DV4H 2R86A 5JQGF 3RFCA 3T9DA 2I80A 1S97A 1S0NA 1N33H 3G8CA 3T9BA 4DR4H 5C5JA 2R8IA 2ABJA 1FKAH 2JA5G 4DV0H 1K1QA 3T1HH 5JVDF 4ED0A 4O81A 5KFUA 2UU9H 1EKVA 2V4RA 4J9PA 1WRVA 2FPIB 5DQGA 4DL2A 4LF9H 1KUTA 1TA8A 2VR1A 4TV8F 1TWAA 2W6OA 4O7TA 1I50A 4ZOLF 1S0MA 1I94H 4JI6H 4NXMH 2QYZA 4A3DG 1N36H 4BY7G 4R7RA 5C1OA 3FMAA 3T7AA 5KFVA 4DUZH 4XZ3B 4LSAA 5FLXW 2F4VH 5HBRB 4BWSC 4TQRA 4EYIB 4JV0A 3PW5A 5DG7A 2WB1A 5FD5A 2R7ZG 1GO3E 3CVZA 4BBSG 4O86A 1B04A 1KJIA 2FB9A 5BYBA 4BY1G 2ZDGA 4RZQA 5EZYF 1P8LA 2WAQA 3PR4A 1DV2A 4HN2A
chains in the Genus database with same CATH topology
1ZHQA 5D1OB 3N44B 5FD6A 4B3SH 5D1OA 2FE3A 2YCHA 3S24A 1XNQH 3KAKA 1FJGH 3RGZA 1M0TA 3NC0B 4X64H 4UCVA 4DR5H 1ZHSA 4DR1H 1XNRH 4JI2H 4LH7A 1V9PA 3GDEA 3N42B 2CFMA 4RB3C 1WH2A 3RGXA 2HVRA 4YHHH 4LF8H 2Q2TA 4JV5H 4JI5H 2VQFH 4GLXA 5IWAH 4JI3H 4UCRA 4FM9A 4MTDA 3BA8A 3IG0A 2MCTA 4DV3H 1IBLH 4DR2H 3DF7A 2WE6A 4B3TH 2VOBA 4RB1A 1SYXB 1CKOA 4LFBH 4JI8H 1M0WA 4LFAH 4DR3H 1IBKH 1CKMA 4PZ7A 2VUGA 5D1PA 2HGSA 4AQYH 3PN1A 3T1YH 3L2PA 4RAZA 1VS0A 3GJXB 3JAMW 1HNZH 2UUAH 3W1GA 3C0FB 3QWUA 4PZ8A 2HVSA 4RAYA 3KXYT 4DUYH 4DV1H 3NBYB 1HNXH 3F8NA 1I6UA 4UCTA 4Q0YA 4LF7H 3J81W 4JYAH 3KALA 3RIZA 3JSLA 1BJTA 4A2AA 5LMUH 2W57A 2XIGA 3RJ0A 4GKJH 3BABA 4X62H 4DV2H 3L4JA 1S68A 4CC5A 2Q2UA 1O75A 3EYYA 3N41B 4GKKH 1GYFA 4APMA 4DV6H 4JI0H 1DGSA 1Z2PX 3KAJA 5BR8H 2HIVA 5A2QW 1N34H 3KYHC 2WYOA 4E6NA 4ETSA 4X66H 5DISC 2VQEH 4LSXA 2UXDH 3BAAA 3RF2A 4IAJA 4K0KH 3N6XA 1XDNA 4EQ5A 3H20A 2RGRA 3UQ8A 4DR6H 5LL6b 4B3RH 4M7EA 4UCUA 3N40P 1AN7A 4A2BA 4DV5H 4LF5H 1FVIA 1J5EH 4DRFA 2WDTA 4JI1H 4EFBA 5FPRA 3GB8B 5IT9W 2KSWA 3L4KA 4JI4H 1IBMH 4LFCH 3J80W 3OTOH 3M4IA 1TAEA 2UUBH 1A0IA 2E5LH 4DR7H 1S03G 4MV7A 4UCSA 3W1BA 1SEIA 3J7AK 4EEQA 3RR5A 3TY8A 1HR0H 2OWOA 1Z2NX 5FPOA 4LF4H 4LF6H 1XMOH 1CKNA 3NBZB 4DV7H 4CC6A 1Z2OX 3RTXA 2RGVA 2CW7A 4MV9A 1E4FT 2UXBH 1XK5A 4X65H 4KHPH 2UXCH 1L2ZA 2HIXA 4DV4H 4UCOA 3LMLA 4OX9H 4EFEA 1N33H 2VPSA 4DR4H 2UUCH 4PZ6A 4RB0A 3W5OA 4J0MA 1FKAH 4DV0H 3VNNA 3T1HH 1N32H 3TY9A 2UU9H 4PDBA 4JI7H 3K3VA 4LF9H 1P16A 1TA8A 1MZBA 2ZM6H 1I94H 1E4GT 3HXLA 4JI6H 4NXMH 2O03A 5LMNH 1N36H 4B3MH 4YY3H 1CKNB 4R7RA 4LH6A 3FMAA 2HVQA 4RB2C 2ZJTA 4LSAA 5FLXW 4DUZH 4NXNH 1HNWH 2F4VH 3TY5A 4BWSC 4LMYA 5FD5A 1BGWA 3CVZA 1B04A 3JSNA 2CW8A 5EOYA 4UFZA 1XMQH 3BA9A 4RZQA 1X9NA 4MTEA 3MWMA 4I7HA 1P8LA 2HHHH 3N43B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKM A;  4PZ7 A;  2VUG A;  4PZ6 A;  5D1O B;  5D1P A;  1XDN A;  5D1O A;  3W5O A;  4EQ5 A;  3PN1 A;  3S24 A;  3UQ8 A;  3VNN A;  3L2P A;  1VS0 A;  3GJX B;  4UCU A;  3TY9 A;  3NC0 B;  3W1G A;  3QWU A;  4PZ8 A;  4UCV A;  2HVS A;  1FVI A;  3NBY B;  1P16 A;  1TA8 A;  4UCT A;  4LH7 A;  4DRF A;  1V9P A;  3GDE A;  4EFB A;  5FPR A;  3GB8 B;  2CFM A;  3JSL A;  2HVR A;  1CKN B;  2Q2T A;  4LH6 A;  1TAE A;  2HVQ A;  3BAB A;  1A0I A;  4GLX A;  4UCS A;  4UCR A;  3TY5 A;  3W1B A;  4EEQ A;  1S68 A;  3RR5 A;  3TY8 A;  3BA8 A;  4CC5 A;  2Q2U A;  5FPO A;  2OWO A;  1CKN A;  3NBZ B;  1DGS A;  1B04 A;  3JSN A;  4CC6 A;  2HIV A;  3RTX A;  3KYH C;  4UFZ A;  3BA9 A;  4EFE A;  1XK5 A;  4E6N A;  1X9N A;  5DIS C;  1P8L A;  1CKO A;  2HIX A;  4UCO A;  3BAA A; 
#chains in the Genus database with same CATH topology
 5KFI A;  1E4E A;  4IHJ F;  3WO0 A;  5K3W A;  5FD6 A;  2HGW A;  4ECQ A;  3H3V H;  3DTG A;  1XNQ H;  4O83 A;  2Q7D A;  1SFO A;  4O3Q A;  4ECU A;  3WWI A;  4F4Z A;  4LH7 A;  1V9P A;  3GDE A;  4QW8 A;  4G3I A;  4O4J F;  2CFM A;  4YHH H;  4FFN A;  3RGX A;  3HOW G;  4YJ3 F;  5I5S A;  2Q2T A;  3PW2 A;  4JI5 H;  3RV3 A;  4C5B A;  4UCR A;  2FPG B;  3RB6 A;  3HOV G;  2R7M A;  1WCM A;  5L1I A;  1N56 A;  1ZQ7 A;  2I87 A;  3KHG A;  2WE6 A;  2W9C B;  2YL2 A;  2VOB A;  2J6T A;  2Y0S E;  4YR0 A;  2ASJ A;  1VKZ A;  1CKO A;  2NU7 B;  1K1S A;  4J9S A;  1M0W A;  3GTJ A;  2VQD A;  4HNU A;  4J9L A;  2ATL A;  3VMM A;  3U0G A;  3T5K A;  2Y0S A;  3PN1 A;  1JDE A;  4F50 A;  3UFX B;  4UUG A;  1VS0 A;  3JAM W;  1S03 G;  4AYB E;  4RNM A;  3QWU A;  4M9U A;  4MV6 A;  5FR9 A;  4DIM A;  2HVS A;  4RAY A;  3NBY B;  2CNQ A;  3OUU A;  3F8N A;  4DL5 A;  1HNX H;  2V9W A;  4CMD A;  1I6U A;  4XYM B;  2RDI A;  1UC8 A;  5LA6 F;  2NVX A;  1I1L A;  2V5A A;  2YS7 A;  4EG0 A;  4U6P A;  3Q8S B;  4A3F G;  4JYA H;  3RJ0 A;  4X62 H;  3ETJ A;  1V51 A;  4O82 A;  4J9M A;  4O3S A;  2E2I A;  4DV6 H;  2VPQ A;  2RF4 A;  4ED2 A;  4RNN A;  3NGD A;  5A2Q W;  4F4W A;  5I5Y A;  2R8J A;  2XGQ A;  1AUV A;  1Y1V A;  5KT6 A;  4X66 H;  2VQE H;  1I7L A;  4YAK B;  4A93 G;  3BAA A;  1OBD A;  5DGH A;  2NU9 B;  3N6X A;  4Q44 A;  2X5R A;  4Q43 A;  4DQN A;  5KFN A;  4Q4C A;  4QIW E;  5EWG A;  4MV4 A;  2YS6 A;  2ZGI A;  1TWF A;  1VBH A;  3QQM A;  5LL6 b;  4B3R H;  4LF5 H;  4FS2 A;  3ORR A;  5H80 A;  1Y1W G;  2GQS A;  4R8U B;  1J5E H;  5KFJ A;  1IYE A;  5L1L A;  2W71 A;  4O7W A;  4DAA A;  5CR5 A;  3GB8 B;  2IP4 A;  4YB8 B;  3L4K A;  5IT9 W;  4YAJ B;  1GGO A;  3RB3 A;  1C30 A;  3ORQ A;  4DR7 H;  4FFR A;  3QZ8 A;  4ED6 A;  2W7P A;  1RYS A;  1UC9 A;  2W8L A;  2UVU A;  2W6M A;  3NBZ B;  2COI A;  1XMO H;  4CC6 A;  3AYH B;  2FLN A;  1Z2O X;  3KHH A;  5DQI A;  1M7J A;  2J6U A;  2FK2 A;  2UXB H;  2NU8 B;  4GC7 A;  2UXC H;  2R85 A;  1S9F A;  2AGQ A;  4UCO A;  5F9L A;  4O7N A;  4EFE A;  2W8K A;  2WTF A;  3WNZ A;  4O2A F;  3U54 A;  4PZ6 A;  2UUC H;  2JA6 A;  4QWA A;  4RB0 A;  3W5O A;  3G6Y A;  3U9S A;  3VPD A;  5IP7 G;  3KHR A;  3GIQ A;  2NU6 B;  2R82 A;  5HV6 A;  4PWQ A;  4QW9 A;  2V4Q A;  5KFF A;  4RNO A;  3GTQ A;  2C28 A;  4PDB A;  1A9X A;  3K3V A;  4L1K A;  3BQ0 A;  3HOU G;  1WR2 A;  3KRE A;  1RJQ A;  4ECT A;  3T5H A;  2O03 A;  5LMN H;  5IYZ F;  4YY3 H;  3GIP A;  2HVQ A;  2R7L A;  2CKZ B;  4RB2 C;  3JZF A;  2C00 A;  2DAA A;  5EDW A;  4FFM A;  1KEE A;  2HHF A;  4DL6 A;  2VA3 A;  1KJQ A;  3JZI A;  3RUP A;  2WAQ E;  4A3C G;  3Q1K A;  2CW8 A;  3R5H A;  5EOY A;  3BA9 A;  2OLS A;  1X9N A;  3EPI A;  2SCU B;  3MWM A;  4I7H A;  3T5J A;  5KFG A;  2BQR A;  5I5T A;  1A48 A;  1A0G A;  2A1H A;  1EZ1 A;  3BG5 A;  3TW7 A;  1ZHQ A;  3IN5 A;  5DGB A;  3JZ6 A;  3BAC A;  3KTM A;  3KAK A;  3NC0 B;  3MR3 A;  2IBK A;  1WSC A;  5IP9 G;  4JI2 H;  4EBC A;  2ASD A;  3OUZ A;  3N42 B;  3PW0 A;  5I5X A;  1CQJ B;  2JA7 G;  2EJ3 A;  1WH2 A;  2HVR A;  5IYC G;  1T36 A;  4Q4D A;  2OH2 A;  3UYY A;  4JV5 H;  5KG6 A;  4GLX A;  4IWY A;  4FM9 A;  2YRX A;  4O7L A;  3BA8 A;  1ET0 A;  2R7K A;  3SE7 A;  4MA0 A;  3IG0 A;  2W6P A;  4O4H F;  2BR0 A;  4O7V A;  5BPF A;  3MR6 A;  5KG7 A;  2W9B A;  3M9N B;  3U9T A;  4DV3 H;  1IBL H;  3DF7 A;  4HNT A;  5J2U F;  4B3T H;  3HO8 A;  2BQ3 A;  2R8K A;  4RB1 A;  4IZO A;  2QB5 A;  2YYA A;  5DLG A;  1CS0 A;  3GII A;  3BJY A;  5JQW A;  2FK3 A;  2UVV A;  4FFO A;  1CKM A;  2VUG A;  5KG1 A;  2XCP A;  3GIL A;  5C1P A;  4RAZ A;  5KFH A;  4A3G G;  3GJX B;  2UUA H;  1E4E B;  4NYE A;  3W1G A;  1BNC A;  4PZ8 A;  3KXY T;  2ODT X;  1Y1W A;  2PN1 A;  4A3J G;  4UCT A;  4Q0Y A;  3AX6 A;  3KAL A;  3RIZ A;  4QWB A;  1BJT A;  1T94 A;  4AYB A;  2W57 A;  5LMU H;  1VAJ A;  4EBD A;  3BAB A;  1GSO A;  5JVL A;  4DV2 H;  1JDB B;  3PFF A;  4O3N A;  2HDK A;  1S68 A;  4CC5 A;  3EYY A;  4QJF A;  4A3L G;  1G2W A;  4J9O A;  1GYF A;  5DG8 A;  5IYD G;  4EYH B;  5BR8 H;  1Z2P X;  5JUM A;  1W96 A;  3N6R A;  4I50 F;  4TV9 F;  3VOT A;  2DLN A;  3VA7 A;  1RK6 A;  4ECY A;  2WYO A;  4O2B F;  4XX0 B;  1N34 H;  4E6N A;  4ECS A;  5I47 A;  3SNO A;  5D8D A;  1TWH A;  1SCU B;  1ZET A;  2W9C A;  4IIJ F;  2UVR A;  3RF2 A;  4K6N A;  4K0K H;  2YRW A;  1OWT A;  4GC6 A;  1C3O A;  1XDN A;  4EQ5 A;  3H20 A;  3UZB A;  3UQ8 A;  1KTA A;  3HKZ A;  4J9N A;  4ECX A;  2XD4 A;  4DR6 H;  4QWC A;  5CA0 F;  3GIJ A;  1N48 A;  4XYL B;  2YZG A;  2YW2 A;  1I7N A;  1CE8 A;  2CNU A;  5KFL A;  3NUA A;  2WDT A;  3MFI A;  2VUM A;  2NVY A;  2Y4R A;  2PMZ A;  1IBM H;  3J80 W;  2JA8 G;  3H0G G;  2GPW A;  2GPS A;  1TAE A;  5EWF A;  3OSN A;  2UUB H;  2R84 A;  4O3O A;  3QFF A;  3GID A;  4F4Y A;  2VA2 A;  4UCS A;  5C4X G;  4C5A A;  3J7A K;  4LF4 H;  3TY8 A;  4O4I F;  2OWO A;  4O3P A;  4LF6 H;  5DAA A;  4JI0 H;  4YP3 A;  1M6V A;  3TEK A;  4MV9 A;  5E25 A;  2FPP B;  2W6Z A;  5KFW A;  3Q8P B;  1XK5 A;  1PX2 A;  3DTF A;  4FFP A;  3R5F A;  1TWG A;  2W7O A;  2HIX A;  5DLF A;  1RYR A;  5DG9 A;  1L2Z A;  2R87 A;  5JH7 F;  4YBZ B;  4ECV A;  2YU9 A;  3KHL A;  2COG A;  3CEB A;  3GLK A;  4WD3 A;  3TY9 A;  4DLK A;  3G6X A;  2FLP A;  4YJ2 F;  4A3B G;  1JKJ B;  1GSH A;  1ULZ A;  5KFQ A;  1P16 A;  1MZB A;  3ETH A;  4QWD A;  4ZQI A;  2CZG A;  1B6R A;  4CKE A;  3GV8 B;  4FBU A;  2DWC A;  4LH6 A;  4MV8 A;  4NXN H;  4RU9 A;  4JXU A;  3TY5 A;  2W9A A;  4FE2 A;  2NUA B;  1WCM G;  1BGW A;  1TWC A;  2BQU A;  4QWE A;  2R92 G;  2ALZ A;  2AGP A;  5GON F;  2R7N A;  3RBE A;  4MTE A;  5L9X A;  3TIN A;  5BWT A;  3LP8 A;  4JV2 A;  2JEJ A;  4DL7 A;  3AW8 A;  1GSA A;  4EBE A;  4B3S H;  5D1O B;  2FJZ A;  5D1O A;  2FE3 A;  3WWJ A;  4DL3 A;  4JUZ A;  3RAQ A;  3GTM A;  3V4S A;  2PBZ A;  1IYD A;  3RGZ A;  4O7Y A;  3BQ1 A;  4UCV A;  3GTO A;  5F9N A;  1ZHS A;  2J9G A;  4PBC A;  1T3N A;  5KFT A;  1XNR H;  2DZD A;  2PVP A;  1S10 A;  2C2D A;  3GTG A;  4ECW A;  4RB3 C;  1VBG A;  5BPH A;  2VQF H;  2HGX A;  3K5I A;  1ZAU A;  3FDS A;  5IWA H;  4JI3 H;  2B63 A;  3MFH A;  3T9E A;  3Q8Q B;  2EIY A;  2FKL A;  2IA6 A;  1UNN C;  3G8D A;  4TM5 A;  5C44 G;  3HOX G;  3I12 A;  3V6H A;  4FGR A;  5CM0 A;  3T54 A;  1B33 N;  2E2H A;  5KFY A;  4JI8 H;  1KC7 A;  4LFA H;  4PZ7 A;  5D1P A;  4BBR G;  2HGS A;  2I8C A;  1EKP A;  1DAA A;  2JEI A;  3JRX A;  5KS8 A;  3HT5 A;  2GQR A;  2FMA A;  3VPC A;  4Q45 A;  2C22 A;  4ZHQ F;  3C0F B;  4IRD A;  2YZN A;  4ED8 A;  4DV1 H;  5KX5 F;  3H4D A;  3WWH A;  4CHI A;  2P0A A;  3QZ7 A;  1EKF A;  5KFX A;  4NLG A;  4GLW A;  4EGJ A;  5J2T F;  4A2A A;  5T14 A;  4Q8F A;  5KKN B;  5LXT F;  4TQS A;  4GKJ H;  2B63 G;  1I3Q A;  5KFD A;  3R5X A;  4TVI A;  1Y14 B;  2JA5 A;  5KFP A;  2C2E A;  4APM A;  4J9Q A;  2HIV A;  4O4L F;  3CQZ A;  2J6S A;  2HG8 A;  5DIS C;  2W9B B;  3HKZ E;  2CNV A;  4LSX A;  4RZR A;  4J9R A;  2UXD H;  4HYK A;  3T9C A;  3MR2 A;  3TW6 A;  4IAJ A;  3V6J A;  3U55 A;  2RDJ A;  3SI8 A;  4HQ6 A;  3R9R A;  2R8H A;  4FBT A;  2R8G A;  2Z04 A;  3GV7 B;  2R93 G;  4UCU A;  3Q2O A;  1AN7 A;  4A2B A;  4DV5 H;  1V4Y A;  2DAB A;  5KFO A;  1R9T A;  4DRF A;  1A3G A;  3DAA A;  3TQT A;  4CE5 A;  4C2M A;  4EFB A;  4YQW A;  4JI1 H;  4MAM A;  4JI4 H;  4LFC H;  3OTO H;  3M4I A;  2E5L H;  2XCA A;  4MV7 A;  5FLM G;  2HJW A;  1HR0 H;  3PO2 G;  2PMZ E;  5KT2 A;  5KG4 A;  4DV7 H;  4ECR A;  3GTK A;  2QF7 A;  2UVW A;  3RTX A;  3EPG A;  2R92 A;  2C35 B;  2CW7 A;  5K2M A;  5KFB A;  3BQ2 A;  4ME6 A;  3WO1 A;  1KJ8 A;  3M9M B;  4O3R A;  5C8Y F;  4RUA A;  4X65 H;  5IYB G;  2COJ A;  3RBD A;  2FP4 B;  3HB9 A;  3LML A;  3MWD A;  2DIK A;  4OX9 H;  5DGA A;  2VPS A;  3H0G A;  5KT4 A;  4HR7 A;  3V6K A;  1RJR A;  2YWV A;  3T99 A;  4J0M A;  1KJJ A;  3E5N A;  3VNN A;  3TIG A;  1N32 H;  3FKI G;  1DIK A;  4JI7 H;  3RB0 A;  4NZN A;  4QSH A;  2ZM6 H;  5KFK A;  5I5U A;  1E4G T;  1JIH A;  1JLL B;  5CE8 A;  3HXL A;  3UZO A;  4MV3 A;  2WB1 E;  5KFR A;  4B3M H;  5BWR A;  1CKN B;  3GIM A;  2R6F A;  4O7Z A;  2ZJT A;  1HNW H;  5KFZ A;  4EGQ A;  5KG2 A;  3LWB A;  3N8D A;  4C5C A;  1RJP A;  1EYZ A;  4LMY A;  3PW7 A;  2R93 A;  5KFC A;  1GLV A;  5BWV A;  3VPB A;  5CB4 F;  1JXL A;  3JSN A;  1IOW A;  3LQS A;  2V58 A;  3PR5 B;  4UFZ A;  1XMQ H;  1DV1 A;  2Z02 A;  4CKC A;  2DPJ A;  1I2L A;  3TQ1 A;  3PZP A;  4A3M G;  2AU0 A;  2HHH H;  3V4Z A;  3N43 B;  4U7C A;  4RUC A;  4DUY H;  5KG0 A;  3N44 B;  2XC9 A;  2YCH A;  5EWE A;  4ED1 A;  3S24 A;  3K3P A;  3PVX A;  5CAE B;  5KG3 A;  3Q8R B;  1FJG H;  5KFE A;  1M0T A;  1RK5 A;  4X64 H;  4YR3 A;  3H40 A;  4Y8V B;  4DR5 H;  3HOY G;  2R7Z A;  4A3I G;  4DR1 H;  1K83 A;  2JA7 A;  4E4T A;  1EHI A;  4MV1 A;  4WHX A;  2HHF B;  3GQC A;  4LF8 H;  3PO3 G;  2JA6 G;  4R8U A;  4M0J A;  5KT5 A;  1I1M A;  1KJ9 A;  2YZL A;  4MTD A;  4A3K G;  5DGI A;  3OSP A;  1KT8 A;  4J9K A;  2AQ4 A;  2MCT A;  5CA1 F;  3RAX A;  5LYJ F;  3T9A A;  4ED7 A;  2JEF A;  4DR2 H;  2XCL A;  3GIK A;  2XGP A;  4DL4 A;  2EJ2 A;  2EJ0 A;  1SYX B;  2CQY A;  3M9O B;  4FS1 A;  5C3E G;  4LFB H;  4YR2 A;  4BXX G;  5KG5 A;  4DR3 H;  1IBK H;  5FNV F;  1S0O A;  2QK4 A;  4AQY H;  4F4X A;  1CQI B;  2V59 A;  2M05 A;  5KFS A;  3L2P A;  5DQH A;  3T1Y H;  4IR9 A;  3H4B A;  1HNZ H;  2ASL A;  1PK8 A;  3I4M G;  3RV4 A;  5I5W A;  3RB4 A;  4FU0 A;  3J81 W;  4LF7 H;  5KFA A;  3JSL A;  5BWW A;  3I4N G;  4TUY F;  4WBN F;  2FK1 A;  2XIG A;  2W6Q A;  1B6S A;  2FLL A;  3SGI A;  1EUC B;  3T9F A;  5I60 A;  3L4J A;  4IRK A;  3N41 B;  2Q2U A;  4RCN A;  4CKB A;  3MJF A;  1O75 A;  3GV5 B;  4IRC A;  3HOZ G;  4GKK H;  4NZM A;  1DGS A;  3KAJ A;  3LUL A;  5I5V A;  3MR5 A;  4IR1 A;  3K5H A;  3KYH C;  5HNE A;  2ZDH A;  1KBL A;  2X0S A;  4NZO A;  4HNV A;  4ETS A;  5FJ8 G;  4QIW A;  5BYA A;  5LP6 F;  5BMV F;  1BXR A;  1I1K A;  3TII A;  4CMF A;  2DPI A;  2RGR A;  1I2K A;  1W93 A;  2AGO A;  3HBL A;  4JV1 A;  3GTL A;  2YZM A;  4M7E A;  5KT3 A;  3N40 P;  4EEY A;  3FKI A;  3OHB A;  5BWX A;  1FVI A;  4O7R A;  4FFL A;  4I55 F;  2W70 A;  2VUM G;  3CSW A;  5DMX A;  3JRW A;  5FPR A;  4O7S A;  4I4T F;  2KSW A;  1Y1V G;  1IOV A;  4O84 A;  1OBG A;  4IWX A;  5KT7 A;  1AUX A;  5BWU A;  5LOV F;  3OHA A;  5L1K A;  3T5L A;  1A0I A;  4ED3 A;  1JX4 A;  3G6V A;  3GTP A;  1SEI A;  3W1B A;  4Q8E A;  4EEQ A;  4ECZ A;  3RR5 A;  1Z2N X;  2C2R A;  5FPO A;  2W6N A;  2ZDQ A;  1CKN A;  5L1J A;  4MA5 A;  2RGV A;  3PW4 A;  3R23 A;  2GLT A;  4ZI7 F;  1E4F T;  2IMW P;  1EUD B;  4A3E G;  2JEG A;  5KFM A;  4KHP H;  3MWE A;  4DV4 H;  2R86 A;  5JQG F;  3RFC A;  3T9D A;  2I80 A;  1S97 A;  1S0N A;  1N33 H;  3G8C A;  3T9B A;  4DR4 H;  5C5J A;  2R8I A;  2ABJ A;  1FKA H;  2JA5 G;  4DV0 H;  1K1Q A;  3T1H H;  5JVD F;  4ED0 A;  4O81 A;  5KFU A;  2UU9 H;  1EKV A;  2V4R A;  4J9P A;  1WRV A;  2FPI B;  5DQG A;  4DL2 A;  4LF9 H;  1KUT A;  1TA8 A;  2VR1 A;  4TV8 F;  1TWA A;  2W6O A;  4O7T A;  1I50 A;  4ZOL F;  1S0M A;  1I94 H;  4JI6 H;  4NXM H;  2QYZ A;  4A3D G;  1N36 H;  4BY7 G;  4R7R A;  5C1O A;  3FMA A;  3T7A A;  5KFV A;  4DUZ H;  4XZ3 B;  4LSA A;  5FLX W;  2F4V H;  5HBR B;  4BWS C;  4TQR A;  4EYI B;  4JV0 A;  3PW5 A;  5DG7 A;  2WB1 A;  5FD5 A;  2R7Z G;  1GO3 E;  3CVZ A;  4BBS G;  4O86 A;  1B04 A;  1KJI A;  2FB9 A;  5BYB A;  4BY1 G;  2ZDG A;  4RZQ A;  5EZY F;  1P8L A;  2WAQ A;  3PR4 A;  1DV2 A;  4HN2 A; 
#chains in the Genus database with same CATH homology
 1ZHQ A;  5D1O B;  3N44 B;  5FD6 A;  4B3S H;  5D1O A;  2FE3 A;  2YCH A;  3S24 A;  1XNQ H;  3KAK A;  1FJG H;  3RGZ A;  1M0T A;  3NC0 B;  4X64 H;  4UCV A;  4DR5 H;  1ZHS A;  4DR1 H;  1XNR H;  4JI2 H;  4LH7 A;  1V9P A;  3GDE A;  3N42 B;  2CFM A;  4RB3 C;  1WH2 A;  3RGX A;  2HVR A;  4YHH H;  4LF8 H;  2Q2T A;  4JV5 H;  4JI5 H;  2VQF H;  4GLX A;  5IWA H;  4JI3 H;  4UCR A;  4FM9 A;  4MTD A;  3BA8 A;  3IG0 A;  2MCT A;  4DV3 H;  1IBL H;  4DR2 H;  3DF7 A;  2WE6 A;  4B3T H;  2VOB A;  4RB1 A;  1SYX B;  1CKO A;  4LFB H;  4JI8 H;  1M0W A;  4LFA H;  4DR3 H;  1IBK H;  1CKM A;  4PZ7 A;  2VUG A;  5D1P A;  2HGS A;  4AQY H;  3PN1 A;  3T1Y H;  3L2P A;  4RAZ A;  1VS0 A;  3GJX B;  3JAM W;  1HNZ H;  2UUA H;  3W1G A;  3C0F B;  3QWU A;  4PZ8 A;  2HVS A;  4RAY A;  3KXY T;  4DUY H;  4DV1 H;  3NBY B;  1HNX H;  3F8N A;  1I6U A;  4UCT A;  4Q0Y A;  4LF7 H;  3J81 W;  4JYA H;  3KAL A;  3RIZ A;  3JSL A;  1BJT A;  4A2A A;  5LMU H;  2W57 A;  2XIG A;  3RJ0 A;  4GKJ H;  3BAB A;  4X62 H;  4DV2 H;  3L4J A;  1S68 A;  4CC5 A;  2Q2U A;  1O75 A;  3EYY A;  3N41 B;  4GKK H;  1GYF A;  4APM A;  4DV6 H;  4JI0 H;  1DGS A;  1Z2P X;  3KAJ A;  5BR8 H;  2HIV A;  5A2Q W;  1N34 H;  3KYH C;  2WYO A;  4E6N A;  4ETS A;  4X66 H;  5DIS C;  2VQE H;  4LSX A;  2UXD H;  3BAA A;  3RF2 A;  4IAJ A;  4K0K H;  3N6X A;  1XDN A;  4EQ5 A;  3H20 A;  2RGR A;  3UQ8 A;  4DR6 H;  5LL6 b;  4B3R H;  4M7E A;  4UCU A;  3N40 P;  1AN7 A;  4A2B A;  4DV5 H;  4LF5 H;  1FVI A;  1J5E H;  4DRF A;  2WDT A;  4JI1 H;  4EFB A;  5FPR A;  3GB8 B;  5IT9 W;  2KSW A;  3L4K A;  4JI4 H;  1IBM H;  4LFC H;  3J80 W;  3OTO H;  3M4I A;  1TAE A;  2UUB H;  1A0I A;  2E5L H;  4DR7 H;  1S03 G;  4MV7 A;  4UCS A;  3W1B A;  1SEI A;  3J7A K;  4EEQ A;  3RR5 A;  3TY8 A;  1HR0 H;  2OWO A;  1Z2N X;  5FPO A;  4LF4 H;  4LF6 H;  1XMO H;  1CKN A;  3NBZ B;  4DV7 H;  4CC6 A;  1Z2O X;  3RTX A;  2RGV A;  2CW7 A;  4MV9 A;  1E4F T;  2UXB H;  1XK5 A;  4X65 H;  4KHP H;  2UXC H;  1L2Z A;  2HIX A;  4DV4 H;  4UCO A;  3LML A;  4OX9 H;  4EFE A;  1N33 H;  2VPS A;  4DR4 H;  2UUC H;  4PZ6 A;  4RB0 A;  3W5O A;  4J0M A;  1FKA H;  4DV0 H;  3VNN A;  3T1H H;  1N32 H;  3TY9 A;  2UU9 H;  4PDB A;  4JI7 H;  3K3V A;  4LF9 H;  1P16 A;  1TA8 A;  1MZB A;  2ZM6 H;  1I94 H;  1E4G T;  3HXL A;  4JI6 H;  4NXM H;  2O03 A;  5LMN H;  1N36 H;  4B3M H;  4YY3 H;  1CKN B;  4R7R A;  4LH6 A;  3FMA A;  2HVQ A;  4RB2 C;  2ZJT A;  4LSA A;  5FLX W;  4DUZ H;  4NXN H;  1HNW H;  2F4V H;  3TY5 A;  4BWS C;  4LMY A;  5FD5 A;  1BGW A;  3CVZ A;  1B04 A;  3JSN A;  2CW8 A;  5EOY A;  4UFZ A;  1XMQ H;  3BA9 A;  4RZQ A;  1X9N A;  4MTE A;  3MWM A;  4I7H A;  1P8L A;  2HHH H;  3N43 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...