3RU2A

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadph.
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
489
structure length
489
Chain Sequence
b'MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 180
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3ru2A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3ru2A02
2XTBA 1TD2A 5BYEA 5F11A 2AJPA 2QHPA 3RO4A 5C41A 5COJA 3RU3A 2HLZA 5EY7A 4K8CA 1LIKA 3JULA 1UA4A 1U2XA 3Q1YA 4KALA 2YXTA 2YXUA 3RY7A 1LHRA 5TQIA 3BF5A 1UB0A 4K93A 3KTNA 3DRWA 1TZ6A 3K5WA 2PKMA 4EN4A 4N08A 3UMOA 3MBHA 1VI9A 3RRJA 3RSSA 3H49A 3LJSA 2R3EA 3VAQA 3ROGA 4KADA 4O1LA 4LC4A 2ABQA 3IQ0A 3RNOA 4JKSA 1GC5A 2AFBA 3PZSA 3HPDA 1VM7A 2VARA 4S1MA 1JXIA 3NBVA 4C5LA 4C5KA 1V1SA 3RQXA 2DDMA 1RKDA 1ESJA 1ESQA 4DC3A 3UQ6A 1YGJA 3ROZA 2C49A 3KEUA 4C5NA 3UQ9A 3RREA 3B1PA 3B1QA 2NWHA 3B3LA 1YHJA 3NC9A 3RQHA 2DCNA 1V1BA 3NM1A 3IBQA 4GM6A 2ABSA 3GO6A 4PVVA 3NL2A 5C3ZA 5C40A 3RTBA 5TRWA 3D3KA 3ROEA 4C5JA 2R3BA 2C4EA 1RFVA 3FHXA 4XDAA 4XF7A 4E84A 4C5MA 4LBGA 4XCKA 4EBUA 3GBUA 4DU5A 2AJRA 1V19A 2A9ZA 1YGKA 3RS8A 3H74A 4KAHA 3ROXA 4EOHA 5CGAA 4O1GA 3D3JA 2V78A 4B8RA 3RS9A 3OTXA 2I6AA 3KZHA 2F02A 4K9IA 2O8NA 3B1RA 3RTCA 2PKNA 4UBEA 4LCAA 4EUMA 3RSFA 1RKAA 2I6BA 3UQEA 2DG2A 3RRBA 3DZVA 3K9EA 3VASA 1GQTA 5CM5A 3RTDA 1RKSA 3UMPA 3RO7A 1EKQA 3NM3A 4WJMA 4YL5A 2AB8A 4LBXA 2A9YA 3NL3A 4X8FA 1RFTA 3QAIA 4S1IA 3QA2A 2HW1A 4E69A 3RQ8A 1WYEA 3GO7A 3RM5A 5F0ZA 1KYHA 3RQQA 3RPZA 3RTAA 3B1OA 3BGKA 2HQQA 3PL2A 4K9CA 5CGEA 4YWRA 4N09A 1EKKA 1TYYA 2QCVA 1BX4A 3HICA 1JZTA 3RQ2A 2DDOA 3NCAA 3W4SA 4KBEA 2F7KA 3RU2A 4K8KA 4K8TA 4U7XA 4JKUA 3LHXA 1LIOA 1RFUA 3N1CA 3RQ6A 5BYFA 3RTGA 3Q92A 5BYDA 4E8WA 3IN1A 3ZS7A 4KANA 3UQDA 1C3QA 3B1NA 2AX3A 3RRFA 1LHPA 2I5BA 4B8SA 5C3YA 3IKHA 3IH0A 3KD6A 1L2LA 2Q5RA 5EYNA 3RPHA 3IE7A 2DDWA 1LIJA 3RT9A 1LIIA 2PKFA 3EWMA 1RK2A 1DGMA 1TZ3A 3I3YA 3RT7A 1V1AA 4S1IB 4XF6A 2PKKA 4JJPA 4K8PA 4E8YA 3RQ5A 3NBWA 1JXHA 3RSQA 2AWDA 3UBOA 3FHYA 3HYOA 2JGVA 4E3AA 5B6AA 3NC2A 3NL5A 2JG5A 3CQDA 3MBJA 4S1HA 2AA0A 3RTEA 3LOOA 5BYCA 3RSGA 2RBCA 4E8ZA 2JG1A 3NL6A 3LKIA 1VK4A 2FV7A
chains in the Genus database with same CATH superfamily
4Z0TA 3K71B 4KVGA 5KTMA 2YOGA 1P4JA 4MCIA 3DLHA 4HZGA 1CRZA 1EG7A 4XPZA 4MA4A 2CJYA 4X94A 3WMWA 5CTJA 6GPBA 3FRHA 3R7NA 3QFHA 2WTEA 3CYFA 2DWQA 3QXSA 1TNDA 2B1IA 3ROTA 1WZNA 4K6OA 2H1FA 3ZHSA 5BV2P 1X74A 4B85A 1PGPA 1N57A 3OPYB 1ML3A 2OV6A 1Q83A 2WM9B 4R9NA 1AUXA 4JYZA 2B6NA 3TR0A 3WGIA 1CUEA 4WFQA 2FZ4A 2JF0A 3H42B 1KOLA 3I2KA 5TPZA 3TSOA 3L92A 3SJAA 3KSBC 4Y2VA 5E3HA 3RAEC 1NW6A 1PV1A 1MG0A 1RYDA 3HC7A 3GUHA 4WMLA 3OH8A 2R11A 1HH4A 5AW9A 2Q4OA 1LW6E 5EY5B 1E6LA 1G7TA 3NIBA 4IJ6A 1BO6A 1JG6A 2E89A 2I67A 3INRA 4G0OA 4H17A 3SK0A 1O94C 4YV0A 1WB6A 1J6UA 1ZH0A 5TQ2A 1QNLA 2BGNA 3OOWA 3JARA 2F4VB 5JAZA 3NHFA 1OX6A 3QCZA 3ZC3A 1KMNA 3I53A 4UZSA 5DI3B 1JJAA 1Y3DE 4UUNA 3BGVA 3NL2A 3WZMA 1K5HA 4GPAA 5I9NA 3AO0B 1WXQA 2CJFA 3QUSA 4N5HX 4MR7A 2ISCA 1I8TA 4MLDA 1B6RA 4NH0A 4G5HA 3A1DA 3PRJA 4RTRA 2WTNA 3UK0A 5IAEA 3VYVA 5DM70 2UU9B 1AX9A 1UBFA 2G1KA 3EGXB 5TVGA 5AI4A 5KYWA 4P5PA 3TLXA 1F5NA 3AB8A 1USWA 3RSFA 1EXDA 3BK2A 1AHNA 1H1LB 1O7JA 4TUYA 2DLCX 1DC8A 2PL5A 4OBXA 4RKQA 3ZBTA 5C34B 3L49A 1F8XA 1TUBA 2QRHA 3DLCA 3ETEA 6LDHA 4CLHA 5JBIA 3BE4A 4C3ZA 2GRAA 4BRSA 1NTRA 1V6SA 2GAFA 4IDOA 5L4NA 2PKRA 1KWKA 1K97A 2OAP1 3PA8A 3RVJA 3D59A 3IO5A 1U0GA 2G67A 3P2EA 2BBWA 4HPWA 4GNRA 2IIBA 2RGNC 3EMVA 3JU3A 4JOQA 4TVOA 4E5SA 1ISIA 1KRHA 2O5EA 3E61A 4DA0A 1AKUA 4UVDA 3IEUA 3RSHA 4N48A 2XMDA 1W93A 4NNPA 3ZBPA 4HEQA 4KRFA 4ALKA 1QP4A 2GCEA 1KKMA 4YXWA 3BWYA 3IOEA 4UAJA 2SECE 3OM9A 3T5DA 2CVFA 4FMCF 2P79A 4IMRA 5BVHA 2OMKA 5LDGA 1M6HA 1AD2A 4DNXA 3VU9B 1PWZA 2IYNA 3A8TA 1XR3A 2I78A 3C97A 1SCBA 4FIDA 1GTG1 4EYQA 1HPLA 3IR6A 3FOEC 4MUIA 2KHZA 3RM3A 2VPTA 3GW8A 1JR3A 1XRRA 3STWA 3VKVA 2ZXEA 2ZSHA 3F4KA 4NFHA 1USIA 4F4HA 2JCXA 3EFOB 3TB4A 3ZU2A 3A1WA 3PA6A 3QYAA 3EVBA 5JJKA 5A2QA 2G4VA 2YWEA 1M1ZA 3CW2A 4QATA 4FYHA 4FEGA 4U39A 2PM8A 4YGYA 1S3GA 4XIJA 4CCYA 1IBLB 4RSRA 3GZNB 5DCLA 2GNAA 2P27A 4NXMB 1E9RA 3UJNA 2QPOA 3EGDA 1MC8A 3NUGA 4AKSA 3JZIA 4LJAA 4LVCA 3G5MA 1E1LA 3AGQA 1ZLYA 4KVAA 3C6BA 3HLTA 4GLOA 4GMXA 3M2TA 1NBAA 5BWNA 4XD7A 2XCTB 4PZPA 3N86A 3QU4A 4KE7A 2OMEA 2R25B 4RY9A 2X9VA 4HNRA 2EU8A 3NOQA 4XCVA 1QQ7A 3TPCA 1HEIA 4D96A 1KOGA 1TAQA 3WRWA 1QSGA 2VLIA 3FGOA 4JGIA 4KJZA 4KQ1A 2ENWA 1Z5PA 1F0PA 2AUMA 2RGEA 1JKIA 2GAJA 2WZCA 2ZRFA 4ID3A 4EVRA 5K0EA 1KI3A 4UQOA 5K0NA 1CEEA 1NW7A 1OPRA 3IEIA 4EZBA 1ESCA 1IXYA 3RS5A 3JAMA 4HT3B 4ZQHA 3S3TA 3L7OA 2E4XA 3ISJA 3QLVC 2OFFA 3X0DA 1RYNA 1SULA 2FPKA 4Y9UA 1QRDA 5CG2A 5E6UA 2IYPA 1P7ZA 1RLMA 4PX2A 3TR6A 1X86B 2F3UA 2GYVA 3K20A 1T2FA 4MLCA 4I50A 1C7RA 3ZDXB 4I1IA 4UU7A 5EIEA 1FVXA 3A2LA 3HWSA 2OBMA 3N3AC 5REQA 3RQSA 2Q3EA 5BW8A 3RTBA 1NBMD 3G13A 3EULA 4U6NA 3U13A 2I4MA 1AZLA 2B6HA 3L41A 5LYYA 4PR0A 4FFSA 5C80A 2YFKA 4HDAA 2WIBA 2WJHA 1T9DA 1K88A 4NR0A 2NLOA 1NQVA 3FBTA 3H5AA 3ZE8A 1MCZA 2SKDA 3E3OA 3JQCA 2UYHA 4WKGA 1ZISA 3R5TA 3E5HA 3UT5B 5CA1B 3WWCA 4MWEA 1H6AA 2R48A 4X63A 5LDHA 1N3YA 3K9EA 1JHZA 2BN4A 1M3SA 1VL2A 2OXCA 3HM9A 2N46A 3R5SA 1T1JA 1XAGA 2Q0QA 2UVPB 4MS4A 3FTNA 4YBZA 2DB3A 3GLUA 5T41A 3WLPA 2CL5A 3O3CA 4Y6RA 3RM5A 4B40A 3NATA 1OBHA 3IUBA 4N7RA 5PGMA 5J63A 1DJMA 1WV0A 2JI8A 1GL6A 2X76A 4N6NA 1WXXA 5K0TA 1TYYA 4G5RA 4GOJA 1JKJB 2DDOA 3VSEA 1NF8A 3LL4A 3AUKA 4GZMA 1L4EA 4ZAXA 4CEIB 1V48A 3RKUA 4GZLA 3UAGA 3LA6A 4KDFA 5FAKA 4U7DA 2IXAA 2VQEB 1F2DA 2G1JA 2Z95A 4OQZA 2IEYA 3EPPA 4MW1A 4B5KA 4ZXPA 4EB0A 3I61A 3HL4A 4ON9A 4H7DA 1XROA 4BMYA 4M0CA 5CT5A 3ANTA 1U3FA 3I28A 1W36B 1IN8A 4MV4A 1IWOA 1DLJA 2QQ5A 5F12A 3DBHB 4OAOA 2Q7DA 3ZE9A 4RHTA 4S1IB 4A0RA 4JS0A 1KO8A 5BV7A 4B6QA 1Y7IA 1CFZA 1X9IA 1XVLA 3KT0A 4MPRA 3I52A 2P9TA 3C3PA 1T9HA 2LIVA 2LR0A 3U7FB 4J7AA 4A3SA 1RSZA 5AVTA 4DXAA 1TXGA 2R8RA 3NC2A 2RKOA 3WYNA 3H8JA 5SZKB 5JALA 4RZQA 3CUEF 3NCTA 4WFIA 4LK3A 1IN5A 3A3KA 4J1TC 3T34A 4B32A 4EB8A 1ZR4A 4LJ6A 4F96A 1VQ1A 2AI2A 3SD7A 4KIWA 1WB9A 4AJJA 4N7BA 2PWAA 3BXEA 2OHIA 4BQQA 3FRIA 3LWDA 4UPVA 2J45A 2YV5A 1T9BA 3DEYX 3NEYA 2B82A 4JVNA 3W9SA 3ZZNA 1A76A 1R4NA 3OETA 3STUA 3ZWAA 4D9GA 3PLRA 2I6QA 2NSHA 5C18A 1H8HA 2Q07A 4LEIA 3BORA 4MVCA 4WOPA 1I2MA 4UQPA 1Y33E 2ZR7A 3VAZA 4N3AA 2I2WA 2NSJA 3U62A 3IKLA 2CMKA 4C0LA 1VPWA 3BD9A 3HGQA 1KC3A 1T2CA 2ZSIA 4Y6QA 3N2LA 3SLKA 2YV4A 1UJ4A 1ID1A 5ECWA 1G5IA 1RBQA 1XTSA 2C3YA 2ASVA 4XDZA 4LMPA 1OX5A 4QXOA 3ZQUA 4JI4B 3FSGD 3U7GA 1I7QB 1GGNA 4AN4A 4RZIA 2FPWA 3QHAA 1LRLA 1Q74A 3CN7A 4ITUA 4TTTS 3GOHA 5AVRA 3HRKA 3QOXA 5B4UA 1NBEA 3DLBA 4V0OA 5EHXA 5K09A 3IBQA 4TV8F 2VP3A 3EVAA 4DG5A 4Q66C 1A2OA 3BXOA 1G8HA 4RIIA 1RAEA 1UXJA 2GPYA 1YI8A 3WJ2A 3IUQA 1CZLA 3LL7A 3RBXA 3GBUA 4PSCA 2QTLA 1T43A 3E6AA 2A9ZA 4X95A 1FTYA 3MTBA 2CVOA 4ZO6A 3UJ7A 3CFYA 1YRBA 4RS3A 2H57A 1R8XA 3IMGA 3JS5A 3SDSA 1TE2A 3MILA 4D2IA 5JQGF 2PKNA 4EBBA 3AF6A 3KB6A 3T8YA 1XD2B 5K8VA 4EUMA 3OIUA 1QHXA 2OUKA 2RKBA 1FFEA 3DMDA 1G3IA 4M1SA 3RTDA 4HDMA 4C0HA 4BECA 5J5VA 4AT1A 4C7OB 5M7EA 1VCHA 2CMDA 3MN1A 1JKXA 1WCV1 1SUAA 3VV3A 3BCSA 1DMSA 5DBHX 2R97A 1JLHA 4BV3A 2OAEA 3HP1A 1I9CA 2M6RA 2R8BA 4FW8A 5JTUA 3BMNA 3M6MD 5C1DA 3GGOA 1F2VA 1EFDN 1G42A 2GA9A 4R54A 2ST1A 2H2GA 2JHCA 4TMKA 1OT3A 5A0FA 4ZYZA 1IQUA 1EFLA 3QXJA 1Q84A 2GN9A 2YV2A 4JQCA 1XZGA 2P1DA 3B53X 1E2IA 1ZAKA 3I6IA 1XZCA 4AWBA 2R2AA 3MUOA 1C8LA 3ACCA 1K98A 3Q92A 1V2GA 3KT8A 3SYLA 3GT3A 2AF4C 1EVEA 2PZLA 3LX8A 4FE4A 4YEDA 3EASA 1DEHA 2IP4A 2PGAA 2Z2YA 1YIDA 3LAWA 4DIBA 4JXJA 3CVUA 2ZJ1A 3SHTA 3R75A 2HSJA 3LWNA 4MP8A 4RH1A 3IE7A 2PA0A 2PZKA 2C4MA 4XIFA 5HS4A 3GN1A 3U6BA 4MDFA 4BO9A 3GFRA 5AOBA 4CIXA 5JNUA 2OLJA 3USCS 1T6XA 3Q3EA 4X7BA 1D2GA 3BHMA 3FWPA 3N0RA 4MZDA 3IAM6 4A4DA 1I5RA 3HKCA 4KR9A 2QRVB 4S12A 1K7EB 1VHWA 3L0PA 3O8OB 3WGGA 1WAMA 3DCIA 4GECA 4Z7JA 3JQ9C 3M1AA 2G07A 2I54A 4LXUA 3TLAA 3IP7A 2IS1A 2IHYA 1DRKA 1NT2A 2R79A 2YASA 4UOQA 1EXVA 1HEYA 3WWPA 1XZDA 2DOKA 3JULA 4QRIA 1UKBA 1PU2A 2XE7A 3GEGA 2NXCA 3NDJA 2YJ5A 1FCJA 4RSHA 1OXTA 4MARA 5B1DA 3EUAA 5CB4A 5CFMA 2D1QA 1ZQ9A 3DTVA 3MJ4A 4PV7A 5LD2B 1ZHHA 1QTQA 4CVMA 5KHLB 3FWHA 5J1SB 4MV8A 2ZLBA 4M8NE 4MVJD 2AHRA 1SOMA 5EKDA 3C7DB 4REQB 1OV6A 1MAUA 1B3RA 2P9CA 3S1LA 2JFPA 5KX5A 2J9XB 1I0LA 3EXG2 4G5GA 1Y9DA 2H3HA 4M0DA 2NO9A 2GASA 5HKLA 4O1LA 1JSZA 1OWMA 1ZUNB 3FDZB 2XTAA 1SM4A 3K9GA 1HLDA 3D4PA 2B4YA 3G2HA 3OJ0A 4O33A 4F4IA 3EPKA 3T7TA 3TYXA 1OGYA 1HT1E 2YZKA 3N76A 1GO2A 2COUA 3ELUA 5GQSA 4X1KB 1PR4A 2OBLA 4MUAA 4TUYF 2WIGA 5E38A 2QWXA 1ZL0A 2XI4A 3C70A 1OIWA 1RLIA 2G36A 3M1YA 5BOSB 2VAPA 1NWHA 3PD7A 2QSUA 2YN2A 1A2KC 2LW7A 4MV6A 2M2IA 1YK0A 5AK0A 1T5TA 2PWPA 4C5JA 1GZ4A 2G6BA 3LHDA 3OTWA 3UCFA 4XRGA 4Q93A 3ET4A 5AQ1A 1O03A 2EWWA 3AETB 3BSWA 3HCFA 3K8QA 1HT0A 5JDCA 2N75A 5EIOA 2B34A 3FCEA 1OZAA 4I6EA 4V03A 3VUFA 4RIFA 1GZDA 4JJAA 4YMVA 5JMPA 3VPBA 1UPBA 4YQYA 2PSHA 4C0KA 4UNQA 4HVLA 4YMLA 2WM2A 1OCEA 2I4OA 3R6DA 5I8PA 1QFJA 1WNFA 1LJLA 4AZWA 2XCUA 5E7JA 4IQ8A 1COWA 4N7MA 2Q21A 4AIIA 4GRAA 3JYHA 5EPOA 2FEMA 3GRYA 3WGHA 1E1YA 4JCOA 4RTQA 3HKBA 3ZDYB 3PYLA 4BXOB 4Z4IA 3OC0A 1U99A 1DFHA 4TRMA 2PEZA 5JAIA 3BXFA 2PSFA 4FHEA 1WWKA 3K3PA 4K9PA 4QHYA 3BGKA 1C3XA 4LWPA 4ZVVA 1BWPA 1M6YA 2BTOA 1OWPA 2AUTA 1QAMA 1V96A 2CZGA 1K92A 1C1XB 1JF8A 1HY3A 4JLWA 5TS2A 5K03A 3PRYA 3JQRA 3K92A 3OEEA 5IDVA 3ND5A 4WK2B 1X1CA 5ED0A 1NV8A 4LE2A 4ZK6A 4UTPA 5BYFA 2OOKA 2ZUTA 3DHYA 4RELA 5FD8A 3VR5A 3TCXB 2PE5A 4M8KA 4RM2A 1U8ZA 2O54A 3W7AA 4W1RA 3BN3A 2XYPA 3OCYA 1TZ3A 1G20E 3AEQA 2HSDA 5KNBA 4J0KA 1WKVA 4CR6A 4YREA 3AR7A 4HMOA 4N5NA 1IOLA 1Y7PA 3KOOA 3R5JA 1QO9A 3AESA 4BLOA 4C4OA 1NUTA 1QYDA 2PUTA 2GNOA 4H6VA 3T3HA 5JZOA 3EODA 3LXMA 3HGTA 3SYKA 1H1TA 1Z08A 2CXHA 4F6LA 1RJWA 2ZWPA 3DSRA 3GD5A 1LVUA 4DNOA 2V9ZA 5D5PA 3UFXB 1Y8RA 3PT5A 4LHYA 1QP7A 2R751 1YH3A 3R7AA 3FMFA 5EJ8A 5IVPA 4QUAA 4GPIB 3L0BA 1O5OA 2F1RA 3CUVA 1MMFB 5JH7B 4PO3X 4XLTA 4F3CA 3W9YA 2QV0A 1EFHA 4F4DA 5CIYA 2AEJA 3BHNA 5JXWA 4GKJB 3WNVA 1NNLA 1F3OA 3ZLUA 4ALIA 1HDXA 3RHZA 4FFBA 5LQMA 4E08A 3WBBA 3A4VA 4DVJA 3L8DA 2KM1A 2QN6A 4FOOA 5CB8A 2NV2B 4D1YA 1X9HA 3NHWA 2NADA 5BV0A 4ND8A 3ICOA 2J33A 1PW7A 2VF7A 1O96A 2IV2X 1FK8A 1Z2NX 2D8AA 3E0XA 3EIEA 3PHBE 3ECSA 4U7PB 1SB9A 1D5CA 1XEAA 4FUQA 4TT3A 3G1WA 3LX4A 3IPAA 4OVKA 5FHQA 4CV1A 4CG2A 3PXGA 3L02A 4N5DA 5JROA 3TD9A 3O94A 2Q5JA 3R0ZA 2C31A 4HCJA 1QRAA 1FVFA 3EDMA 4KQGA 1Y0BA 3KTAB 4YMUA 5I4CA 3Q7PA 3RREA 1XTVA 1RPTA 3DFZA 1R4MB 3LKZA 4ND1A 2XCIA 2XBUA 4DFDA 5IDYA 1DU4A 1IG3A 3C8UA 3C3EA 2OAGA 4Q18A 5K20A 3DFIA 3GLGA 1MC1A 1I2DA 2HUNA 1VSQA 1Z4PX 3TNYA 1ZS9A 4K9DA 4DIDA 2ORIA 1DZ3A 1ULHA 4E07A 1K2VN 3HB4X 2QF7A 4YCBA 4ZCLA 3GDWA 1XAIA 3L5KA 2D0IA 2AM2A 2DSTA 4EPWA 5H81A 1IAVA 1V6CA 5D8DA 2Z5GA 2VORA 1PJ8A 1CRLA 3A9UA 2IVZA 1NGSA 5HPYB 1L4LA 2I6BA 4Q01A 1Y82A 2AJTA 1TTQB 2E7ZA 3OLZA 5CLHA 4OXQA 1DAEA 4MRSA 4C7MA 2XVAA 4PHFA 4YAWA 3R74A 5KVVA 4KWTA 1UJMA 4MW9A 3QBTA 2VRCA 1WNTA 4QVKA 1GAWA 4RJIA 2VQSA 1ORDA 2H31A 2O14A 2ZBFA 1QDLB 1ULBA 3FLAA 3OQVA 1EFVA 1B73A 3AHHA 4KSYA 1N5KA 4KRYA 4P36A 2PO7A 2NU8B 1KKLA 4IZHA 5T6MA 2FKNA 3T1OA 2IEBA 3T9CA 1A8QA 3CC8A 4F5WA 1MR3F 2RGBA 2WVAA 2AM1A 4I1RA 3ZHOA 1QV7A 1NLMA 2C8KA 1CVLA 2LV8A 3I9JA 2AWNA 1VMIA 4O4LA 2JKYA 1V3UA 4QNRA 1KU0A 2G5PA 1RYYA 2P0EA 2QD1A 3QQPA 4LTMA 5LA6F 5FFFA 3X3HA 5B1HA 2V1UA 1WV1A 3II6X 5K3CA 3URMA 1HSOA 1TPZA 5EP2A 1S2IA 1IXKA 5G0UA 3H1PA 3ZHBA 1W76A 2NO7A 3C1OA 3D8SA 4RANA 2ZVPX 4FGUA 5C3ZA 5HVNA 5ARCA 4CLDA 1PKXA 3LLSA 5U9CA 1X7DA 1YB7A 3OIFA 1UK8A 4B9EA 3JYLA 2GB4A 3R3WA 1U1CA 3LBYA 3KQQA 1LVGA 5ALXA 1E61A 1HDYA 1F60A 1UXIA 2PNFA 2ZTSA 3JW8A 2R00C 3QLUC 4CN9A 3FYDA 4DE5A 2NV6A 2MSLA 5BUQA 4BO5A 1V6AA 3O8LA 4W5NA 2X2EA 3WIBA 2X1MA 1DXHA 1RI4A 2C2YA 4AN0A 2Q4DA 3D0OA 4IQ0A 3UA4A 5LQUA 2UUAB 3L8FA 4LDQA 4QDKA 4DBLC 2A9PA 2HLZA 13PKA 2QM7A 3VPSA 2MSEB 3B6KA 3ZZ0A 2FR1A 1OAOC 4CPDA 2HRCA 1CDEA 2WAAA 4EW6A 5ICCA 2QX8A 1U7DA 3QITA 2DHCA 4AJ4A 4D9EA 3CLUD 1B4DA 3DE0X 4K87A 4KN9S 4KXXA 4UBLA 1GYPA 3GA0A 2B0CA 1YXMA 4QX6A 2XRMA 3AVVA 3KYDA 4GIBA 4RVOA 4Z6KA 1Z4NA 1V5GA 4V0MA 3MK31 4EECA 3HCCA 1WD5A 1YR9A 2I4IA 1E79D 3DD1A 3GA7A 3NO4A 3THXB 4Q4CA 2XOKD 4DCPA 1QQAA 2BM8A 1JR4A 3D8RA 5B3JC 4QKQA 2OXRA 2YFYA 1D0SA 3KJZA 2IUEA 3RYFB 5JASA 4BFLA 4PAMA 4L02A 4BP1A 4CL2A 3PX2A 1XYYA 4YJHB 3SJCA 3I2HA 4R16A 2X86A 4L9WA 4RF4A 1BVHA 1DGQA 1QHEA 4WHMA 5FOXA 4JJ6A 2XNDA 3OFVA 3UQ6A 4YDQA 1E4EA 5MDHA 3F47A 1KEVA 4K8RB 3HKDB 4JLJA 2OVBA 2WBLC 3KPJA 4E2FA 2BGTA 1AJEA 2PFSA 1U1EA 3VZDA 1P81A 4YRQA 4PN3A 3SZOA 1OBCA 1NG9A 2ABSA 4U3JA 1E5XA 3RFTA 3AL3A 1CBUA 3GJ7A 4XEUA 2HBYA 3FPHA 3RODA 3MJVA 1ZK0A 1M6VB 2OSVA 3FHXA 5DT9A 5AK3A 1UK9A 2BZ1A 2MSKA 2XITA 4MVJG 2B4AA 3RBVA 1W5AA 1I6LA 3B2QA 1D0IA 4HP8A 5KINB 1W6RA 3SXUA 1BX0A 4WKOA 5CM8B 2HLDD 1QG4A 3AJ8A 3E27A 3UEOA 1DT3A 4OGLA 2GESA 4X91A 4B7AA 3LDAA 4BZWA 3ZHRA 2X9LA 3GJRA 3B1RA 1D2CA 5KYYB 3NNDA 2HCFA 2JFYA 3IPXA 2FUKA 1YUMA 3ORYA 5DTJA 3TOCA 4PR3A 2WUVA 4C1NA 1AY0A 3OO0A 5DBEX 2R8ZA 4V02A 3B70A 3NTLA 3JATA 1OXVA 2DFPA 3UB2A 2RGAA 5A4KA 5LPNA 5EJ6A 4IDEA 3RQ8A 2Q8QA 5I7EA 1AKNA 5CIWA 3O3NB 4F5DA 4Z7OB 1M5TA 5A3QA 4YPFA 1CPYA 4C2AA 5F2NA 4QU9A 4LJYA 4QLBA 1D6NA 1SVUA 2H2AA 4G1UC 1RRKA 2Q50A 2V7UA 2PWYA 3GYBA 2R7MA 4PGMA 5HZKA 2PL1A 5KDDA 2YXEA 3F3MA 4JL8A 3ABZA 3FSJX 5F2EA 3SS8A 4DZTA 5JLJA 1MHTA 2O59A 3S1AB 4N7JA 2Y27A 2A5DA 4H0FA 4QPJC 5KKAA 1UR5A 4CWAA 2OFOA 3ZWQA 2C5FA 3EMBA 1GPKA 4QXQA 4GH5A 1Z4LA 2J0UB 4MS3B 3M82A 3SFZA 1S5PA 4OYHA 2Q5RA 2CUTA 5DJ5A 1PFYA 2ZRBA 3QP9A 4KSBA 4JYBA 1JEEA 4QEZA 4R7ZA 5CB4F 1RZVA 1QO7A 3MT9A 3ODGA 3WWZA 3KUCA 4MVXA 3HA5A 5H16A 2R60A 5ITSA 2AWDA 1LLUA 2GBPA 4QUGA 4ER3A 4QZVA 1FDTA 1P1CA 2DH5A 2ZIAA 2WHPB 3C3AA 1RXSA 3CEHA 3HU5A 3IT0A 3O21A 4G37A 5LB4A 4B7ZA 2ZQZA 1DAOA 2Y1FA 3ENVA 4G56A 4L8GA 3DYBA 4P35A 1PF7E 3LWBA 4YX9A 4LSZA 5C1PA 5D3KA 5JECA 4JXXA 1LCIA 4JT9A 1GZSA 3T7JA 2QAJA 2IXBA 3F5DA 1RHRA 1DXOA 3INTA 1UPUA 1X7GA 2XMRA 4OHFA 1N5JA 3QELB 1N2BA 1UC8A 4BFXA 1XCLA 5KHAA 4QF5A 2IBTA 4Q7EA 1NW5A 1ENPA 5I7WA 4WY5A 1XU7A 2AKAB 2AG1A 1XRNA 4KK4A 5F7ZA 3BAFA 3BTOA 3WMFA 5DSTA 1UL1X 3S99A 3TG2A 1CJVC 1AO3A 3WL4A 2AMJA 4I3HA 4L9RA 2A1TS 4O63O 5G1PA 5GONB 5F3RA 3VSAA 2XV1A 4KP7A 3ZEAA 4A2PA 2PZBA 1QKJA 2CFRA 1EJBA 1E5QA 1FNMA 3HN6A 2LKDA 1NMQA 3C24A 2HTEA 4WNYA 4A10A 2JLYA 1CRWG 3GJTA 2ODEA 3KB2A 3KZVA 1APBA 4IS2A 1T3SA 3KSZO 2GTIA 1U98A 4IGAA 3RFUA 1MENA 3T38A 1D1SA 5DNDA 1LTKA 2EGGA 4DB2A 4PTLA 1W5EA 4AROA 1NP3A 2C1XA 5JU6A 3TAHA 1I4WA 1OH5A 2GD2A 1O87A 1UK6A 1T36A 1DO0A 3FI0A 2K5UA 3ML1A 2P4HX 4ARZA 3DBRA 3EF0A 3T54A 4ERXA 3DT8A 4OYLA 1QFMA 3RB8A 2ORYA 2WQ7A 3M6VA 3HJUA 3MAJA 1A69A 1CUWA 3PGVA 4ABTA 3JZDA 4MTLA 4YP1A 3H74A 3R0XA 4JBHA 4ZYTA 4OM8A 1BEEA 2YWBA 3IIIA 2AOTB 4OL9A 3FOZA 2G80A 4GOMD 5CGAA 5HJ7A 2ZUCA 3SKYA 3CVWA 2B4QA 1PGQA 4MPDA 2FRDA 1JDVA 3OZRA 3HH8A 5FKJA 3UMPA 1FE8A 4IMIB 3HZHA 4WUTA 1DE0A 4R1LA 5DT2A 3NG1A 4FI3C 2A1IA 1F8GA 2FWIA 1NA5A 1R5OA 1Y9EA 1T24A 2Q9UA 3PI7A 3DMFA 2HF2A 3RTAA 3OEYA 2WWXA 4X6LA 2QIPA 2ODQA 5A7HA 1WSDA 4JBYA 3R5XA 4KQJA 1QHFA 221PA 5TMDA 5JYDA 5KPDA 1L5WA 2UUCB 1TJPB 2PBZA 1N7IA 5EAIA 4GP9A 4Q1BA 2WLSA 1NT4A 1ANKA 4NESA 3N2GB 1C1HA 2JI6A 3PD1A 5E1MA 2C58A 4IMPA 1R6XA 4JLVA 4J0DA 4RLFA 1Y9JA 3M1LA 5E8JA 3HHEA 2RKWA 1U81A 4EHJA 3BRWD 2DWPA 4OHXA 4BNGA 4CM9D 3AY0A 1BCRA 2GERA 4FJ2A 1KWGA 3WQQA 2IA5A 4A73A 4CLRA 5CLFA 3GMIA 1FTWA 1M9NA 2RAPA 1JJ7A 2BGIA 4BBPA 2UZAA 2QNIA 4GRIA 5A4JA 1GA1A 3E15A 4CVLA 4UBIA 5LQCA 1KETA 1A8IA 3V8PA 3GA5A 4JI0B 2A14A 5L4LA 2D7CA 4NHOA 4US2R 1QIKA 4NU5A 4OHUA 1JHYA 1BJRE 2GPTA 1ITZA 4ZRMA 5G02A 2XCSB 1EWTA 4RPIA 2I4RA 4NRDA 4WN3A 5F9HA 1QH8B 1VCMA 1Q57A 2PLWA 1O9GA 3DW1X 4LIPD 4WA7A 1T9CA 1TU3A 4EMSA 1GUDA 3AG5A 4LYAA 3UMBA 3DVQX 3QX7A 4IRXA 1AKWA 2RK4A 3RY7A 4OQMA 5D7BA 1CJTC 1P2FA 2YXNA 3E03A 1VIYA 1P9NA 1VJTA 2LGJA 4MUEA 3AX6A 2IPMA 2YJTD 3N1UA 4QUHA 5CT8A 3TGLA 1E1RD 2ZBEA 4WE3A 5LYJB 1P9RA 5DULA 3WOHA 3BHJA 5DTEA 1PKEA 1D0VA 3TSZA 3ZJYA 4PLTA 5ARBA 5SZJA 3QU2A 5L53A 4QXAA 3ZQ4A 5HIKA 3M83A 1ST3A 5TARA 2CW5A 4BKQA 1MNQA 5FQNA 1GZ7A 5T67A 4E1BA 4P3NA 8GPBA 3G1UA 4WZZA 5CDSA 4XRRA 3F67A 2INGX 1R5BA 3E22B 4IHKA 4NF2A 4C5KA 3KL4A 1V1SA 2BGLA 3OCVA 3UZUA 1AXEA 4F3KA 2AWOA 3QFTA 1GNTA 1QBKC 4QNMA 1SXJA 1IUPA 3BIJA 4E3WA 1IQPA 1QRTA 2NGRA 5DW0A 1LBSA 5BN4A 3BDAA 2VP5A 1JPUA 2I76A 1C1DA 4B87A 1E6WA 3DVLA 2OY0A 1MDBA 3HXKA 5EIBC 3IUNA 1AKVA 1IJFA 4BN0A 1X7YA 4DM4A 3ZDRA 1CW2B 4Y0NA 3SZRA 1XA3A 3RUIA 4G4JA 3EOZA 2VHJA 3TQTA 2B35A 1A8PA 2IPOA 2C29D 3CO5A 3K32A 4PLPA 4H9GA 2VTBB 1XVTA 1OIXA 4HX9A 4B0OA 3QVGB 3E1GA 2FDCA 1CF2O 1X92A 3EAGA 3HSYA 4O4LF 1KSGA 4LMRA 4ENRA 1GDTA 1VYVA 2PEYA 2VHEA 3UQEA 3A3YA 3DV9A 2SKEA 5L40A 1DT5A 3B6JA 1P91A 3HMQA 3MGGA 4WZAA 3HVUA 1J49A 4B31A 5JPDA 1PR3A 2P35A 4W8GA 1JEJA 1BKSB 5F1YA 1H94A 4M1OA 4C87A 5G53C 4K0KB 1E99A 1H2EA 2XWPA 3KV3O 3KZOA 1FPMA 1U0SY 2R6CA 4PZCA 4GKAA 3WGOA 2P2NA 3S8EA 1QWSA 1VFPA 3E9ZA 4L9AA 2FHSA 1E8NA 2O0JA 4HEA6 2FRXA 5DNCA 1L5YA 4CR8A 1D2NA 3A4MA 4U2CA 1JEAA 1QPBA 2R4QA 2FV8A 2PPVA 4RQTA 3MMNA 2IZOA 4LY0A 5ICSA 4BNYA 2XTMA 5B7NA 3COZA 4UATA 3PXUA 4M8LA 1AKMA 3U5ZB 1KO4A 4MULA 3WLSA 3ABQB 2NWQA 4KV7A 4OLJA 4I1UA 2FGKA 1MO2A 1EG2A 3SM9A 2HRBA 3O92A 2OV2A 1JVBA 1KYZA 3A04A 1Y4SA 3KYBA 3JVIA 4GI2A 4UW9A 3RT7A 1DGMA 4DQUA 4CGYA 2A1TR 4Q1FA 1EJ6A 1WO8A 1JWAB 1L5HA 3IQZA 4FHFA 2BGGA 1O9BA 1NULA 3AEYA 3PFNA 5EZ6B 3PEUA 2XW6A 4IRUB 2DBRA 1OH8A 1G0OA 4M0PA 2P8JA 2PJDA 4RV4A 4AF6A 1OVGA 3MWDB 3B9BA 3MSXA 2I8AA 3LF2A 5DWVA 4MEAA 1ZESA 3RGGA 3V2GA 4JKSA 1Z6XA 1TW3A 2J41A 2OP1A 3O1HB 3NWEA 3VR6D 3A28A 5KNDD 4OV6B 2C5GA 4F2PA 1HE5A 1A9XB 1FFBA 4GICA 4CLOA 1T1GA 3PHGA 5A1TA 2GEDA 1G21A 4QYIA 3ZIAA 3NNSA 4P2BA 3W8NA 1XQWA 2Q4EA 4J03A 3I3OA 3I72A 5KQGA 5TY0A 2WFZA 3MAAC 4KC0A 2MSCB 4I36A 1JSRA 2PXCA 4QGFA 3AT1A 4M88A 1IK4A 3GP8A 4Q1VA 1GEEA 2M1XA 3CJTA 3ZIDA 3C4QA 3N2NA 1JAHA 3DE4X 3CH6A 3UK6A 1QU3A 5JSZA 1UAGA 2EFJA 3VR6H 3FKQA 5KNDH 3ZK9A 2ZKIA 1X1RA 3I37X 3QNMA 4OP2A 2QLJA 5BRAA 4P84A 2XQFA 1Q91A 1QZZA 2H65A 2ZUDA 2ZTVA 3PGLA 2EZ4A 4URWR 3QE0A 4BNNA 5FNVF 2CMFA 1ODLA 4FT4A 4DEYA 3R3HA 2CJPA 1XEXB 1Z37A 3L1HA 4G1FA 4J75A 2IE8A 1CVRA 1JZQA 1BMDA 2EQBA 3SLRA 2W2PA 4CIBA 2E5WA 4BLQA 1T0PA 1XALA 5A0TA 1RWMA 2ZJ5A 3KOUA 5D6OA 1MH1A 2JAPA 4DDKA 2JVJA 4PCVA 4YJ2A 1TB4A 1OLOA 3FB4A 4RMJA 3TBKA 2JFHA 4HRAA 2V74B 3AMVA 3EF3A 2X4DA 2IWRA 1G60A 1A7KA 4G5FA 4PC7A 2PLRA 5E8RA 4EY5A 1Q1QA 5LP6B 3ZI0A 4ZYYA 3NDPA 3ZYCA 5CT9A 1U4NA 2I6AA 1X7WA 2YNMA 4DG8A 3QUAA 3EZXA 4M0KA 3EPLA 2DG2A 4XM2A 5EL0A 1N5LA 4DXDA 3NTRA 1U0JA 4IEIA 1KI4A 2PD6A 4ER6A 4FOLA 1TEHA 5TPZD 4LY9A 4TWAA 2XR1A 4JFRA 1YS7A 3UV3A 1L7VC 2HCBA 4DANA 2QQ0A 1UKZA 3BSSA 3RVOA 4EP1A 4XTRA 2NTJA 1RP7A 3BMOA 1C5KA 2BFWA 3AKYA 3AIOA 2ZKLA 1H6CA 4PXAA 5AUOB 3ZHZA 5CEJA 1VL8A 2JFFA 3FHCB 3L8ZA 2GHTA 3DWGA 1WY5A 2FNAA 4PXYA 3K16A 4JBXA 4X93A 2PA3A 3CIFA 4RTMA 3PFHA 2H1SA 4JT8A 2J4FA 4NCKA 5B1EA 3EK2A 5DHUA 4Q3KA 3DDNA 1V16B 3V1YA 4W8HA 1NAIA 3WO0A 3FNQA 4OHOA 4DUYB 3K70C 2I9PA 1YBMA 3RRFA 4C04A 3WYBA 1ACMA 3ZVLA 4GGMX 4L15A 1VLMA 5DM2A 1UUFA 4PRYA 4FZRA 4N41A 2QLLA 3VI3B 4Z86A 3TRJA 4ZODA 2VVTA 4Z54A 4IDNA 4B4VA 1L6RA 2HADA 1ZZEA 3KFVA 5A5GA 2Q6OA 3CH7A 4HF7A 1ABEA 3K05A 2IH2A 4CM1A 1MNAA 3A3OA 3P4YA 5E2AA 4EQZA 2JGRA 2JLRA 4YYZA 3PQ5A 3C7CB 5SY9A 1P31A 2WD7B 3T15A 3CA8A 3NEPX 4JBWA 4P54A 5ITZB 5A5VA 3EXHA 2F9FA 3BMCB 3HPRA 4FR5A 1L5GB 3F9CA 3IP6A 3QHPA 2P9YA 4OQEA 3AM1A 4LECA 1U2DC 5J5CA 3V4RA 3LKIA 2E4ZA 5ESRA 3NL6A 4ZYUA 2X3YA 5FJIA 4ZD6A 3PV0A 2P7HA 3RHFA 3SBOA 2D7JA 2I0FA 2V0CA 3P0JA 1NJ8A 2O2SA 1NUPA 2FZEA 2N47A 1C8BA 4KALA 1YR6A 2QDXA 3STHA 1E2JA 1W88A 2G88A 4JLOA 2R7KA 4DCOA 4LFBB 2EZ8A 3OAAA 3GBSA 5C4IA 3NOOA 1N9GA 1NI4A 3EC2A 5EKXA 3RQIA 4FD2A 3B3GA 1R2QA 1J0DA 4N3CA 2AFRA 2FFHA 3X43A 2FYTA 3DWIA 2N42A 3BEDA 1RMYA 3MBIA 3Q1KA 4MWZA 1XMSA 3H4TA 4OUDB 3ZJ4A 4IDQA 1I7NA 3A4NA 2GCIA 3OLXA 1O8BA 2CYBA 2ZWIA 5TT1A 1E1CB 1MJGA 3KQNA 2H51A 4W5WA 5FRDA 2D5LA 2G04A 1JHMA 1TF2A 2B30A 5F1PA 4CEJA 4N0MA 2CZCA 4ZMSA 3GPIA 2QTFA 3IIKA 4ENVA 4WSOA 1JR3D 4ZVPA 1SXHA 1Z34A 1NY5A 4RC9A 1U0TA 2EVWX 2ISSD 1Y3BE 1BAPA 2XQIA 4G0WA 4X1OA 2W6MA 1UMDB 4BAUA 4BE9A 1EQAA 4CODB 1CHNA 1JU3A 3KCQA 3UTCA 2P91A 3LY7A 1WPXA 3KAKA 2VZ0A 4UREA 2ZZNA 4S1VA 3F74A 3SWWA 2R8YA 2FUEA 4MVJI 1VCOA 1XDWA 1I33A 1BGXT 5DIFA 4YWJA 1G1MA 1Q11A 1KI6B 3G2LA 3Q3IA 4O1GA 2EGHA 4RK5A 3T94A 4OI4A 1V1MA 4KQ2A 4QFMA 2SICE 4XD7D 1NV9A 4PC6A 5MF6A 1UK7A 4JH0A 1RC0A 4RVFA 1X38A 5FPTA 3GGGA 2W2TA 3A1NA 4MI3A 1I13A 1A9TA 5LZ2A 3QW4B 2AA3A 2PGXA 5JNRA 2RHRA 3I9V1 1IJBA 1XN4A 2JB9A 3ND9A 1ZMBA 4G01B 2EW1A 2AV6A 5HQJA 4O08A 1MZVA 4DEXA 1XPUA 1EVIA 2QT9A 4JJIA 1BNCA 3EJ6A 4PYMA 5KOJB 2HHAA 3EDCA 3SKXA 2O8CB 1XD9A 5BSHA 5FP0A 4KBEA 2Q7XA 2J4CA 4F21A 4WNAA 2QE7A 1VOTA 4MX8A 4WBNA 1J9GA 3JD2A 1QGOA 4M54A 5IZ4A 1Y80A 3N1CA 3COYA 3WGKA 3WGZA 1Q1NA 2H2HA 1R7RA 1FZQA 1T4BA 1JG7A 1WEHA 2C4TA 3IAS1 3O1JC 5BQ3A 4B8SA 1SCKA 1GTMA 1VDMA 2VEDA 3BFKA 4Q1DA 2AYYA 2BR4A 2J3HA 1OFVA 5DMHA 3W4KA 3O7MA 1PL7A 2H17A 3WIUA 4OHCA 2VJLA 1ZHOA 4LF8B 3NWBA 4MEBA 3FF4A 2CJWB 3WZ2A 4ALLA 3IERA 3MRVA 3U1BA 3OTGA 4OHRA 1KXZA 3ZU6A 3L0OA 5J4HA 5FLXA 5CCXA 3W5UA 3ZGXA 3NBWA 4DMMA 5G41A 4D4JA 1H23A 3IUEA 2DEUA 2Y0DA 3OEHA 1PZNA 3I1YA 3OCXA 2JIRA 3R3YA 1WB4A 4MKGA 2EP5A 1ZFNA 4B6EA 1OROA 1NY6A 4I6JA 1GGMA 5BSVA 4GXQA 1N2CB 1YRQA 7ABPA 3IEVA 1P9WA 3ECAA 4HS9A 3M34A 3ETLA 2OM6A 3KSAC 2FJ0A 2NP7A 4LE0A 4OXYA 3RVLA 3TCNA 1U2XA 2WOOA 2HSEA 3FFWA 2ZRKA 2O8EA 4S0ZA 2XE8A 2EXXA 1IN7A 3HNOA 3UVEA 1PNTA 5AOVA 4CTKA 1JQDA 5DNYB 1IWBB 1VIDA 2FSFA 5ES3A 3G0GA 4ZDWA 1Q2XA 4A26A 3SMQA 2QPAA 3GL9A 2Z58A 1EUCB 2PKWA 3AVPA 1JVSA 1W8IA 3PGXA 5G4KA 3VH3A 2IQIA 2D0PB 4I6GA 5JANA 2C78A 4KLAA 5AM5A 2DPHA 5H80A 3R5KA 4RK0A 3DBLB 1CJSA 4WD3A 4Z5XA 5LQJA 1ZR2A 4MLPA 3X1ZA 1I7SB 4I1OA 1SC6A 3I42A 4DJDC 3ZLTA 1AO0A 3PKZA 3V55A 2B3TA 2VG8A 2VJDA 1S6YA 4RVNA 1SQ0A 1LLDA 1XKXA 2W70A 1Q92A 1PZFA 3HVIA 3L1VA 3T1NA 2SBTA 2PLNA 4G85A 5LBUA 2AZMA 1KDOA 4E2XA 2F43B 4JGGA 4O5OA 4RD0A 3V48A 3UJ3X 1OLSB 1SZPA 1QH1B 2PZEA 4TL7A 5FORA 1UBGA 1KPGA 2JLSA 2VOEA 3OUTA 3X1YA 2R44A 2WMDA 3BRCA 4UU8A 1Z5VA 3ZDDA 1E1QA 4HQ0A 1AGRA 1TPYA 2F48A 2P2ZA 3DV0A 3AVYA 1QGZA 4XX1A 1SUBA 1QIFA 1R37A 2J7PA 1TTTA 1H8HD 1SBNE 5DLDA 4CV2A 1E6UA 4FW9A 3U9LA 3EXFA 4N0PA 4RD4A 3BERA 4P83A 4X60A 1YL5A 1BH6A 3R7BA 3ZCQA 4XVCA 4MVJM 5BYKA 4AWAA 1WXIA 3KUKA 4XWGA 4EKDA 5AM4A 4LGCA 1II9A 3REFA 3PZRA 3QVSA 4DT1A 1OH7A 1QOPB 1L5RA 3F5FA 4UEJA 2ZULA 5C37A 4KXMA 3P0EA 2I2FA 2ZVJA 4OY3A 2WNIA 3OFKA 2IOQA 3N8GA 2C7GA 1GR0A 3D6FA 3H75A 5DBIA 1SHTX 5KAPA 1GRNA 3I4LA 3C6ZA 2V65A 4LZAA 2KPOA 4W9NA 2A94A 3F0TA 3TLGA 3TOSA 1C3QA 2ARKA 5AM3A 1HF3A 3K0CC 3LQ1A 2OZEA 3KK0A 1R64A 1FFXA 4EMUA 3UUGA 5LMNB 4NZ9A 1PJAA 4P4LA 2XXAA 1PTJC 2I6XA 2XMQA 1ZMTA 1U8EA 3GLFE 1A5ZA 1XLUA 1JQ3A 2MINA 4R7GA 2J09A 2F59A 1XTJA 3CH5A 2FA9A 3QPCA 4UDOA 3WDMA 4I5DA 4OBWA 4IJWA 1TM4E 4E3AA 1TQDA 1I10A 5DI9A 2O2YA 4ZIRA 5T8KA 1W2HA 2ONYA 3TIFA 3NALA 2H8GA 621PA 3LRTA 5F9FA 4WX2B 3CNNA 5B1SA 5A4AA 4MHTA 3CLTC 3GZJA 2NTVA 2O2GA 2OGUA 4MA0A 4U0KA 4UDNA 1LPMA 3ORSA 1GKUB 3D6JA 4UJ3A 4EG8A 2V3CC 2V7BA 1FW8A 4FQ5A 5E6SB 3VYRB 2QUHA 5JYCA 1HRDA 5IARA 5M2QA 1V41E 4B83A 5DNEA 5FTLA 3GCZA 2OPHA 4X20B 3LUFA 1CCWA 1DX9A 2IPXA 2QJWA 5ALGA 5A9TA 2BFEB 3FTQA 3TFWA 3A25A 5KTYA 3PEYA 2ZI7A 4LNAA 3TTVA 4YJ2F 4ZVLA 2OBYA 3DAFA 2O3RA 1MO3A 2VK2A 3LUBA 4C6TB 1B8OA 3G82C 2ZYGA 1UBTS 3Q41A 3NP7A 3E4DA 4DMFA 5E9AA 4L07A 3ZNNA 4J0QA 3VVMA 4EQ6A 2HJGA 3AWIA 1XRSB 2OD7A 1ORHA 2DUNA 3EGEA 3L6OO 4LF9B 1JDUA 3INGA 3R77A 4TLEA 3RU9A 1Q0TA 2ZROA 2P6UA 2D1YA 3WG9A 3A58B 1PZXA 1XLTA 4LOJA 3MUNA 3ZV7A 2RD2A 2HSZA 2WEKA 3B3LA 2JBAB 5JCPA 1NRWA 3HCBA 4HDCA 4JP3A 4YROA 3TL2A 1VLLA 3TIVA 5F7XA 4C89A 5HBRA 4QUEA 4L4RA 2BP7A 1ABBA 1GAEO 4E84A 3TBFA 3LFTA 5AHOA 2C4WA 2GRUA 4JA0A 5HQ3A 4XCKA 4PX9A 2CEAA 4DIMA 2VC2B 3F6SA 4CKBB 4ECEA 2ZUBA 3UQYS 5HJEA 4Q39A 4PBRA 1RWPA 3OJOA 1TA9A 2QAGA 3DTVD 5AESA 1LF0A 1HYGA 4D80A 2D6FA 1A8UA 2MSDB 2ZI9A 3ZTYA 3RTCA 1QANA 1NFFA 4R8LA 4PQYA 4XUEA 2JFWA 4Y0AA 5I7SA 5EJGA 4DIUA 2VHCA 2CUZA 1R5NA 2X0EA 4GPZA 3CQ9A 3TRIA 2A3NA 2CFOA 1GCUA 3FYCA 2BD0A 5IU6A 1O3YA 4G0PA 5EG5A 3FTPA 1GTZA 2IF2A 2QN8A 3IDAA 1YUNA 3O74A 3PHCA 3R0VA 4MICA 2PLAA 3R7WB 1NU8A 3G0CA 3G9ZA 4C7JA 4L4YA 4J0IA 2PBRA 1DRJA 4CUJA 1XPJA 3LK6A 3MRTA 5CB0A 3R9WA 2WUEA 4QT4A 2CUNA 1V8OA 3ETNA 3ENNA 1GT91 4KBGA 2IDJA 3DUFB 3ANSA 2DETA 5INTA 3I9LA 2VF2A 1A0OA 5I7OA 4MB6A 4DGSA 1MQSA 3OU2A 3PYMA 2BM9A 5ABPA 4CM3A 5CK4A 2RGYA 5BPFA 4LF4B 3OQIA 2REQA 1BJKA 5CYPA 4NECA 1XDBA 4RWEA 1VJDA 4I4NA 4Y67A 3VHQA 3KD3A 4M1KA 2ZYRA 1PS8A 4UUMA 4DNFA 4IDDA 1I1NA 2W2MA 1OD6A 2AW5A 3ZUGA 3P9CA 2LCIA 4KQ9A 1V47A 3RAJA 3A9SA 3NCHA 4B1FA 2ZTLA 4EGSA 2YWDA 3P52A 3DLIA 1P5RA 2H0RA 3ENWA 4INAA 2VCYA 1JR2A 1G7RA 1U0RA 5BUSA 4PNEA 4JLBA 5UKDA 2GBLC 3WV5A 4BEJA 1FX0B 2HNBA 3PQ4A 3COSA 4E5UA 2FLKA 5BYCA 3GK3A 1TTHA 3OX2A 3FZNA 1IIRA 1COWD 2V4UA 3EHEA 1N2IA 1TOAA 2OHOA 3H04A 4NWIA 1NQAO 3RVMA 3KJGA 1FRQA 1ZUIA 1FUKA 1DKOA 1ZCBA 4BEVA 4RY0A 1L4FA 2Q99A 3SR4A 4ARVA 3MWEB 3QLTA 1Q0QA 5I47A 3HCEA 3TW8A 3H2KA 1NFQA 1GOTA 3KNZA 1Z4OA 3FLBA 1D2HA 4Z9YA 2WJJA 1VPVA 3PSAA 3Q6NA 1T8YA 2UYYA 5DIZA 1PUXA 3OEED 3UMOA 4KXUA 2FHPA 3K9QO 1JJFA 4MWOA 1N4DA 2C2BA 4IR7A 3VR5D 3X1WA 3O2QB 4X8MA 4L7VA 4CKEB 2XPCA 4TMXA 5IBRA 4B3TB 3IQ0A 5TNXA 3EG5A 1D1PA 1RLOA 2CC2A 3FCUB 3PZSA 3EDQA 1C29B 1NVVQ 5IBCA 4D46A 5KNBD 1QHHB 1SELA 1RKDA 2O3JA 4FMCB 2BOVA 1C7QA 2RH9B 2YYAA 3AR9A 1BQEA 2VSFA 3R41A 4E5NA 1BSVA 2NUTA 5CXQA 1NVMB 4WFKA 2ZIUB 1ODJA 1KNXA 1ZMXA 3O4HA 4Y6SA 1GRVA 3LUHA 1UFQA 2JGKA 2D5IA 4B48A 1VA5A 2WUDA 3PX3A 4IIJB 3VR5H 1PN3A 4DQVA 4EUFA 4B3SB 1GTJ1 4BMZA 2PQ0A 1OMOA 2HF9A 3TZQA 1AS2A 4BUJA 2FOIA 1MJNA 4PX3A 1XJ0A 5IX8A 2XUOA 1T8RA 1GSOA 3A6LA 4I4LA 4QWWA 5LC1A 5KNBH 4FVTA 4IHQA 2IHNA 1N33B 1LPPA 3KYJB 4DSTA 8AT1A 5C7LO 2BSQA 4XW2A 5AKXA 2BKEA 5HOQA 2BFCB 2XXJA 2WMYA 3A1VA 3SE7A 3HLYA 4ZDKA 1TKBA 3AL2A 2FG5A 1PR6A 5IT9A 1AF7A 3B36A 3ZCPA 5JRDS 2UUOA 3PFBA 2O2DA 2QSYA 3UPUA 5KBYA 1Y37A 2NZJA 2OZLA 1BJTA 2XDQB 3EAQA 4GOLD 4LRSB 3NGMA 1YZVA 4MV0A 1P1IA 4P33A 3P9YA 2NZ8A 2YX1A 5KJEA 4OLBA 4TYYA 3NL3A 2E9SA 4RK1A 1ABFA 4RY8A 1ACJA 2BJVA 4TT3D 2YHUA 4IVNA 4WRRA 3KWMA 5GIPE 2QS9A 3QOFA 2UDPA 5J40A 3GNQA 4XEHA 3H5LA 3UHAA 3SQMA 3HBAA 1GXSB 2IIQA 1JAXA 1GZVA 2ZJ2A 3M3PA 1XZEA 2A9FA 3KDSE 1FSSA 1GA6A 4EW1A 4G0QA 4P81A 3W6OA 4QUBA 4D26A 3LE8A 4TVBA 5EZSA 2HJRA 2W6OA 3W2FA 3DP9A 4QTXA 5HS6A 3C3YA 2OB1A 1Q0ZA 1SWWA 2J0VA 3ZWYA 5EYNA 3HI6A 4INPA 1FMJA 1IPHA 1JXAA 4IIBA 1LIJA 1SBIA 2GCAA 1Z6AA 1RU3A 1K1EA 2JJ1A 4AO8A 6REQB 3UGJA 1OOEA 3DZHA 3L8EA 3NTOA 5CGQB 5IJ9B 4Q4AA 1VHDA 2FPPA 3EC1A 4DHEA 4ISCA 3UOAB 3GJ3A 1O95A 1S0UA 1YQQA 2A0WA 2XNSA 3PQFA 3AY7A 3IBTA 2PS0A 3GJ6A 4H18A 5BQOA 3CF0A 1Q20A 3RC3A 3UWOA 1DCMA 3AU8A 1T3ZA 4F7WA 3C1UA 4Q4JB 4U7GA 1RBZA 1VJCA 2HTFA 5ALUA 5ES4B 3GQBB 1OXBB 2JAOA 4B2LA 4DV7B 4XVQA 5FA5A 2IEZA 1UEJA 2K2WA 2VRCD 5EJ5A 3ELWA 1G8GA 4NOJA 4W7IA 2H7VA 4DUGA 1NF2A 1GL7A 1IK6A 2ZSUA 3BGIA 2VDMB 2XQKA 3G8DA 2QBYA 1G19A 3D6NB 4POOA 1LIKA 2OCPA 1YMUA 5BSFA 4R0MA 2OTCA 1SBTA 1B0ZA 1E2NA 2I91A 2AC2A 1JEYA 5HG0A 3DOOA 3HWRA 4FT2A 1VGRA 4OGKA 5JDIA 4LSGA 1CUCA 1E9FA 3IO3A 4KQIA 3GVCA 2FLVA 1IZ8A 1V11A 3EXG1 5DRTA 4HWTA 4ED9A 3LT1A 3R24A 1GR1A 2G08A 2P6MA 1GNPA 1MOZA 2C82A 1XQ9A 5BYAA 4YAOA 3A05A 3ESQA 4M83A 1GQSA 4BDSA 3I4FA 2GTPA 1EUDA 2Z2JA 5BUCA 2DR3A 5EWMA 3GYGA 4PPYA 4XJTA 5D01A 1HM5A 2OQRA 2JASA 4ZAWA 1AZSC 1JH8A 2NQ2C 3SBEA 5JSQA 4R6XA 2GEJA 3UHFA 3AEKB 4ZOLB 1LX7A 4G8JA 1KQGA 1CRQA 2ZYTX 4F93B 2CEKA 2NIPA 3B13B 1P2UA 9ABPA 3AI3A 2FEPA 2QW0X 3BHIA 5H4HA 4XQ9A 1L7AA 3GFSA 4RABA 5ALEA 5FR1A 3U4CA 5KSOA 2X8JB 3HSSA 3UJAA 3OE1A 3IHTA 3EJWA 5T64A 3LCJA 3ZL8A 2E55A 2IL1A 2NZXA 4Y2PA 1G59A 2WAOA 4RUKA 1OFGA 5JCOA 4JA2A 4KLZA 2HWWA 3U39A 2CLEB 1SD5A 5DVZA 2PUEA 4W63A 4ZQFA 1B2LA 1KU6A 1N25A 4TM7A 1OYWA 5F52A 1NKVA 3DB1A 5JG7A 1N0VC 1VMEA 2G25A 1C0PA 2P9JA 5HEKA 3SSAA 4YRBA 5A7FA 2R86A 1UBMS 3OQPA 4LC1A 4QUJA 4RLHA 2KE5A 3UWMA 2IPLA 3WLIA 3AYZB 2ZBUA 4J9VA 4HTFB 4W7SA 2R96A 2H9YA 3LT5A 4YT5A 3WICA 4QGSA 3R3VA 3NH9A 5DU2A 3WLLA 5KUTA 4DREA 1RKSA 3GH3A 3JASB 1YDMA 2Q0HA 2RG1A 3WLRA 3VC3A 3K5HA 3RIHA 5KOHB 3KSDO 3QAIA 3K53A 1YBFA 1Q15A 1ADBA 1H9AA 4CXMA 3HADA 2WD9A 5AVSA 3UXHA 1RAGA 4X7MA 2B5WA 3JAWB 3QVVA 1HG0A 1BDIA 3OZEA 2XNDD 5B1IA 1AKYA 3AM5A 4UPEA 4K8KA 2Y1LA 2VOSA 2OB2A 2VXYA 3D02A 5GY7A 2DLNA 1AV7A 2AG8A 3O4IA 5BNWA 1F9EA 1FYXA 1K0UA 2PR7A 1L8XA 2QPLA 2A78A 3HKEA 2WJ6A 3M0EA 3MQ2A 3NHSA 4C4ZA 2P4UA 3OCCA 2VP4A 4OGGA 9ATCA 5KMGA 1Z0IA 3N07A 1T9KA 1GPLA 1JDTA 3G2MA 1ZGJA 5ARDA 1Z25A 4J7CA 4IIVA 5AVJA 1YRLA 2UZ3A 1I2AA 5DW3A 4TV8B 4RPGA 3DAPA 4AJHA 2OCKA 3CKYA 3U4GA 5BV1A 1MB2A 1VHQA 4HN4B 3HK2A 4L7QA 2CNWA 2X22A 1N6RA 5ECYA 1L5SA 3FYSA 2P4QA 3HEMA 3KXIA 3VNBA 1IL0A 3EQ7A 1XG5A 1Z28A 5AI5A 4DLKA 3DMHA 3G17A 2P1RA 4WCFB 2F8TA 3H5OA 4D74A 3KR9A 2IUUA 1BMFA 1OAAA 1NVEA 3SAJA 2ZI3A 3HNRA 3I8OA 4K9MA 1IC6A 1FFYA 2VYFA 5JQGB 2XGOA 3BF8A 4MQ4A 4GAEA 2WWTA 1TCAA 5CX4A 1YR1A 1Z8NA 2HA0A 3H9JA 4E5YA 5AWFC 4JXZA 1A4XA 1YZQA 1ZM9A 2WTMA 3IP9A 1ZRSA 3Q1YA 4PHCA 1PGNA 2VSQA 2V6FA 2AG6A 2CCKA 2FFAA 5B3LA 1SZDA 3T7EA 1NXVA 3O4GA 2WJPA 3K0EA 3I2IA 2BI4A 2G17A 1I01A 1HURA 5BSKA 3H49A 1V25A 4E6PA 3HYTA 2QV7A 1NYLA 2LRHA 5BSRA 5JAPA 2I6FA 4AP5A 3EXAA 1SKMA 3T4XA 1C80A 5JHGB 1O6FA 1WMAA 1QJ4A 1GNVA 4HY3A 1S8FA 5JI3E 3AR4A 4GZ5A 3L0CA 2WWIA 1Z6GA 4PYNA 5TGZA 4KIUA 3S2UA 3WKCA 4ZCIA 5A4DA 4YJFA 1E62A 4ZGBA 3DD5A 1EE2A 1HEUA 2P9HA 5GJCA 2VBIA 2XE4A 3K31A 1PBTA 4OB8A 2HPVA 5KYUA 5LZ5A 1EKXA 2I2DA 2VPZA 3HCNA 3PB3A 2I7TA 2C2MA 5BW4A 1QG0A 4AU1A 1M0EA 1V1BA 3WX0A 1TQ8A 4GM6A 2QG9A 3BOSA 5CLGA 1Y1RA 4L51A 4URFA 1FJ2A 1GCAA 4BOYA 2H06A 1PJ4A 3BFPA 1PLJA 3CUSA 1U6IA 4L5AA 1K4YA 3BZBA 1XZAA 3K0FA 4QHTA 1NKSA 4ND4A 3BE8A 3OKPA 1G3RA 3KVOA 4ZKEA 2PV7A 2BKLA 4D3FA 1E8CA 3CR7A 2YY6A 3QU9A 4WOCA 4V3CA 3UJ8A 4BGEA 2GDJA 1GA4A 2GAAA 2XLCA 2P11A 5GM1A 5AW8A 1YQGA 4DLRA 1S3FA 4H7FA 2ZB2A 1AZTA 3RRZA 2I29A 5TQ2B 3GFTA 2C61A 4OOEA 1ZL2A 3JARB 3MNFA 5I4IA 4Y3UA 2AFVA 2JL1A 2W90A 1G3QA 2H2DA 3BBPA 3DQPA 1KZ9A 3VBEA 3W8RA 2C2ZA 1PFWA 3OT4A 3PG5A 4BNXA 3ORFA 4FJ0A 4PZUA 4M1YA 3GVXA 2IUSA 4ZCMA 2WF5A 1T8PA 4HN2A 1PWXA 1EK1A 2JNWA 3SNKA 5JADA 3EVGA 2NU6A 3FUUA 2AOXA 2O1SA 2MT9A 4K40A 4MR7B 2NT4A 2FP3A 4CRWB 2O8DA 1ZRMA 4JJ4A 5FPPA 1NATA 3HZOA 4P0QB 3QKTA 2BUAA 2C9YA 2X9NA 1FY2A 1T91A 4QOGA 1T6ZA 3H1FA 3IJPA 1BDJA 5ALZA 2J9FA 1M2OA 3OCWA 4IIYA 4BX9A 5JSHA 5KYWB 2GXSA 1U02A 2BF7A 1Y5LA 1THMA 1ONNA 3HU2A 4RYLA 1ZSYA 4TUYB 3EWAA 3IKTA 1M1XB 2Z8XA 1UKYA 3T7CA 1TUBB 2ZDQA 2OOSA 2ACVA 3L46A 4KSCA 2X58A 3JVUA 3WGNA 3SI7A 3ZV3A 2J5KA 4A9AA 2WJWA 1H65A 4FNMA 2FWBA 5EPUA 3EW9A 1WR8A 3S29A 4U0JA 4B2YA 5T5QA 4BGDA 5DGXA 3EIWA 4XA8A 3UUWA 3AF1A 4ID9A 1GITA 4NTZA 3TTXA 2JRCA 1JTVA 3DTYA 3HFGA 2NXEA 5KWIA 1E98A 2XB8A 1QOZA 1QVAA 3KZMA 3NR2A 1AB6A 4AS3A 5IH7A 1M73E 2F3RA 3TQQA 1CQIA 4LZLA 4OD0A 4R3UC 1HX7A 3QU5A 3VYTB 1K7XB 1P1BA 3ILVA 4HQFA 4A92A 5BVHB 4K81B 5JV5A 3S6JA 2I3DA 4E5DA 4K46A 4PPNA 4LV5B 3U44A 3D4BA 2GWRA 1QYVA 2EC5A 4D9BA 4QTYA 3R8CA 3K5WA 4B3XA 4GW3A 2Y1GA 4ZZIA 4DGQA 4LHZA 4QBIA 5IYZA 3OHSX 2BF4A 3W3AA 2XKBA 4Z3KA 1M34E 1IHPA 3M4ZA 3WGTA 2WTBA 1VP3A 5GV8A 5JTTA 1JI0A 1KAQA 4L5YA 1JDBC 1G7SA 1ZU5A 3DZFA 4UUAA 4E2YA 4HFJA 3E82A 4C03A 4C4SA 2CSXA 4MB2A 1T6NA 4CCYB 4ZCRA 4L85A 1A27A 3WHLA 5LZ8A 1R27A 4BMOB 4BNFA 3K15A 1U2QA 1TD9A 3EGDB 2QVCA 3TINA 4IVPA 2V8BA 5AK6A 4DKXA 5CCBA 5FTMA 4CM5A 1RXWA 1QFXA 5BSWA 4EYOA 4YJDA 1JPNA 1R50A 3CLVA 2Y1WA 1KY4A 3H18A 3IVGA 4FZ3A 1I3LA 1VPDA 5CXXA 2PS1A 3H4VA 3H0EA 4EK9A 3KC2A 1A4RA 3IOYA 3P2KA 2Q5CA 5B6IA 1K66A 2VYVA 3QA3E 1R0RE 5AK5A 4EJ2A 3WK4A 2HY7A 2I3GA 1ZMOA 2ZITA 4Q34A 5DBOA 3B5EA 1N1DA 2OL4A 3BH0A 4DV2B 3WLKX 1EFTA 3WP1B 4X8HA 1L0BA 3W5AA 2I8LA 2NACA 5E4TA 5E6UB 2J0SA 3H97A 3EX7C 4J3FA 1J23A 1WOMA 2C03A 3U6KA 3DDCA 3DBOB 4YB8A 3HBJA 4HAIA 4I50B 2W6ZA 4LMBA 4DA7A 1SKYE 1RACA 1V35A 1ZH8A 2Z9BA 2WSSA 1UZMA 3BWMA 3F7NA 4GMKA 4IS3A 4PHTA 3IMFA 5REQB 3HXLA 2B8WA 5B6PA 1J9ZA 2KLHA 1TO6A 3RQQA 1PQ4A 2ZWAA 3T61A 1F8YA 2ATVA 1GZHB 3HWWA 4HVCA 1XTZA 4YWHA 4EG0A 2P68A 2XHEA 3RQ2A 3OQOA 1CZUA 5KC9A 5K3AA 4Q0MA 4IDPA 1SXJD 1TYCA 4B4UA 3GLFB 4Y7CA 1I3MA 4QQKA 5K8LA 2H4WA 4RENA 1PUJA 4IG9A 1PFQA 2BI8A 3TUIC 5ICEA 1JQEA 1WMFA 4OKSA 1A95A 1FRZA 2FWAA 4IXTA 1ZNXA 4NOLA 3BWVA 3U7EB 4BHTA 4CF4A 2EERA 1ISFA 1P7CA 1RJGA 2ZBGA 3D7MA 4TOIA 5EE0A 1V7ZA 4DR2B 1XQYA 2H6EA 1OW3B 4K8PA 4E8YA 4Z1MA 2LDXA 2CZQA 3QFFA 4CTJA 2PUVA 1RC8A 3VKHA 4DMRA 3A4IA 1E5LA 1QJCA 1ZD1A 4N8EA 4BVJA 4C7XA 1ZWLA 3DHVA 1NBOA 3HR4A 2LTAA 3LWZA 4OF4A 3ZOKA 4FOSA 5JNSA 1YA8A 2G1AA 1CK4A 3RUHA 2VCHA 2C84A 4AYTA 4BFZA 2JIZA 1U94A 2GVZC 1Z82A 1V9SA 1JLLA 3IP3A 4ZV7A 2FW1A 2BFPA 2GO7A 2R7LA 1V8FA 3D5QA 3UCXA 4LXIA 4PG5A 5BP7A 1FRNA 1E8DA 1ENYA 2JC3A 3SXPA 1NBIA 1OYOA 4PQGA 1AXRA 3IJ5A 1YR3A 1XDSA 2HRRA 4RA9A 3HJGA 4I0WB 2PX5A 1K75A 1Q1BA 4R05A 1ZXBA 1EZ4A 4R1TA 4A0QA 4ENTA 5TDHA 1IZYA 2EEPA 3GMDA 2QRLA 3EOAI 1OC4A 3L7DA 3ROGA 2HQOA 5EUBA 4YJGA 4FEYA 4DL9A 4Z3OA 1JE1A 1WCIB 1DQPA 1VLVA 2BLLA 1P5JA 4P3PA 4RGYA 3GUZA 3LO5A 5K6AC 1BCSA 5G3YA 4IOMA 3G89A 3NV7A 4J07A 4EVSA 1EBUA 1DC7A 2MR6A 1EWQA 5KTNA 2F55A 1QF7A 1HO3A 5LN1A 1N77A 4FDMA 1M0SA 1E5TA 3BFVA 3H5VA 1E4OA 1HKHA 5DYGA 4C14A 4YUXA 4MPPA 4ENSA 5A3JA 2X7HA 1H93A 2XTZA 3HS3A 5TB5A 3NI2A 1CVIA 1JX6A 3C87A 3CEJA 4QYXA 4EUEA 1J06A 4HDOB 1Y3IA 1TJYA 1X1TA 2QZZA 4K6GA 4MWGA 4OXKA 4BO6A 3H0CA 4NAUA 4Y2SA 4E6EA 4PSAA 3QH4A 4R8KA 1UDXA 3T4UA 3M4XA 3DGEC 2Z8ZA 2GEUA 1LS6A 3ZIAD 4NNJA 2ZT5A 2A84A 4LVOA 3R3XA 4WGFA 1Z8DA 1UKEA 5SV2A 3T5AA 1NIPA 1UPAA 2C9OA 3FPEA 4QJBA 5FPQA 2IZ6A 5CM5A 1U3VA 4JVLA 4ALMA 3FIJA 4U63A 1FMFA 1IDOA 4UMFA 1T8UA 4X1IA 1RJ9B 2HBZA 2XB4A 2C7VA 4N6OA 2AL7A 4OMCA 4CU2A 4HNGA 1KBZA 1E1KA 3FA2A 1XNJA 1AN0A 2OBNA 3SLGA 5B64A 3FHJA 3Q3CA 4IWYA 3WWYA 2Q3FA 3MFYA 4QQRA 4R1MA 5GOTA 3WNZA 2H7YA 2UVDA 4ZPJA 4Y1GA 2RC5A 2ZGVA 4NATA 4PC3A 3H9QA 3DLPX 2X1VA 4FGSA 5JSKA 4B81A 4BYGA 5KNLA 3IQIX 1JU9A 4GI1A 3PNMA 2MDTA 3PX7A 1WQ1R 2X9QA 1UC4B 3PGMA 4LYEA 1SY7A 5C5DA 2PGOA 2J9GA 4H4EA 3CU5A 4ZVQA 2H5JA 4GX2A 3SC6A 4JJZA 4L5JA 1LDBA 3PNLA 4BP9A 4XGNA 4EAQA 4IZOA 4HDMB 4AUMA 2NSYA 4GR9A 4L8LA 3ZTTA 1F4VA 5AI6A 1VB5A 4R1SA 5C32A 4ZARA 4K2AA 4G84A 2DERA 4Y2XA 3ITEA 2JJ8A 4YRFA 5K3OA 2JD1A 2QN2A 2JVIA 5DTQA 1SUSA 4IV5A 2BW0A 3BMNB 2YNMD 4FDVA 2QP4A 3B51X 3WAGA 3UAXA 1DQRA 4PCLA 3T3DA 1AQ6A 1ZGZA 3P9SA 3RFCA 1OT5A 1KK1A 3FFBA 5T4HA 1M7HA 1R0CA 3G9TA 1UBLS 3G8AA 4FB5A 3JQPA 1S9DA 4HK4A 5F2OA 4OMUA 2QL6A 3QVXA 3IBFA 1HZZA 1ODFA 4XQEA 3SZUA 3RADC 1PR0A 4DRYA 1JW9B 2EF0A 4M9RA 2X9GA 1TVMA 1Z5NA 3IIJA 1JIKA 3RC1A 4MAFA 3SC2A 1XFAA 3U4MA 2PSEA 2W48A 1SH7A 4L3WA 2X19A 4MGEA 4P31A 3H13A 4QGGA 3OLVA 1TT7A 2PYIA 3ZJ5A 3L01A 4MJLA 1E94E 3BKXA 5IN4A 1IN1A 3HKCB 3M33A 1DQYA 4LTNA 4QARA 1F2UA 1P19A 1PZHA 4HAUA 5D1NA 4KWEA 2C0PA 1SVIA 2JZOA 3W2TA 3QVKA 3G2JA 2JZCA 3HY6A 3D6VA 1P4SA 4HADA 2EBUA 4UNSA 1Y4DE 2Z43A 1J9EA 1SPBS 4YIHA 3VNVA 2L19A 3SIWA 4AXXA 2RB5A 3CF2A 3A4TA 4K03A 1P2VA 3ER9A 4HYEA 4PQFA 1EBBA 3RVQA 1EINA 2A58A 4XCQA 3ZXYA 1AM4D 5CB4B 4MQFA 5EVCA 3DTVB 7GPBA 2PYDA 2Q62A 4EY8A 2W4MA 3U9TA 3I05A 4BN5A 2N1MA 5L3QA 3HY3A 3ROEA 3QM1A 1WF3A 4N0EA 2AZXA 2JJYA 2PX4A 2VSXA 4KN8A 4A1FA 4DV3B 2UXCB 1V3TA 4U02A 2HYDA 3FPFA 4PGAA 1Q19A 3JQQA 4FWTA 1HE8B 4QA9A 4BNIA 3DNMA 2EP7A 2PUCA 1PRYA 1LNQA 3BFXA 3FPLA 3DE5X 4H1WA 5KNCA 2Z6AA 2E0IA 2QM3A 3OAAD 1S7GA 1VJ5A 3JYQA 3ZDFA 5ALPA 4L9SA 4E51A 2XF8A 1M8JA 3LC2O 4ZRDA 1PCXA 1YZ3A 3D5EA 1GQTA 2BI7A 1JI3A 1RCFA 1RVDA 1ZHFA 2FR8A 3BA1A 3P9PA 5LM3A 4P0PB 2I66A 1BWRA 3A2MA 3TPZA 1FNCA 2X0FA 1L4YA 2IODA 1C9KA 2MSNA 2QKYA 2IZ5A 5D51S 3W06A 3ITKA 3R6WA 5KQPA 4IZ6A 2IUFA 4IHJF 3IQHX 4OQQA 1D4AA 1J90A 2EFGA 3FYUA 4P3OA 3KM0A 4KCGA 1E9AA 5HJ2A 3SP1A 1YFKA 3RU2A 2XA2A 2EQ5A 1FXUA 2Q2OA 2QMQA 3MRSA 4LQLA 4ZK2A 1A8SA 4V2UA 4G1EB 5LZ4A 2VT6A 3AFMA 1ZX1A 3KVNA 3ZDEA 4Z4CA 2EFHB 4KV9A 5A7GA 1DUSA 3C5CA 4Q3DA 2ENUA 1GLVA 1I1QB 5U4QA 4B09A 1KI2A 2VAWA 5I9IA 4IUDS 4DSOA 2DR2A 1VMAA 5HGJA 1GU1A 2HL6A 4KUHA 2Q7OE 3ZGYA 4KWCA 3BRSA 3B6MA 4JB2A 4LX8A 4QBTA 4XKJA 4XZ3A 3TE6A 2WUWE 2E21A 1GZ5A 5KOIA 3A4LA 3OKFA 2JBWA 3CH4B 3HKBB 2WYUA 1R9GA 2DQZA 3U4DA 1LDYA 1EK6A 1JQ5A 4A0HA 3I76A 5GTDA 4Q48A 4LOLA 4YIKA 1O97C 2C0QA 4JJFA 5IYZF 3RWMB 2OV8A 4NCJA 2AK2A 1CD5A 4ZI5A 4XYMA 4D6YA 2PSJA 1AGPA 4B8RA 1V5IA 1A9YA 1SPXA 2D8MA 2PPLA 3GRVA 1NJGA 3M5WA 1WDWB 3CGGA 3LOPA 3SDZA 1ZIPA 4UCWA 2X42A 2C3UA 1NLUA 3A36A 3KZCA 3LDUA 1G63A 3WSWA 4KPUA 2BZGA 3BPSA 4H0NA 3CNOA 4KIGA 4QVIA 2QE7D 1EB8A 3KUDA 3TSWA 3AESB 1YVDA 1FUIA 2C94A 2GD0A 4NV1A 5KYXA 5DLQC 2GJ8A 4ZV4A 4II7A 1T9GS 1JXMA 1WG8A 4F4FA 3QEBZ 1H4VB 1HOXA 3BBLA 3JZFA 4Q4HA 1GN9A 4HNVA 1O5IA 1EK2A 4FFLA 821PA 1O08A 1QMPA 1Y8RB 5K4AA 5LLTA 4FYYA 2JIOA 3QWFA 4U1RA 4E33A 3TUZC 1JDJA 3ELDA 3KQVA 4PYLA 2GJ4A 1C0IA 2JGJA 3ZDZB 1BKYA 3I04A 1IHDA 2FN8A 3OEHD 4KZKA 1W87A 1SBYA 1T5HX 4BQSA 2NZYA 1M7GA 4I2NA 4DPKA 4FFBB 2QLMA 1P9OA 1P9LA 2OO3A 2Y1OA 1GD1O 2WJ3A 3ABRB 4IXWA 3CLRD 4NCBA 1EQUA 1P18A 1STOA 3GEHA 2VDLB 1R6BX 2IYFA 3IR7A 2D2EA 4I46A 4ND8B 2RE8A 5COAA 1CSEE 2JHFA 4J16A 4WADA 4WKBA 3T99A 1O96B 5BNIA 1HT3A 3RYHA 3UJBA 1R4AA 2JAHA 4PNPA 4V0QA 4ND3A 4ND6A 2EIXA 3D6TB 4QRDA 4X44A 3FM9A 3L9XA 1SFRA 3GJ0A 3GX1A 4GWLA 4KH1A 3CX8A 2VKTA 5ENDA 1UWLA 1X1EA 2OUIA 2B4TO 2IS4A 4JUIA 2QORA 3T0GA 2GFIA 1R8JA 2Z9CA 2GCOA 3NYWA 5JO0A 1NVVR 4JASB 4D0SA 2XA1A 1NQUA 2CLFB 1PG2A 2A9VA 4UHCA 1ZD5A 3T3GA 6ADHA 2ZRIA 4TROA 2JH3A 1TJ3A 4CF3A 5LFAA 5CYGA 1UDWA 1V95A 2OORC 3T7DA 3T35A 3LP5A 3Q6MA 4OG2A 3UW1A 1WYEA 3GLGB 3RLIA 5FB3A 4GOOD 4D8WA 2CVZA 5EMKA 3WC4A 1KI8A 3TK1A 4FDTA 3GLFA 1EMDA 1YJCA 3W6NA 3FMPB 2V5UA 1ZNZA 1YUBA 1G8JA 2AXEA 2ZSJA 3SQDA 3HDVA 1R1DA 2GYYA 4UE6A 1GFZA 1GUAA 2MTBA 1T6BY 1NVUQ 1WSWA 2VYCA 1ULUA 1KAHA 4JR1A 5AKKA 1NXPA 3NHYA 3NM6B 5IH3A 3FTDA 1SNYA 5TRTA 5ALKA 2Y4NA 2H1CA 4EAAA 1TDJA 3COJA 4UEWA 1H2XA 2XYRA 1JHVA 5K2OA 3FNIA 3W2HA 1AA6A 2ID4A 5LQDA 1BWQA 2F1JA 1DQNA 2RGUA 3BC1A 1EFVB 1E1QD 3D3WA 4RHCA 1Y3HA 2CHFA 3IDFA 2BDUA 4HYTA 5E1BA 5A03A 3FHYA 4TTIA 5I9LA 2J7PD 2X0RA 4RKEA 1ESNA 2PX8A 3PPIA 3N2AA 1HTWA 3DEHA 3KOMA 1HNNA 1ZW6A 4O8ZA 4PPFA 2ZZMA 3OFSA 3CUKA 5TQIA 4UUBA 3I9V6 2MR5A 4L72A 4MRVA 2QRQA 1O8CA 3EQ2A 1W2WB 1DPFA 4O4LB 4RTOA 4HB0A 1MIOA 2AYXA 2XE6A 3NX4A 3NYIA 1E7YA 3VKGA 1W19A 1YQUA 1M2GA 3UAVA 5IHXA 3CG4A 2BE7A 2FG7C 2QLFA 2VXOA 3ITNA 3KBBA 3IAAA 1FFCA 3CX3A 3Q9UA 4HH0A 1KY5A 3CLSC 3MOGA 4CTOA 5LNK1 4HDQB 1GUFA 1XZKA 4IUBS 5HF9A 1P17A 3M4NA 1KVTA 4O02B 4C4TA 2ICAA 2XF2A 3RUFA 4UCXA 4UUOA 1I32A 4D0RA 3E70C 3KR0A 2BHNA 4C5CA 3U61B 2Y9PB 5K0LA 3DOJA 3OIDA 2IZ0A 4UCFA 1CQXA 4MPJA 2PZFA 1A2QA 1O57A 2DCUA 2Z1NA 4OXRA 3SR0A 4LZJA 2HMTA 3FOBA 3HCPA 4OATA 3GUUA 3KZKA 2I99A 3R09A 5KDLA 2I71A 2EJWA 1S9HA 4TLDA 1KRWA 4HX5A 5BNZA 2ZIVB 3QLJA 3TQFA 1G5HA 3KJHA 4RDCA 1SQSA 5JH7F 1UBEA 3FG9A 1ZU4A 3Q11A 5B30A 4XPIA 3L40A 3KYDB 4MP3A 2O0HA 4MZXA 4LOIA 2ZUEA 3AVWA 4KQHA 4HBGA 3F7TA 3IR5A 3V8RA 2XRZA 4BLTA 1KGDA 1FMCA 1Z83A 2ZRDA 3Q15C 1J00A 4GX1A 4ZO7A 3T7AA 2BMDA 1AU9A 1CF9A 1EFAA 2VQ6A 4L16A 5EE5B 4KAHA 1HR0B 3BIFA 3NBMA 1X77A 2H9AA 3BAZA 1SCUA 3F5QA 1QDUA 3KTOA 1PQUA 2WFLA 4FILA 1WABA 4NK5A 2GKSA 5JJBA 2X1HA 4W6ZA 4XB6B 3RIGA 4RVHA 1SD2A 2VTDA 5EIHA 1VJGA 3GGSA 2EOAA 3IDZA 3PC7A 1SVKA 3PNYA 5E4YA 5H3LA 1O89A 3ZX5A 4PG8A 3EGCA 1EPUA 2IUYA 1RYMA 3U4HA 4DJ5X 4H59A 1JSXA 4BNLA 3AEZA 3KOYA 3B1WA 2PJZA 3D7NA 3LW8A 2Z08A 1ZD2P 3QPBA 2JIBA 4XOIA 5JYEA 4C13A 1NUHA 1J0AA 1RIIA 1Z17A 2QNBA 1SC1A 3ZJUA 2OECA 4BVFA 1YIOA 2BPOA 4WGGA 2EW2A 1T6YA 3KJIA 4IIEA 3V34A 3TXYA 4BLUA 1V1RA 1PJCA 5A1JA 3TNDA 2QMUA 4UULA 3N8NA 1VI5A 1HC7A 3SXUB 3FYTA 3ZW7A 1G6OA 2R5FA 3U16A 1KARA 2VWQA 2FZCA 3KQHA 1RJDA 1N3IA 3WHKA 1MT0A 2CXRA 3A9RA 4BATA 3RRNA 1NOJA 1IHOA 3D8UA 5HUHA 5EIXA 3AOEC 4MSUA 2WYWA 3ZLBA 1D4FA 1TM1E 1IATA 3WIVA 3VJKA 1VBNA 1UEXC 1T5SA 1QV9A 3JATB 3EZ6A 3KQTA 1CJUC 2V6GA 4ML3A 5C1BA 4B3GA 1NU6A 5CGZA 3PQ7A 1T9GR 1KTIA 2B8EA 3HEAA 1BRTA 1MD9A 2JLWA 2XMBA 2QTZA 1JJBA 2CHQA 1UMBA 3VM6A 4BKRA 3BTUA 1F0YA 1YOVA 4UPDA 4LYHA 4W4TA 3BE5A 4DLLA 5U1PA 2FX5A 1FYWA 4LOHA 1IZ9A 1DP4A 5I8ZA 4F38A 2G5GX 1GL9B 2Q9BA 5B2ZA 2G9NA 1NVGA 4KU4A 2W2QA 1TGYA 3L7NA 2QX9A 5K0CA 3D3NA 4D4KA 3CNLA 2B36A 4DJTA 1A2BA 5TS3A 2QTGA 2PMDA 3EEYA 4KRGA 4MWBA 3TI7A 3M5DA 1EP1B 1IJEA 4HAZA 1WU8A 1KQNA 1XZHA 4F6RA 1J2YA 3MC1A 4EO9A 1D03A 2JDIA 2XCQA 3NAGA 3IIMA 2H5IA 2GJSA 4EN4A 3UYLA 1MKYA 1XMQB 3JQ8A 4R1NA 4TSKA 4QOIA 4BMSA 3IPLA 4UTNA 4PIVA 4J4HA 4PO1A 1IB0A 3F3KA 3C16