3RU2A

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadph.
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 180
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3ru2A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3ru2A02
2I5BA 3PL2A 5C40A 2QCVA 3NCAA 4PVVA 4O1LA 3NL2A 3RSQA 5C3ZA 5CGAA 2DDOA 1LHRA 3B1RA 4YWRA 1UB0A 4X8FA 2ABQA 1TYYA 3CQDA 4LCAA 3VASA 3DRWA 4K93A 3RTEA 1TZ6A 1LIOA 1RKSA 4E8YA 3RU2A 3IQ0A 1EKKA 2AX3A 5TQIA 1KYHA 2Q5RA 3NL3A 5C3YA 3RSGA 4K9CA 2AB8A 4DC3A 4K8KA 3RO7A 4KALA 5BYCA 3RTAA 3ROXA 1YHJA 1RFVA 1RKAA 3NBVA 4S1IA 4C5JA 4WJMA 3KEUA 5C41A 3IH0A 3EWMA 3UQEA 3RT7A 2ABSA 4DU5A 3LKIA 2NWHA 3RS8A 4JKUA 3OTXA 4XCKA 2FV7A 3RQ5A 4LBGA 3RRFA 3RQQA 3RU3A 2YXUA 2JGVA 1C3QA 2F7KA 2R3EA 3IKHA 1LIKA 4LBXA 5EYNA 4C5MA 3MBHA 3I3YA 3KTNA 1DGMA 2R3BA 2AWDA 5BYEA 3PZSA 4UBEA 4N08A 3HPDA 4JKSA 3BF5A 4C5LA 3D3KA 3ROGA 1YGKA 3RS9A 2VARA 4KBEA 4K8TA 3RPZA 3RSSA 2DDWA 2HW1A 4KANA 2RBCA 3UQ6A 3RM5A 3N1CA 4O1GA 3K5WA 3UBOA 4EN4A 3W4SA 4XDAA 4C5NA 3HYOA 3UQDA 1RFTA 1JXHA 4B8SA 3RPHA 3IN1A 3KZHA 3UMOA 3RSFA 1ESJA 2C49A 2I6BA 4S1HA 5CM5A 1VI9A 3RQ6A 3GBUA 3ROZA 3JULA 3NC2A 1WYEA 4K8PA 2PKFA 4E8WA 5BYDA 1RK2A 4E8ZA 3VAQA 2PKMA 3B1NA 3B1QA 1LIIA 3DZVA 3HICA 3LOOA 3LHXA 3Q92A 4N09A 3RRJA 2F02A 1EKQA 2AJRA 3NC9A 5TRWA 3RQ8A 2DDMA 3KD6A 4K8CA 3B1OA 4KAHA 4E84A 2JG1A 4EBUA 3FHXA 2JG5A 3RT9A 1L2LA 4E69A 4U7XA 3IBQA 1RFUA 1U2XA 2QHPA 1JZTA 3Q1YA 2A9ZA 3RREA 3NM1A 1V1SA 1GC5A 1V1AA 3ZS7A 3RTDA 3LJSA 1VK4A 4XF7A 3NL6A 1V19A 4GM6A 4EUMA 2HQQA 4B8RA 3GO6A 3H49A 1UA4A 3BGKA 2PKKA 2DG2A 2O8NA 3GO7A 3K9EA 2PKNA 3NBWA 3B3LA 3UMPA 4K9IA 1ESQA 4C5KA 2C4EA 5CGEA 1JXIA 3QAIA 2A9YA 3RQHA 5BYFA 3B1PA 1YGJA 3UQ9A 1LIJA 4XF6A 3D3JA 1LHPA 4E3AA 3RRBA 2AJPA 3IE7A 5F0ZA 3NL5A 3RNOA 1GQTA 5COJA 3RQXA 1TD2A 1TZ3A 5EY7A 3MBJA 2XTBA 3RQ2A 2HLZA 1VM7A 4S1IB 2DCNA 2AA0A 4LC4A 3RTBA 2V78A 3QA2A 4S1MA 3RO4A 5B6AA 4EOHA 4JJPA 1BX4A 1RKDA 4YL5A 3RTCA 2I6AA 3ROEA 3H74A 3RTGA 4KADA 1V1BA 5F11A 2YXTA 2AFBA 3RY7A 3NM3A 3FHYA
chains in the Genus database with same CATH superfamily
5LMUB 5ARBA 1WZUA 2DB3A 4YYZA 4OU5A 3PQ3A 4FMCB 1P3Y1 4HQRA 3SNHA 5BNTA 2WSIA 3HKBA 3TFWA 4XZ3A 4WEQA 1PVDA 2EF0A 4OHBA 4HFMA 3TE7A 1IHPA 4OXXA 4LVCA 4LCAA 1GDHA 2REOA 5BV7A 3Q8MA 1OI4A 2Z9CA 2QPOA 1NVAA 2W6ID 2ZIEA 4R83A 2QW1A 1Y4DE 4AUEA 2FK8A 2WTBA 3REQB 1LF0A 2NVWA 3F4BA 4GLFA 2OILA 2JCYA 4HN4B 4NFHA 4X85A 5EWLB 2YHUA 3NHBA 2PZ8A 4NJEB 1C30A 2BTOA 2DGDA 2VK1A 1E2UA 3HB1A 4I3HA 4L0DA 3ZE1B 2EIXA 3AIOA 4XVQA 4NFSA 1SK8A 4NR0A 2PL5A 1PYOA 2XVYA 2ALJA 4UEQA 1Y0BA 1E3WA 1L7QA 4B2IA 2CEKA 3QLVA 3GRYA 3DJFA 5IKXA 4ZHQA 3MHPA 4WPGA 2QJOA 2LW7A 3P2YA 1W0JA 1RVDA 3AB7A 1HLFA 1V9LA 1GR1A 2J4FA 1Y37A 4BVLA 5HQ3B 4DL9A 2XOKA 3CZQA 1C50A 1VIAA 4M1YA 3PRKE 3NTXA 1R0SA 3LCUA 3OEYA 4J0FA 4U7HA 5IN5A 1B2LA 1XA3A 4QOJA 4P3PA 4Z49A 1J49A 1Y81A 2O7NA 4HY3A 5FAXA 5B2EA 4CPDA 3NKFA 2HW1A 1BRMA 2R4TA 4PR0A 2RBCA 3CC8A 2A0KA 1G5FA 3VH3A 3OLXA 4ETMA 3R75A 4HWPA 3P32A 4Q1BA 1DLJA 1L5ZA 4R9UC 3ZKWB 1KJZA 1UBKS 1H8HA 4DNXA 3MUOA 2LXNA 3AB8A 4G5RA 5WRFA 5B1IA 1E6CA 1ZMTA 4LJLA 3D02A 4Y9DA 4ZT7A 2BSXA 2VHCA 3SYKA 3EWSA 2RAVA 3VSEA 4F97A 1GTJ1 1SKMA 1I2BA 1U0JA 2VJQA 5GZ6A 5KWEA 4DWWA 1ENYA 3LL4A 4LHXA 4B81A 1OX4B 3PFIA 1R12A 4MQ5A 4M1MA 2RHBA 4UBKA 5TJ9A 4ZRMA 4UBOA 4ZALA 3HEBA 1J1ZA 3BDIA 2OC4A 1NBMA 4WMLA 2JZOA 4C3OB 3WOVA 1ZOSA 2VCEA 3NP9A 2BFMA 4F04A 1RCTE 1UINA 3H3JA 3PYLA 2XZTA 2Z6QA 1UZMA 2XNJA 2Y76A 5F76A 4A23A 1I5RA 3ZBPA 3KR9A 1WVGA 2CLLB 2QN1A 3T5GA 4BP3A 3QITA 3OE1A 3NBYC 1R27A 4F5EA 2IITA 4L4ZA 3G7NA 3IP1A 1A8HA 4RF5A 4NG5A 4KAAA 4RHXA 5L53A 4HMQA 1JZQA 1XLVA 3NLLA 1BN6A 4IDAA 4PGHA 5CGEA 1G8SA 1P62B 4J91A 4CQJA 4RHEA 1PR2A 2PS1A 3Q7SA 1GTG1 1ZN8A 2UVQA 4ZT3A 4CMBA 3T8YA 3OZ7A 2GM4A 1NXSA 2ZJ0A 4QFDA 4BQFA 1AKVA 3JZAA 3NDJA 3NOVA 1PWZA 2NZ2A 1JAYA 4HF7A 2PX2A 2I8AA 2FXVA 2EYQA 5E6RA 3V48A 4D02A 1GPH1 2ZT6A 4D3FA 4JJGA 5B7GA 1TC2A 4ZDJA 2F1IA 3B2EA 1DARA 3NBUA 1M2GA 1ST2A 5KWVA 2V78A 2EP7A 3ZH9B 4DGSA 3LYHA 1B26A 3OKFA 2OOKA 3SIPA 5J4HA 4P98A 1CFJA 1FX0A 1MC1A 1VJ0A 2V7UA 4QDXA 2UZIR 2IK8A 3LT1A 3OKCA 2P40A 4HNHA 1PSDA 3L0BA 1HETA 3NYIA 4ZQHA 3LCJA 2FPGA 4K8OA 4ZDIA 4KRFA 2C97A 2WF5A 1A2BA 3CH7A 1T4DA 4KQIA 4UUBA 4A2PA 2OBXA 3ZGNA 3V8RA 1PJAA 4RVHA 3RWBA 4XVRA 3U7RA 2Q21A 3SR4A 4C2TA 1N2IA 3HDTA 4BNMA 4BMCA 1XDWA 2OO3A 4HS9A 1CIPA 2WLSA 4HAVA 4HDCA 4KO4S 4E8WA 4CQMB 2NVBA 3U3RA 3W4IA 4TL8A 4E1VA 3E9YA 4WNAA 1PJRA 2V7EA 3TD6A 4CTJA 3K70C 1ONSA 2ID4A 2B36A 3AIIA 3DAPA 4RIEA 3AWIA 1T9HA 4D9HA 5CB4F 1ZOOA 4XIYA 3ZYZA 4PGFA 2YVQA 1CJVC 3GA0A 4TLMB 4QYIB 2X0NA 3DMFA 4RDXA 1FFYA 4C0JA 5C7IO 3A0RB 2H59A 1FNNA 2OGTA 3CM0A 2GTIA 3LYUA 3OIYA 1W59A 4P81A 4DA9A 5EGNA 2QSUA 1OILA 3VPCA 3JQ6A 3VZDA 3T5BA 4S1OA 2XZLA 4XUCA 2Q3JA 1JEQB 3BEDA 5EIWA 3T4XA 1V6AA 3TAUA 1ZOIA 5HX7A 1HDCA 4V39A 5DCUA 1JX6A 4JKSA 3QV2A 4BFWA 4XI9A 5HZKA 3CPJB 1FB5A 2PAFA 3HJCA 2Y2VA 3PG5A 3V4OA 2KM1A 2DT8A 4BV8A 3Q7PA 4O5OA 3CU5A 3D6AA 3FCXA 2Z4TA 3JSXA 4Z1OA 5DYNA 1N32B 1O08A 3EW7A 1M6YA 4WK0B 4A8TA 1XA4A 1LLCA 3OQMA 1Y7TA 1GDDA 1RXEA 3NH6A 1F17A 5GONA 3DVSX 3ZHSA 3PXDA 3ELBA 4F9GA 2NSHA 3OIFA 5FTNA 4D0RA 5K3SA 3LNCA 1UQRA 2HSEA 1LLFA 2FDRA 2PS0A 2QG6A 3ANLA 4IJWA 4OA8A 4RY9A 1SIOA 1IBSA 3ZK8A 4RD2A 3IXQA 3T7RA 3NC2A 3MERA 4TMTA 5AI4A 2RAUA 5EZYA 2VQFB 1F3OA 3JCZA 1N5LA 4N0QA 4UZFA 5BYDA 5HMLA 3GIDA 1PFUA 4RTOA 4KFCA 2BKLA 4U6SA 2AMYA 2WF9A 4DR2B 2MSNA 3KOOA 3CURA 2F1OA 4GM4A 3RE1A 1KEZA 3HYRA 2OCXA 4XGQA 2AG0A 5JD5A 5YASA 1DG9A 1OI2A 2Y67A 1A4RA 3I32A 4MPPA 4D0LB 1PJTA 4LBVA 4DZTA 3KSBC 2X8JB 4XSGA 1NU8A 5H1YA 1KI8A 4MVJE 4PQYA 4FYXA 1U2DC 4BQEA 1GUAA 2QYOA 3KKPA 4YC7A 3SC6A 4DRXB 2FLVA 1H5UA 2HDNB 5DBGA 1XRSB 5IX8A 1W25A 3A1NA 2DETA 2H1IA 2FFQA 4UXIA 2WAOA 1CETA 4YDSA 2VTKA 3C4JA 4H17A 5L7YA 3ZHXA 3G89A 2ERYA 3D3JA 2AJTA 2O1SA 1IQ0A 2B7BA 2EGUA 1WXFA 2F9LA 2A4MA 3H5VA 1I3CA 2GEJA 3M82A 4M83A 4J1SA 5E6UA 2OAQ1 1GP2A 4W1PA 4W5NA 2XUZA 4MUXA 1HSOA 4BCDA 3FIUA 4AJEA 3STYA 5CBKA 2R00C 4XTCS 1EXWA 4AWXA 1ZJWA 1ZK1A 2RG7A 4F4DA 3EIXA 4IDDA 4HDNB 5CB6A 3I5XA 5CNIA 1IRIA 5FOXA 5I4CA 5A7HA 1KK1A 4P4SB 5IDQA 3IYLW 1PGPA 2Y1FA 3M33A 4X1YB 1HDOA 3Q9NA 4OJMX 4XSVA 5EQTA 4UUNA 4J76A 1KDYA 2OYCA 2RG1A 1GNRA 1ZEMA 1SZPA 2BMWA 2G9VA 2OG2A 1T9GR 2RH4A 2MYUA 3DTVD 4O4IA 4QD3A 4WNAB 3WJAA 1SULA 3OZAA 2I6TA 2A84A 5EJIA 4G37A 3BMCA 1PV4A 1AZWA 1XYYA 2DTXA 4WNCA 1SIBE 4F21A 5K8VA 5A4KA 1KHTA 1XZNA 5CJPA 2WU3A 1U0SY 1VHDA 3RQSA 3CH5A 2RGXA 1CZKA 3N2NA 3BXHA 3UQEA 4RPHA 1DC7A 2W2KA 3ZEAA 4XJXA 3UH0A 2YW9A 1PKEA 4Q18A 1DCMA 4JBHA 4DVJA 1F51E 1SU6A 4A1OA 5TARA 4IXTA 1DI0A 1KEPA 2IXGA 5ERYA 1R8XA 3GUZA 1UP4A 3GEDA 4Q4HB 2EWMA 1YZTA 4KE6A 2DT5A 4HMOA 1DT3A 3MTAA 1ZONA 3EPRA 1T5IA 4GT1A 1JMVA 2RHWA 2GLUA 2NQ2C 3PLRA 5ECDA 3ZWYA 4ZA2A 1FGSA 2I55A 1CUYA 1RXIA 3WGTA 2C29D 1DBRA 1GRQA 1ZWKA 3K0KA 3DPIA 5EXEA 1SVUA 4B17A 4I5IA 5TQ2B 4WERA 1IB6A 4B3FX 2YWGA 5AM2A 1D2HA 2FMFA 1UDRA 3LPNA 3ZQ6A 1ZJ5A 1SIUA 1MDBA 2VPWA 4YLYA 3VZRA 2GSWA 3WLSA 1KYYA 3H1TA 3NBQA 5IFKA 4J2HA 5DISB 4RJIA 1XD2B 3EHEA 4J1NA 5LXTF 2DXIA 4CKCA 1P9NA 3H16A 5BUSA 2PFGA 3ZZUA 4HCJA 3U44B 1OKKD 1SOVA 4B6QA 1NJ1A 2YVKA 3WIOA 3WQQA 1TM3E 1TYZA 1X70A 2IWHA 4IRUB 1E1YA 5CPFA 1FDIA 5M04A 3FBGA 1TUBB 2Q07A 3CZCA 1M34E 1XK7A 1MW9X 1USGA 2OZLA 2C07A 1AKUA 1TMYA 2JG5A 4BEWA 1WCV1 2GPSA 1RFUA 1WPXA 5EESA 1WXGA 1RTTA 1MAWA 4FE4A 4GZ5A 1X7YB 4O4JB 4ITUA 1H2XA 2PMWB 4JUDX 5AWFC 1LFAA 4BL5A 3CONA 4ON9A 3E23A 1FTNA 3H9UA 1JA9A 4KDFA 4KMSA 5E7MA 5HDBB 1Z0JA 4ZKEA 4B4UA 3UZUA 1Y8RB 4YCJA 4D3XA 3FLEA 2JFPA 3B2QA 5DI3B 4DCGA 1JU4A 1ZNYA 3ABIA 3CYFA 3HCEA 2YXNA 4KDCA 1WMDA 2YYYA 3EFOA 2E85A 1XL0A 4RA9A 1Y1RA 2J09A 1PNTA 2YYAA 3ICVA 5KI6A 3M81A 4LE1A 3ZN2A 3RAJA 3RJTA 1E4EA 2FFHA 1GQRA 2DCNA 3IAAA 1OVMA 2Q41A 1W36C 1Q7CA 1UJ4A 4Q7EA 3Q6MA 4Z9BA 4C6RA 3ACDA 1VC2A 1YU9A 3N8IA 2HSDA 5EE5B 2BFDB 3IE2A 1W34A 2DCUA 3KVYA 3ZG6A 1O0BA 2CHGA 4RXUA 5T7BA 1V5IA 5BOSB 1GNLA 4DJEC 3CSDA 2YWCA 1AZTA 2BFCB 3UKDA 3SKVA 2H1FA 4CM5A 3NTQA 1UDWA 4C13A 1TI7A 2V4MA 2VL7A 1G38A 1BHO1 5G4KA 3NEPX 1TZ2A 4JZKA 3K4QA 1XZGA 3CRVA 4YAIA 3HR4A 1MW8X 3DZBA 3QOFA 5KNDH 5ARDA 3QVGA 1XEAA 1F06A 3PJRA 1KYHA 1P75A 1JG7A 4NCJA 4B09A 4G0ZA 3X1ZA 2B98A 2EFCB 3GEHA 3QFSA 3RVBA 4KK4A 2QV7A 4RU1A 3V8PA 3ZWXA 5KYNA 1U1CA 2YCLA 4LYDA 1JXMA 1Y3AA 2JEYA 3M5WA 4M54A 2V7BA 4ZT4A 5C8ZA 1RAAA 2ABSA 3JRXA 5CLHA 2HRQA 1VECA 3HJNA 4ZOCA 4EENA 3ENKA 3EPKA 1AKRA 3P9IA 1WSWA 3AEXA 1MZVA 5IH3A 2O1XA 3Q3CA 4GOND 3TVTA 3ONDA 4O02B 3DOUA 2D5CA 2YV3A 4HXEB 4OD0A 2OGZA 3GR6A 3U7QA 3WNBA 3LQYA 3WHIA 3CR7A 4YT5A 3Q1KA 2NSLA 1HWYA 1ESMA 3GARA 5KTKA 5KNDA 4FDTA 1OB5A 1UMCB 1VPLA 1QK3A 2GUWA 3EFOB 2HHAA 3CGGA 3QXGA 9LDBA 1L5SA 3L77A 4BHTA 1OAKA 1Y8RA 2Q8QA 3ETDA 4GZLA 2WNHA 1G64A 1E89A 1N8TA 2VXCA 3CG0A 3WRWA 4CIDA 4MR8B 5IW8A 1EUCB 2B94A 2YINC 3BQ9A 1TF5A 3DDNA 4LYFA 5CM5A 4D4LA 1H94A 1JSRA 2Y4NA 1XZHA 3AX6A 1NWHA 2COKA 3B36A 4TKVA 5KOYA 1F8YA 3VNUA 4JBNA 2ZETA 3DMNA 1C3OB 3G1UA 3A27A 4UMVA 4IMRA 1PTJC 1JQ5A 1U28A 1CZRA 3DOIA 3ZH2A 1JQLB 5BN5B 1F7VA 3TYXA 4XCVA 3H4IA 2L69A 1DEOA 3PA8A 3B38A 4R1PA 3OQNA 2PUEA 1DFIA 1KEWA 3AOEA 3GNLA 2G76A 4LOJA 2VFAA 4MR9B 2ZYWX 2VZ9A 4PLYA 3KOWA 2NXCA 5EKSA 4RTSA 3FHLA 3M6MD 2BTQA 2IOYA 5LQAA 5LDHA 4QX6A 1OASA 4G07A 1Q16A 2P41A 5A3VA 4JVNA 4CKCB 4U6QA 1GV1A 1Q44A 4NE7A 2I1QA 3EMBA 4KIGA 3MLBA 3N75A 4PZPA 4QEKA 3VC7A 4C4OA 1TFUA 2EJBA 4ME6A 2K7FA 3WFJA 5DYYA 1XAHA 1EWVA 2R68A 4ZO7A 4CM1A 4IIGA 4P7BA 1TK3A 5BW4A 5KX5F 1V96A 2C98A 2FPGB 3DC2A 5DJ5A 5G1PA 4EA9A 1U2GA 2X5JO 2RJNA 5KYXB 3WYGA 3IUQA 1ETHA 2NU6B 3B1ZA 4RF2A 1JAZA 1UBJS 2GHRA 3UGTA 1Z0FA 1RMYA 4FLEA 2RBGA 5B57C 2EKZA 5J23A 1CY1A 1Z4LA 2YR0A 2NSDA 4MO2A 3RTBA 2WIJA 3A7EA 2SHKA 1DTWB 2O2XA 4HQKA 4EOHA 4WN3A 5FOQA 3L8YA 3LLMA 3UMMA 3DDHA 1E2IA 3RY7A 5D5QA 4XYMA 1E2JA 1QHHB 1Q14A 4YMTA 4PYRA 5B7NA 1ZSNA 2GVDC 1M2JA 1OLSA 1U4SA 3PL2A 3OQ6A 4YRBA 1YRLA 3DP7A 4ZJUA 4N5HX 3U60B 2VDMB 2AB0A 3PXAA 4QHSA 4WL0A 4YRPA 3ME5A 4DANA 5LSAA 2XY4A 1YRHA 4G86A 4M37A 1GYRA 1GKLA 2OZKA 3KO8A 3OFND 4MS4B 3T0GA 3VUEA 3DAGA 1PQPA 5LZ9A 3IPYA 2VAVA 3OTHA 4IXMA 4MGKR 2CXTA 4V1CB 3HP1A 4YCLA 2QRNA 2IS6A 3COZA 3KJGA 3G6WA 2YN0A 4R2XA 3OA0A 2GD0A 2QYSA 2P1ZA 5BSGA 3QUSA 5K0EA 1Z7BA 4MVCA 4AJ1A 2WNIA 2ESRA 1A95A 3ORQA 4FX2A 4MUKA 1J1IA 3RI3A 4H3KB 2IQIA 3VTAA 3FI0A 3WQBA 1N9GA 4D3ZA 4YMLA 2C9MA 3V2UA 3D7LA 2YHIA 2CL5A 3LKZA 1RPAA 1Z2CA 2PUJA 4JVMA 3FYHA 2JIZA 2NX2A 3TLXA 1W4CA 3KZXA 2REXB 3HBJA 1N6LA 1E61A 1SKAA 1OX4A 2Q3HA 2VP9A 2A5YB 1GQFA 2A9KA 2PD3A 4Z8XA 1ZW6A 2YMPA 3MWDB 3WYEA 4QYXA 5E6UB 5BY2A 5KSYA 2AM2A 4BNDB 4GLLA 4I1VA 2MSCB 2N1MA 1JFFA 3P2JA 2O0MA 3W1WA 4CIAA 1ULUA 4FC6A 3PQ4A 1AF4A 1Q0HA 3IAM1 3OT1B 4FYHA 3SLKA 3DO6A 1O5IA 1SK9A 4OP1A 2IDJA 4HJRA 1WO8A 1M2OA 1LSJA 3OLQA 4L8LA 4CI9A 2BH2A 1ENPA 1XLUA 3EW9A 5FYDA 3ZC3A 1QIIA 5PNTA 1CYDA 4OGKA 4G26A 3DO5A 1PWHA 3TL2A 4N47A 4WWHA 1GPYA 2IZ7A 1MO2A 2PM8A 4FZ5A 2IS1A 4YRAA 2C88A 2CVOA 2HQOA 3LPLA 4NIMA 4I1RA 5FT9A 2AIRA 1T9DA 1RKXA 1USVA 2BFDA 3Q3VA 3QKSA 4RKQA 5H4HA 5GQSA 3ZDFA 3U6KA 3PU6A 1YQ9A 3INNA 3OZVA 4KAFA 4IDPA 1XMXA 3PSHA 4GI1A 2Z08A 1QYWA 2IEZA 3FGZA 4GOXA 1DO0A 3UK7A 2NN3C 4EARA 1V16B 1BVRA 4RJTA 3L9WA 4YN3A 1L2TA 4R7GA 1ZLXA 1P2TA 2AOUA 3LP6A 4RFVA 4MV5A 1CYEA 1YTUA 1EJBA 1P0QA 2HU7A 5JCPA 3AV3A 3JAWB 4P3OA 4A91A 4JK3A 5DI3A 4BYGA 5BSKA 5C32A 1W6UA 3NM1A 1NVTA 4QRHA 2GO1A 3CZ5A 4L0MA 3B7PA 4IDCA 4J90A 3EUAA 1S9DA 4KFTA 4XKJA 1V1AA 4R3NA 4N5NA 4UFNA 2GHQA 2OHHA 4X84A 2B2XA 2FPIA 2I7VA 4BO2A 2JLXA 3H8VA 2PA0A 2DG2A 2C4VA 2AHRA 1N0WA 2PGOA 3HABA 3NM5A 4GHWA 5F5NA 1Y6GA 3QEMB 2MR5A 4Q7MB 4X6YA 1CJMA 3L6DA 1Q12A 3HJAA 2QP3A 1WXIA 1A7UA 1D6MA 2PMBA 2P2CA 3C1OA 3EJWA 1OXBB 2XEXA 3AR3A 4I9FA 1AE1A 3SZLA 5DTIA 4D4IA 3I1JA 4X93A 2J87A 2WA1A 3WK9A 5GINE 1MAVA 4ZVQA 2D1RA 5LP6A 1P2VA 2RGRA 1M8KA 2NUPA 3P5BA 2D5AA 2RGAA 2QRMA 4PCLA 2NV6A 2AK3A 4B7XA 1RT9A 2WYUA 1T29A 2X9VA 4EG8A 3D31A 4RV9A 4BEBA 2FZLA 4ND5A 1EP3B 2ZIAA 2B34A 4U4AA 5IYZA 2YXTA 3UVEA 3BJRA 3I30X 3V2GA 1JBWA 1AGPA 4UMFA 1O6GA 4GH5A 3A6KA 4FDUA 4Q3AA 2ZJFA 3KHTA 1HRDA 4M8LA 1D6SA 3W7VA 1T0PA 3QY9A 1GZVA 1Y3HA 2EW2A 4M9CA 4PFSA 2VQEB 2DDOA 4IRXA 1DJMA 2UVDA 3CXRA 1QM5A 2ZDHA 1N4AA 4JVSB 3FTFA 3C1TA 3GUYA 4K93A 4FUQA 2IYVA 4YP6A 4NJMA 4NV3A 1IBCA 5B64A 2Q2WA 2GKSA 4R2KA 4IV8A 5B1HA 2YDYA 4UUMA 2XBUA 3ITEA 2JFFA 2JVKA 5SYAA 1JG6A 3DEIA 1QRTA 3MMPA 2NU8A 1QE0A 2DZDA 3G5LA 2ZJ4A 4AF7A 3JALA 2JIRA 5CDFE 5FD8A 1REQA 1EFLA 1T15A 4GI7A 1OLSB 2AEFA 4IFIA 2DBVO 3KUUA 2UU9B 5ALDA 1W7KA 2BR5A 3PEVA 1FDSA 3WKBA 4X64B 3X1KA 3ZIAD 4C7JA 1M0EA 1YVUA 2M6KA 3A9RA 1DXHA 3ORRA 4W6QA 4KQ6A 3KTNA 3F7NA 3V1NA 3MWGA 1P6UA 2ABWA 3G85A 1KQFA 3BMQB 3BWXA 3P27A 1M83A 4C30A 3VR6D 4KPGA 3EYWA 4ZXPA 5IZCA 2DQ4A 3AJRA 4IF4A 5EKDA 4YT8A 2AW5A 2VF5X 2NMVA 4HN2A 3PNLA 2CLOB 2CK3A 2GB4A 2HJ9A 3I9LA 2HXSA 4OB7A 1I13A 3O21A 4IZOA 4LV5B 2BPOA 4YCDA 3T7DA 1Y5LA 1H3NA 4P4SA 4PLTA 3V4SA 4F1WA 2FPPA 3ZX5A 5B2ZA 1MO5A 1YL5A 1Y9JA 3QW2A 4MYUA 3CLTC 4E5UA 4N7RA 3F3MA 2L19A 3QHQA 3W5CA 3FJOA 1E9RA 3KXDA 4DLVA 2NAPA 1TK9A 1W36B 5CXUA 1YV9A 1HQDA 5F5LA 5H70A 3T3EA 4F2HA 3ET4A 2HA4A 1MFZA 2D7JA 1XMJA 1DFGA 3IKHA 4IBOA 2IBSA 1FMLA 2AN4A 3HA5A 2V97A 4QOGA 1R1DA 4KB5A 2R1TB 5F33A 3A2KA 3SYMA 4IHJB 1KKLA 3HGMA 3OJEA 4L5AA 4HH1A 2ZB2A 3OEHD 5FBLB 1SCJA 2G82A 5KDOA 2IZ1A 3L7MA 5E3IA 2ZYTX 1OLOA 1ONBA 2GGSA 2XB6A 3FLAA 2BEJA 2H16A 3GGOA 2NT4A 3IDFA 3GMSA 3P0FA 1VRCA 1BVUA 2RKBA 5DH9A 1PQWA 3LVRE 5JCJD 4CKEA 2XQVA 3DOJA 1N5IA 1I1NA 2RHDA 2GX6A 3WHPA 3WGVA 3DWEX 5U9CA 3E2MA 1YONA 3L18A 4X6XA 1E2GA 5BYFA 1YKSA 3T4EA 2I5PO 5BWBA 1RLJA 3CF4A 4MQMA 1HEUA 5SZHB 3PF9A 1KI4A 4Q7JB 1GSOA 3KPYA 4QZVA 1U9YA 5CFRA 4MI1A 5DFAA 1TRKA 3K0FA 3K9NA 5E7QA 5DM60 4HNAB 4YO7A 2J5KA 1AC5A 4OATA 1TA4A 1DAIA 5AI5A 1VL1A 2ZPTX 3C3XA 3C8ZA 3NNDA 2J3JA 3GNTA 4ZYUA 5A6SB 1OBCA 2CCJA 2FEKA 1RWBA 1SVWA 4OF4A 2QL7A 3RR2A 3GJ3A 5DN6D 1BIFA 1ORRA 2VHYA 3JAKA 4CLXA 2FA9A 3PGXA 4FQ5A 3INYA 4GX2A 3ZM6A 1X8JA 4PAGA 1WW3A 1LHRA 3CE9A 5AVYA 1RTKA 4NJEA 1T6BY 1QFJA 1VRVA 2WR8A 5EZSA 4ZVSA 3VYSB 3KYIB 2H2IA 5DNEA 1QC5B 4QPZA 1J9ZA 5FWYB 1DZIA 4BQQA 1ZVVA 1JDSA 2GK4A 2JI9A 2R5NA 5B1EA 4M8SA 3MWDA 3R5TA 2NP6A 1S2GA 3OAAA 1JHDA 1CVRA 2XUHA 3CUVA 1NUAA 4WJKB 1NF8A 1SG6A 2ZJOA 3GQBA 3AP3A 3WTBA 3RT7A 2PAAA 4ZQFA 5HPYB 4MYCA 1E96A 4FYKA 4IV0A 4DDHA 3STHA 3VV3A 1W0KD 1Z5VA 4B45A 4FE7A 4FMDB 4YFYA 2Q1YA 4CM4B 1UANA 2UUPA 2C5FA 4TXHA 3QKSB 4KFUA 3WNDA 3FHCB 3QX7A 4G65A 3WGGA 1U9CA 3QPDA 3NG1A 3TZHA 1IJEA 2OCKA 2WP8J 4JB0A 5FWXA 4CLOA 4V1CA 4WD3A 5FWNA 3RS9A 5JSFA 3PQ8A 1JHQA 3VNRA 3GCZA 4FYYA 3ACCA 4OH1A 4P7GA 3Q9SA 3DTNA 5A4AA 3AJ8A 3ZHCA 1OOEA 4BQOA 5KC9A 2GBPA 3UPDA 2BYTA 1EXNA 1ZESA 3KALA 1KO5A 1CSEE 3EZLA 1HO3A 3VGJA 1GFZA 2RJOA 1HG0A 4MLCA 2VCYA 3F90A 4KX3A 3HVRA 2QTCA 3I9FA 5JOQA 5FF9A 3DL4A 1W0JD 4M9XA 2B9VA 5JFGA 1UEXC 2XYRA 3RQIA 2YIDA 2J6CA 3AI1A 3ZQUA 3H8JA 5F7ZA 2ZRGA 2W6NA 3E5MA 2AEJA 2V58A 2Z8YA 3RRJA 1MFPA 2RK3A 2WU1A 4Q4JA 1N6RA 1R00A 4DILA 1EX7A 3PXCX 5HMMA 3G0HA 1D8TA 3NX4A 3KWLA 3ORSA 4PQRA 4D4HA 2WI8A 3OJWA 4RJ2A 5FQOA 3WGNA 2H29A 1V9CA 1L7MA 3FPSA 2QVBA 4FCVA 1T35A 1FMTA 4GPD1 3LC0A 1PGOA 3MTDA 3R8XA 1UM8A 1SG0A 3GY0A 2QPAA 1UEIA 3RIGA 4ETNA 2HCBA 3TLJA 4WZAE 5IKOA 4FMCF 3H2YA 4D80A 3B60A 4A15A 4MDEA 2JH9A 3BILA 1WVIA 5JCOA 2WLTA 1MAHA 3F3YA 3N0WA 1NNSA 4L4XA 3OTIA 2BDUA 5KC8A 3HU5A 1U9IC 1PE0A 2IP1A 4PEVA 1XCMA 3S40A 9ABPA 1A77A 2ZR9A 2XNDA 2KMLA 2VF8A 4CEIA 2F3UA 3IVGA 4KIJA 1ORIA 1K7EB 4LX0A 3TSAA 3P9XA 1LGYA 1QZXA 1KYQA 5HILA 1XTJA 2VHQA 3NHUA 3IERA 4G0MA 1C3OA 5DX0A 2PL1A 1UEJA 5MGNA 2FW9A 1VLQA 3HCDA 2WV9A 2NUBA 1YR7A 2P5YA 2FSSA 1P0CA 3CVXA 1XTVA 3P7MA 1QTIA 2H5IA 1L4FA 3F6YA 2FUG1 2Q9CA 4LKOA 4ZZ1A 1E6WA 4NK4A 5LQKA 4OEHA 4Z86A 1HKHA 4B5LA 3B78A 3FOBA 5I7AA 4YMVA 3AF5A 3I01M 3OJXA 4EO4A 2JATA 3D0QA 1Z4OA 4XSHA 4PSVA 2J07A 2I2FA 4CMIB 2JAWA 3RHTA 1Q57A 3B12A 5DLPA 1S01A 5LP1A 1K4MA 1KAEA 3BERA 4JOQA 3HWSA 4MKHA 1EHCA 3BRQA 3AFNA 3Q40A 1ZCAA 4B8ZA 4H4EA 4DT1A 5A4IS 3THSA 4I2NA 1LX6A 2JIDA 5DN6A 4NXNB 3A1WA 4Q4JB 4QFBA 2DHRA 2AE2A 2C9YA 3DE6X 2O1EA 4G9GA 2PRIA 4PHFA 1V2HE 9ATCA 2CNDA 4NBKA 3NKLA 5GVSA 1JDNA 5AVOA 1KHHA 1D04A 3U39A 5I8PA 3BIFA 3UJ3X 1AZSC 4XOUA 3ORFA 4DG9A 5BPFA 3H5WA 4EGQA 3NPMA 1NMYA 4ZVUA 3MBKA 4KR3A 3EARA 3PZSA 2FV8A 2YY5A 1RLUA 1JSXA 1UBHS 3A1TA 3R5SA 4FEEA 1GEGA 4MB6A 3R7NA 4BNXA 4HDOB 3RYIA 1GIAA 3AR9A 4H31A 3SJBA 3WRVA 3DH0A 5JSHA 3PVSA 3UMYA 1RM0A 1OH8A 1Z5WA 3GCXA 1NLMA 3CCBA 1D7AA 4MUIA 4HRYA 1NN3A 5G4LA 1JU9A 2AOUB 1P2FA 3MCTA 4RE5A 1GGJA 1DX9A 3B9RA 1R9JA 2D4HA 3GJ6A 1T6YA 2DHEA 4HLQB 4K3UA 1XDZA 2QX4A 4G63A 4U5XA 3S6JA 3WLLA 4BE4A 1AVTA 4MEJA 2B1JA 1HY3A 1LSUA 3BGDA 5DBOA 1J4AA 3ADBA 3R9XB 2Z2JA 4S0XA 4MQUA 4PNPA 1H2YA 1X7XB 1SRQA 2YN2A 1GGFA 4M4SA 1KMQA 2ASVA 4IMPA 3TTWA 3R9XA 3KTOA 4D9KA 1MEJA 1HC7A 1NMXA 1QCZA 2AYXA 1YQWA 1FS6A 4OBEA 1L7RA 1U0NA 1ODLA 2R6ZA 4QDZA 1ZGBA 5KYVA 1SA0A 4HSEA 2WTXA 4YBRA 4IIYA 3VOAA 1A4UA 3EXFB 1HX7A 3VHLB 4IVQA 1KO8A 1F8UA 1SQ5A 2CXHA 1K3FA 5DX8A 4V0RA 2IGBA 5DGTA 3WWPA 4CQLA 3ER9A 5F98A 4J2OA 4R84A 4PIPA 3CNLA 1IZ8A 3C14C 4GO1A 3WGMA 2JI6A 4DM4A 1Q50A 2B21A 3OTQA 3HEMA 1BG6A 4ZTUB 3OI7A 2CK3D 3JAKB 3PJDA 3R0JA 2PK3A 3H99A 3SX4A 5JMTA 4DRYA 2ZBEA 4ENWA 1J2TA 1DKPA 1K0UA 2GTHA 2RGUA 4UQPA 1T9ZA 3BFKA 4Y7CA 5ICMA 1QU3A 4K1XA 1TZ3A 9GPBA 5ES3A 3R4CA 4NOMA 1XQ9A 2OHJA 5HKAA 2QUAA 2XWSA 1FVFA 4CL8A 2BZ0A 3NJ8A 3WA7A 1R0LA 2UYCA 4B6GA 2XVZA 1EBUA 2QE7D 3MD9A 1E1QA 1ZINA 1GLVA 2PX8A 2RGEA 2YY7A 2PX4A 3QEBZ 2DH5A 3ILSA 1CC1S 5AQ1A 1H2FA 3RC8A 4MWGA 1S2OA 3WMGA 5ILQA 3KELA 4DCCA 4ENQA 2Y93A 3HDQA 1YKFA 1R8SA 1FFSA 1KYIA 1A5ZA 2F3PA 2LGJA 3MGKA 3B3GA 3LFTA 4ETWA 1VG1A 4LRUA 1ZHHA 1K86A 3CVJA 3O4RA 1RKSA 5A4MS 1XWIA 3RU2A 4OREX 5HYVA 1ZCJA 4B6RA 4ZARA 1AMOA 1ECJA 5C8XA 1LUAA 3Q8KA 4RD1A 2XUQA 3FPBA 1VG0B 1J0XO 3GRPA 2Y0BA 2VNHA 4ARBA 5F9HA 4YT4A 3CHYA 4YMSA 5EN4A 2FV7A 5FO1A 2IXTA 5FRDA 2NPOA 3GF4A 3HA7A 5DULA 3VR0A 4OQYA 3QIAA 4BNVA 2QL9A 1LBIA 1N3LA 4IGEA 4CF4A 1NPTO 2O0HA 2O9JA 3GDGA 4AJ2A 2GCPA 2H85A 2ZWIA 1OAAA 3RG2A 4NZPA 5I3ZA 4HUTA 4WAUA 2V8BA 4X7BA 2GF9A 3MOSA 3NHRA 4J94A 1EK0A 4QREA 1HNNA 1F4PA 4DLZA 5B4TA 2XMRA 1GPDG 3CUSA 4MP6A 5J5CA 2FH5B 4RWEA 5KQPA 4BO9A 5E3JA 3VQTA 3PUHA 2QMOA 2GAJA 4KOEC 1WDMA 2W11A 2XE6A 5TR9A 2FLWA 1J99A 4S1HA 4EBBA 1P80A 4QRIA 1E3JA 1SAYA 1F7UA 1SCDA 2FPRA 4FFOA 5JPIA 4BX0A 2YNMD 4KTVE 3QX9A 3HI4A 3HL4A 3G9QA 3IA7A 3A3YA 5HRCA 4ZKDA 2IOHA 3G2KA 5D3MB 3ZDBA 3PQ7A 4G4JA 3LDHA 1YR3A 4TT8A 4R1NA 3PYXA 1QIDA 4JLAA 3EGIA 1KMNA 4US2R 3I12A 4U2EA 5D84A 4R05A 3JYPA 2QQGA 3S2UA 1B8NA 1TYCA 2GPAA 2HR1A 3NALA 1LKZA 2DLDA 1VE1A 4PZ0A 4C0LA 1DDIA 4X20B 3M4NA 2IE0A 2FPIB 3DMYA 3JRNA 1H0KA 1QRRA 4JMPA 4JT4A 4LSWA 1YD7A 3CBGA 3OKAA 4GR4A 4ZYLA 3L7YA 2QDKA 4E14A 1I7DA 5EEHA 2O7RA 4HVCA 2YASA 4RLFA 3G2LA 2NXNA 3GLHB 4J4HA 4Q34A 4AROA 1S2DA 4ZP1A 4CM3A 1GG4A 2A9YA 4HDNA 3OTOB 1L6RA 1ZUHA 4RJJA 2QRHA 4YUAA 1FFBA 3T1HB 1IRXA 4FSHA 2G25A 4RAQA 3MJRA 4ZCPA 1VE6A 3E9EA 3NVMB 4B3DA 1FF9A 1QIGA 2WJYA 1XG5A 3FUVA 1CKEA 4JB3A 4XB6B 4BB5A 5HQ3A 3H9GA 1RZRA 2GJAA 4LY0A 1IAQA 4LC4A 5FXMA 4D9IA 3A58B 1UFOA 4KAJA 3AR5A 4MV0A 1BQ4A 5JAUA 4EG3A 1CUFA 1H4VB 2IBMA 1UFQA 4CR7A 4AZ0A 4K0KB 2J45A 3GMIA 2P9CA 1YA6A 4PC7A 3QHPA 1C0KA 3UWMA 2XMZA 3I9V6 4DB2A 3DWIA 3ENNA 5GM1A 3AOEC 3HADA 4K7JA 1AQIA 3KYBA 3OSZA 2I3DA 3EIUA 4ANFA 4KQJA 1GV0A 3DE7X 4OB8A 1XMPA 2VK4A 4WJZA 4UAJA 3WWCA 3X3HA 3NYWA 1OGYA 2DCMA 4XVCA 3RW9A 3GGGA 1E8MA 2AG6A 1FSPA 1K7FB 2OXFA 5T3UA 2BSQA 5C41A 3JD2A 4D5EA 3TMAA 5IRCD 1P4JA 1SIWA 3FTQA 3RVDA 2QR2A 2VSOA 4TRMA 1BEUB 4DAEA 2PV7A 4KRGA 1TAGA 1P77A 4K46A 3AFHA 4RA9B 1DC8A 4ESHA 3VH4A 5L4LA 3CWQA 2BFFB 1HSZA 3CW8X 3D64A 3LY7A 1F4VA 1W1UA 1G8PA 4FILA 5ALLA 1JH8A 3C43A 4G4SO 1K8YB 3W8FA 1NNEA 2FW6A 2Q4TA 2QQFA 3ZV7A 3BGWA 1UMBA 2VPZA 4YJDA 2Q99A 5A03A 4N08A 3FDZA 3ZI7A 2DY1A 1G7SA 4S1NA 1NXTA 1WRBA 4Y2HA 4I55B 1XZJA 3ANXA 4ZZ2A 3KQNA 4I1UA 4PZDA 3GJ8A 1W5EA 3DE4X 3PNQA 1VJ1A 3FF4A 4XDAA 1O9HA 5CB8A 1EMDA 4KO3S 1EK1A 3WLIA 1RC0A 4K6GA 4Y18A 3VAAA 1C0EA 4LF6B 3DDCA 1I0LA 3NWOA 1ADJA 4G85A 3WS7A 5HJEA 2QTRA 3SSNA 1BDBA 5FPTA 2JFQA 1CEXA 4J0GA 1C9DB 5F2KA 2ZUDA 4IDBA 5KKAA 2C42A 2W0MA 5E6SB 1E9DA 1N75A 4D4JA 4RZQA 1YFLA 2ST1A 1VPVA 5E8JA 5E2BA 3PQCA 3D8BA 3AEZA 2PNJA 3WLRA 3K30A 2AV6A 4MUFA 4QE3A 1UKAA 5DWVA 3DGEC 5CGZA 5KYXA 3S29A 3IEIA 1WKVA 2QW8A 3QE3A 4JJFA 5C8YA 3HU1A 1V3UA 3KZHA 1ZJ4A 4MQFA 1Y9ZA 2J9GA 3IQEA 4V02A 4KFSA 3EEFA 2O2JA 2AG1A 3IEMA 2JBHA 4IZIA 4WRRA 4BX3A 2O8FB 1PF7E 1PV1A 1VLLA 1RWNA 1PN3A 1I2AA 5A5DA 3UWOA 3DCJA 2CSUA 2HQQA 1XU4A 2X5OA 4ZVOA 3VKUA 2G36A 4G67A 4XGKA 1ZGCA 5F64A 3UQZA 2NTNA 1AB6A 5T41A 1UT6A 4ITRC 4CUKA 5C9ZA 1KY2A 1EQAA 2JGDB 4QTTB 2P0EA 5D87A 4FDLA 1GFWA 1I6LA 5T6MA 1IH8A 3G5TA 4CM8B 5IN4A 3FOEC 5EIFA 2Z3WA 3U40A 2YWBA 2R5WA 1YVPA 3MBJA 2OKCA 1FNCA 3C6XA 3DEHA 2EGGA 2OXTA 4DS3A 1ZYUA 5DM70 4P3KA 1E9BA 2P9HA 1ISRA 3CMMA 4RLHA 4QQRA 1Z7WA 3AF3A 5HIJA 3VZQA 4XVUA 1WB9A 4JSTA 4Q4DA 5HSGA 3P0EA 2LRHA 5FLYA 1WR8A 2BR4A 4C6TA 2QZ9A 2AYZA 3A7DA 3EK2A 3WA6A 1E8DA 1N2GA 4FFRA 1JQKA 4H77A 5CFMA 5LNK6 3EWAA 2GFHA 2WINI 2DPMA 2UAGA 2L0XA 3IHKA 4P4LA 1JHVA 4A2QA 3GYBA 4CLOB 3CT6A 5CFLA 4D5GA 4L8YA 1GPUA 4EYEA 2ETVA 3EWNA 5A71A 1VI5A 3HXLA 1UPFA 1LW7A 2Y1DA 4YDRA 2V6MA 2JAXA 3QE0A 3NBVA 3KZOA 4X95A 2WG0A 3VPGA 1GL9B 4JT2A 4L6AA 1WB6A 2CLKB 2X4IA 4EHAA 1HBJA 1V8FA 3MAGA 3ONWA 4PN3A 5F9MA 3VYUB 2AH5A 1PZHA 4A0QA 2XD4A 5JRJA 3WBBA 3FKJA 3ITKA 3ILHA 5B1YA 3VNAA 2JFYA 3FXAA 3P0JA 4Q1VA 6ADHA 5A9SB 3RYCB 4XWWA 3BRCA 5ITSA 2Q1UA 3DAYA 2B2NA 3SOZA 2O8EA 4OO3A 1M5RA 4AXBA 3VYTB 1CF9A 3X1YA 2GYWA 3GPIA 4UU0A 1FFWA 2ILVA 2REQA 3G9UA 4TMVA 4DQDA 4ESOA 2QJRA 2XIJA 3TOZA 2JJYA 4HXFB 2WF8A 4S0ZA 4P4GA 1Z75A 1O6FA 4TV8F 1VLMA 3G88A 1XNJA 3IN1A 3UMOA 3RSFA 1I7LA 4Q3BA 1SUIA 4D46A 3CRZA 2WAAA 2H4XA 3MCUA 4DLXA 2H1WA 3RUEA 2QN7A 3K0HA 1OWOA 4QUHA 1XQ1A 1Y7PA 4QDJA 2FEOA 3B7GA 3BS4A 4ZK6A 5KNCA 2X3YA 2VBGA 1L5GB 3IR7A 3W2TA 4HNAA 3NHPA 4J07A 1B23P 1I2MA 3I6BA 3TNYA 5ALNA 3Q3GE 2F00A 1S5PA 2D7CA 4OGFA 5C37A 3PUWA 4OSEA 1QOPB 1AIPA 4YGXB 3AI3A 1FE8A 3H5OA 3U3ZA 3VYRB 1YZNA 1P4AA 3PC8A 1Z6GA 1C4OA 3Q98A 3TNLA 2ZPAA 1JZTA 4RGYA 4OQ4A 2B5VA 5FUXA 4HEA1 3JR3A 4D8UA 1W30A 1KDTA 2KSQA 3QGMA 5TGTA 1IY9A 4AKSA 4HGPA 5K6AA 4DJAA 1U8CB 2FOXA 3Q0EA 1ACLA 2Y68A 3ED5A 3LUJA 1Y1TA 4ZI2A 1NHGA 1N9KA 4RDCA 2WMDA 1IHYA 4Q47A 5PGMA 3E05A 2NO5A 1C9KA 2BGJA 1OAOC 3HKBB 3L7JA 4WESB 1IXRC 4ZYZA 2HRZA 5J2TA 2UUCB 4WV3A 4XF6A 1TU4A 3PJEA 5K3BA 1THTA 2AJPA 5BNIA 2HBYA 5BUZA 4PRLA 5EY7A 2PGXA 1WSDA 3GC6A 4ZODA 3KYJB 4EY7A 3BTUA 4RTNA 1FPMA 1DWQA 2O3SA 2RH8A 3BM5A 5E2IA 1CR1A 1YBVA 4BMVA 3A3OA 2VRCD 1ZRSA 1M66A 3KOMA 4PCVA 2D13A 2XDQB 3QFHA 4GRAA 4QYTA 2TMGA 3QBEA 5DM4A 2YWEA 1KYWA 5EJGA 3PKIA 5T6BA 3VI3B 1DB3A 2FFRA 3I3OA 1ZNWA 2H06A 3Q88A 4MW0A 3SQDA 1HNWB 1G5HA 1BYIA 2CHVA 4I4NA 1Y4UA 4QAJA 1I32A 2VSYA 4YLGA 4ASUD 5IG2A 3E5HA 4FMDF 4HLDA 1DXYA 1GVNB 2FSUA 4YWRA 4KGDA 1R6DA 4UBMA 1CEQA 1U94A 2VJMB 5COQA 3L0SA 2CHEA 4CMAA 3QVOA 3K1JA 1TA9A 3LUPA 2XCOA 1PL0A 4K9CA 1YBAA 4BDSA 5KYGA 5AI6A 2OV3A 4LZPA 2XD9A 4FT2A 4LJYA 3RUHA 2QZSA 1CFZA 1XUOA 1BKSB 3VPDA 2WTNA 3VSBA 2R0QC 5AHKA 1BFDA 1IXSB 2NO0A 4A2CA 2H1HA 1G20B 3E03A 1YGPA 3OCZA 1XLTA 2OL4A 3I5AA 3WLEA 2V0NA 3ZWKA 2PLNA 3RFFA 4FS8A 3DVAB 4FR5A 1BA3A 4PO3X 5AKLA 1FMFA 2G63A 1PWXA 2JLVA 4I4TA 4IIVA 5A04A 4LXYA 4EUEA 1VI6A 4IKEA 3WBFA 4CM9A 1QQ6A 1HDIA 1JLKA 1TYEB 1ZD1A 2Q0HA 3E5RA 1R6AA 3MUEA 3O74A 3RABA 2WDZA 3UQYS 5KZMB 2B3DA 4X3OA 4ZO4A 3QXSA 3JQGB 3LOPA 4O4IB 4PO9A 3EDCA 3T1NA 3V4RA 2G06A 3FTPA 2XB2A 2UXBB 1CUAA 1C29B 1NLZA 3QFTA 4QVKA 1B93A 4H2DA 4LDNA 3LGAA 4K2HA 2ZDGA 3D2BA 2H7YA 2OFXA 3OHSX 4B33A 5ICEA 4MHTA 5CB4B 4TWAA 1R50A 2LR0A 3FPLA 5JAOA 1S9HA 3GLTA 3T15A 1WDWB 1EFAA 3A4YA 2CFSA 1A9YA 3U9SA 5JD6A 4U02A 2PKFA 1YRYE 3KYDA 3QTBA 2MMGA 3EVEA 2GRJA 3UUFA 3K2IA 1PS9A 2EKQA 2WUWE 1T4MA 3VKFA 2ZYVX 3D0KA 3PFCA 4LXXA 4F9FA 1E5DA 3SF8A 5TRWA 1Y33E 2YZMA 4N3BA 2JCGA 3X43A 2CVFA 3B1OA 2QRGA 3A1SA 1CWUA 4XTRA 4KYUA 1RWXA 4YAFA 4YMGA 3TZBA 1E0KA 2AA3A 5F52A 4JGBA 1VHLA 4HB3A 1C8LA 1YIDA 2MJLA 4KJZA 4MV4A 1OIWA 3RF6A 4L78A 4MK4A 1MT0A 1VJ5A 3USCS 4BNZA 2J3HA 2H4JA 3IO5A 2FWMX 2JFXA 2HD4A 2NUTA 3ZBUA 4UTNA 2IW3A 4UXJA 3ICWA 1EGMB 4Q93A 3TQHA 4X1YA 1NE2A 2CFOA 2XBLA 3M70A 2G5GX 5HM6A 1TM2A 2C00A 2C84A 3HC7A 3E3OA 3PWZA 4WOKA 1L5YA 1ESCA 1Z3CA 3OF2A 5IEJA 5FA6A 3IBQA 2QT0A 1E7SA 4RHTA 3ETCA 2DSNA 5JXJA 3FRHA 4DR3B 1KFKB 3HGQA 4ZPJA 1WHSB 1MQ8B 2PGLA 2XOEA 1KORA 4Q15A 5L7WA 5C81A 3G2PA 1Z88A 3NT5A 4GE0A 3TX6A 4ECEA 5CCEA 2WYOA 2PANA 3CT4A 1CEEA 3D4PA 1DWUA 1JU3A 1NTOA 2AN3A 3CX7A 4OHXA 2WKPA 4PFJA 2EFDB 4QOSA 1XAJA 3GCDA 3OQVA 4LHEA 1W0CA 1EAMA 4B6PA 3HJGA 3PRJA 3UT0A 1KBQA 2IIQA 4N8EA 4RFLA 2VK2A 9LDTA 1XJCA 3COSA 1BA2A 1DCKA 3JYQA 3B1RA 4B80A 2I7DA 1M2OB 3IPRA 3PYZA 2ZYHA 3Q3EA 1XZKA 3RM3A 4YJ3A 3R7FA 2YZ7A 4AZ0B 4DG8A 1P17A 1EGAA 2A5JA 4I5FA 4KWCA 5IBRA 3W9SA 3ZWWA 4EK9A 1BDMA 2HY7A 1BTOA 3A1CA 2CDCA 2IYRA 3E82A 1G8YA 1ZK4A 2CMGA 2G6BA 3ES9A 3KOUA 2NYUA 3MS7A 2CDNA 1KMCA 4GG1A 3CPSA 3PYMA 4M49A 4Y6PA 3IDSA 2J0EA 1EBFA 1ODCA 4MUMA 2PV0A 2XODA 2ZLBA 2BUCA 2WZQA 4W8GA 4B3CA 3FUTA 3GH3A 3JD0A 2VHTA 3P0IA 1KQOA 3WV4A 3TLCA 2P62A 3UF0A 4P0TA 1O9BA 4QOFA 3GLHA 1CBUA 1MORA 2H52A 3CUEF 3WZMA 4D2IA 4ZYYA 5EZYB 3R0QA 4JT9A 1A72A 4QBGB 3U44A 2HWXA 4NEHB 1YQEA 4HNTA 2IQ5A 2QUJA 4X65B 1X7WA 1CUCA 2QD4A 4OYLA 4MWOA 3O1IC 3PDJA 4KBEA 3S7TA 4QM6A 2QM0A 1Y3FE 4JYBA 1ELOA 1V8DA 1CE8B 4ZI7F 3O91A 2QVXX 3UH1A 4ZMSA 3H2IA 4IHJA 4DVGA 5AK6A 2Q4OA 4D1YA 3K20A 2R1TA 3BHJA 1GFIA 2XE8A 3R3WA 2A9JA 4NAUA 4F8JA 1GUDA 3PUXA 2ZRDA 2V6IA 3C98A 3BB4A 3SP1A 1CJBA 3IO3A 5KMGA 3RSLA 2CSXA 5D3ZA 1DHTA 1G42A 4H16A 4BP8A 4B44A 3ADPA 2Q7XA 4K8PA 1C80A 1N1MA 2GAFA 3QLJA 5I3CA 2HLDD 3MWFA 3W5IA 5HE8A 4MCHA 3ZQKA 2JLWA 1LIIA 1K88A 1YVDA 2R1VA 5B6PA 2OV4A 4Q6BA 3ZE9A 3D4BA 3OPNA 5MGBA 1XR3A 5CUQA 2ZIZA 1G19A 4JN6B 3W4KA 3QWFA 3WQSB 2PS3A 3FCYA 4E69A 3N8GA 1IZ7A 3BA1A 1SXJE 3TNFA 4U2DA 3MGAA 3IQGX 1BU8A 4LXHA 3WXBA 4C20A 4XOIA 2Y1EA 4Z7JA 1A1SA 3DHNA 4FYVA 4Z2AA 5JYEA 4GOLD 1V6CA 2OB2A 1GZDA 1Q0RA 3BMQA 3IMCA 1RHKA 1M7BA 4XFKA 2WM9B 4DIOA 1UA4A 3OMLA 1EX1A 2GCAA 1LDMA 1H8HD 2PKNA 1ZGHA 1GPWB 1EYZA 1EUZA 1TMGE 4KNVA 4A82A 1DJLA 3EF0A 3JQAD 5SV2A 4Z5XA 1T1RA 1XKTA 4PPQA 4L9AA 2G83A 2G4VA 2PZKA 3JQ8A 4MR9A 4ZGWA 4XX0A 3IE7A 4XD7D 1OXVA 2QUKA 1ACJA 2EWVA 1DRKA 1JDPA 2Y66A 1U7TA 2YWFA 2ZATA 3CNHA 3O4VA 3F7MA 3JALB 4G97A 4BVEA 2O7QA 2XVAA 1MG5A 1OD6A 3OEWA 4I4LA 1KI6B 3BKXA 3P0RA 3PL1A 4ID9A 2AMFA 3UJBA 4CL0A 4R69A 3OZGA 1JI3A 4MIYA 1KY5A 4FMPA 1EX6A 1V11B 1KXJA 1GZ4A 4Q4LA 3QYJA 4HFNA 1VL0A 4M9ZA 1Z34A 3UJPA 3MMSA 1GRRA 2J48A 5CLQA 3CJQA 4EL0A 3FVTA 1RIFA 1TTPB 1UXHA 3MT0A 4UZEA 4IXNA 3LW7A 3ICQB 3BIXA 2HK7A 3C4QA 3BK2A 4W5JA 4HOYA 5HRUA 2FR8C 1UDCA 2WZBA 3DTTA 1AK2A 1HPLA 4ERXA 5BURA 4Q24A 4V0ME 2PJUA 3QBJA 2NM0A 4EW3A 2A1UB 3IVAA 2DJIA 1N6OA 2XADA 4IVPA 3R8FA 4K8KA 2FSIA 3G8DA 1S1MA 4J75A 2Z09A 4XQCA 4F60A 3S44A 4EHNA 2GETA 5H59A 1I8TA 1UBUS 3KR0A 1AKEA 2OPHA 2OFFA 4WY2A 1V1RB 1XQ6A 1I3OA 1UQTA 3FFBA 2PTHA 4HGQA 4KO8A 4ZU6X 5GTDA 2QU8A 3AM3A 2IKQA 4HH3C 4GRIA 3D43A 2C03A 1SKYB 3QKUA 1CVLA 3RIXA 3HFJA 4FINA 3LPAA 1P2BA 2E6UX 3P26A 4O25A 4K5QA 1UC5B 1RLMA 4TUYB 4U0JA 3VPSA 1XPRA 1MF7A 2DC1A 3BCSA 4WADA 2ZQYA 4DY4A 4JC5A 5KYYA 3H9QA 4J16C 3ND9A 5TGDA 4BJ5A 3CLSD 2C4NA 3PC6A 2X5NA 3AG5A 3G79A 1Y6ZA 1JF8A 2XQGA 3ENZA 1RJGA 4KYIB 1EFVB 2WT8A 1II8A 3RJ9A 4P08A 1G4UR 2X5KO 5GZ3A 1D4OA 1CERA 3AHCA 1Q0TA 4H1UA 4J1TA 4P8RA 1I9CA 5K0CA 2BFCA 2Q5EA 5CYOA 3T3IA 2XTMA 3PFNA 3D7KA 4RZSA 1DGQA 1YAHA 2XKAA 4B6OA 3WGIA 2BKVA 3MAJA 2HHCA 4QUGA 3AF1A 3TW4A 4UEWA 1RRPA 4X61A 4BQIA 4HDRA 2OTCA 5TS3A 3TBHA 5F9FA 1U0EA 1IATA 4ZHQB 2QYTA 4NHOA 1GNVA 2BZSA 1MZPA 4Z4CA 5BSFA 1RBMA 4PLCA 3GZJA 3KT6A 3V00A 4NOJA 3I5MA 4KSCA 3QXXA 2RBKA 1Y8CA 1IE3A 4AJJA 1MABA 2X2EA 5CT6A 2A9FA 1BX3A 2QTVA 1S6YA 4OYHA 5AJVB 2HLDA 3OZWA 4LBYA 2WUVA 1H2EA 1WG8A 5DMXA 3U19A 4UVDA 2MYTA 5L7TA 1LJUA 1WOMA 3ZV4A 3KTDA 4MV1A 1S2LA 1GPBA 3GOHA 4JLOA 3ZXXA 5JSZA 2PKKA 4NVRA 5F1PA 5SY6A 2FLKA 3VKWA 3JYLA 1NRIA 1XO1A 1Z8HA 2IPAB 2ZSJA 4PWYA 5D00A 4BWVA 5CW2A 3OKPA 1GCIA 2VORA 4OFXA 1NAIA 5IXJA 1OA1A 2I22A 1M2HA 1MX5A 1MOSA 4A5SA 2FUEA 1YBHA 2DOKA 4PC6A 3IUEA 1G4HA 2IZ6A 3CBQA 3DOOA 4RD0A 1VSVA 2WKSA 4C22A 3FSRA 1AS3A 1UKYA 4RL4A 1G9TA 1P3DA 3QXJA 4F4IA 5D7NA 3I62A 3PWKA 4DV4B 1B0PA 3RO4A 4A73A 4KSYA 4TMFA 1WMEA 3DT9A 1BEZA 3S7ZA 2Z3ZA 3KQYA 2D5IA 4Q9IA 2A1TS 4GZMA 4H7KA 4QASA 4F5WA 1EESA 5TIIA 2VWPA 3CR3C 3KKEA 3E8XA 3OURA 2H1RA 4ENVA 3K6JA 3ZTYA 5LQDA 1EFTA 4DQKA 4YAWA 4QFMA 2NQ8A 3LJKA 1E79A 1I1QB 3P4UA 4MVJI 2EG9A 3TTVA 3UWSA 1KRWA 4IM7A 4DV0B 2NNWB 4YEDA 4EBFA 2IPMA 2ZU0C 3KSUA 1M1YA 2Z0MA 5EI5A 1JR4A 3FPFA 2GERA 1NG9A 1K7SN 1SHZA 1TZKA 2ZTMA 3OU6A 4LDZA 1FP6A 3OU2A 2I29A 1IULA 2IDZA 1ZG3A 1Z0KA 4OHPA 5CR9A 2HYIC 2DM6A 4V38A 3O2SB 5FL3A 1W9HA 4LMAA 4EQ6B 2XW6A 3CGWA 3D54D 4RKWA 4F8EA 4U9HS 4Q4AA 5K8IA 1GGVA 2ARKA 4M9UA 3H6GA 1T2CA 2FSGA 3AUYA 4F3YA 3LUCA 1NQ5A 5AQEA 3DBVO 4EFMA 4P4TA 3NYRA 1UKEA 2AFHB 1JNYA 4DQUA 2P79A 4LS3A 4TOIA 3ERCA 2CT8A 3KOXA 1BHQ1 2XRMA 3E6AA 3IIEA 1PCXA 3DE1X 3PFKA 2R4UA 3IAXA 4NNOA 3P9YA 2IP2A 2RJ3A 4J6FA 4RV5A 3O1LA 3WP0A 2B99A 1JAIA 1EE9A 2I7CA 2JFBA 4XQ0A 2CB9A 4AP6A 2IELA 4TRRA 4J9VA 4OHKA 2PO7A 1W5FA 4MWTA 5ELMA 5K3AA 1DJOA 1M76A 2HC9A 3I9MA 4Q6WA 3EXG2 4L0QA 4MMYB 4EYSA 1IBLB 1A8PA 4XWGA 2I34A 2XMCA 4A8HA 4KWHA 1SVLA 4MW7A 3LGXA 3TQFA 4CMEC 5FH9A 1EEXB 3FYUC 4D3YA 1R0CA 1RW4A 4KITB 2OFPA 1L1QA 4K9LA 1ADGA 4PPFA 3VAQA 3N8HA 1XRQA 1M8JA 4PGMA 3KR1A 5D2CA 2ZAMA 2CLMB 3S2ZA 4AZTA 3B1NA 2B8EA 3C3MA 3ZKAA 2EV9A 1PG2A 4UAVA 3NC9A 3K6KA 1AS0A 3C3KA 4JLVA 2CXXA 4UPDA 1KSJA 1UWKA 1RRCA 1W8DA 3ZV5A 4UREA 1X7HA 4IFTA 3CEAA 1ORWA 4OSOA 3BEOA 3PV0A 1OPRA 5DHFA 2BR3A 5JS1A 1YB6A 5CLLA 3ID6C 3NRCA 3CNQS 3RTDA 3LHSA 3UJ9A 2VDUE 3D8NA 3T3DA 1OTHA 1LI4A 3V55A 4EAAA 1KJIA 4ZYTA 1WSAA 2ZIVB 4KI7A 1BS2A 3MW8A 3QOWA 3EDOA 3SOPA 3PXXA 2WPDA 1R4MB 4YR7A 5L3SB 1Q22A 1ECPA 3GLIE 4FTWA 3AZPA 1D2RA 3ZE7A 3NGLA 1PNQA 4MV7A 5A3RA 4JL5A 3PT9A 4EFNA 1T2EA 4XGNA 3PEWA 3UJNA 2Q0SA 1V1JA 1NBEA 2G0NA 3GUVA 3HN2A 3KT8A 5ENDA 1UDAA 5A4DA 3RUCA 1JBKA 4LNAA 4JHXA 1Z17A 1GPNA 1ZH0A 4LXGA 4LF8B 5JH7F 3GRRA 3ZDRA 3ZGYA 4B9AA 2RKWA 5IAJA 3P71T 2QBYA 4JLWA 5FWYA 3TLBA 2GD1O 1VLHA 1DDGA 1WEKA 2FZCA 2FPSA 2HJVA 2JHPA 2NTEA 3GEIA 4CF3A 2NP7A 4NMMA 1G0OA 4CCSA 2G80A 4MUNA 1FBTA 2P3QA 4OGLA 5K6TA 3ISTA 3ZCRA 1IY8A 3B13B 3QI2A 1AKNA 3F8WA 1H5QA 1P33A 2JCXA 4JLUA 3TKAA 1OFUX 4YRJA 3U3OA 4AX8A 1M2NA 1XQVA 3KRTA 1CF4A 1SBIA 4BLVA 2BI4A 4XGRA 2X0KA 5G3ZA 4YPFA 2I4IA 2CL0X 2G3YA 5B6JA 1T8YA 5KWIA 1TCVA 2XXAA 1K9SA 1FSZA 1H1TA 1KU6A 4GP7A 1Z47A 4UCWA 3PLNA 5T4BA 3UFXA 4TWBA 4JI7B 1YHJA 2EBFX 1NAHA 2QQ0A 3D8RA 3VDMA 1JA1A 2RC6A 3KEUA 1J5XA 1D07A 3QYFA 4W8OA 2B20A 5JNRA 2AM1A 4YP9A 2DMRA 1BHSA 2XNDD 3CB4A 3GP8A 3P2IA 3RRYA 5J63A 4ZT2A 2QRLA 3GFFA 4YO8A 5JSUA 2FVXA 1FCJA 5F7OA 3E9NA 4BFLA 1X1AA 2AOXA 1HQKA 2YICA 3CZ4A 2BEWB 3JD1A 1R0YA 1G6Q1 2EFHB 3S1AB 3NU1A 1H8ED 4IUCS 2PG3A 4B83A 3LU1A 3OZTA 4BX2A 5JPDA 3WRYC 1WW8A 4GVXA 1T2NA 3A9UA 3OP1A 3CX8A 3KZKA 1KYVA 4Y6QA 3R5FA 5CK4A 5CEEA 2XGOA 4C0SA 3PQDA 2Q5JA 4M0KA 5CVUA 16PKA 1FXUA 1SCUA 3FPKA 3EQ9A 3LIPA 3JATA 4TSFD 1N3YA 3FNEA 3N1CA 3U81A 3T9DA 2IZZA 1BXGB 1ZVQA 2BDTA 2YTZA 5H68A 5FA8A 2HIAA 2X9LA 3R7AA 3IIJA 1TDJA 4QOIA 1QG0A 1JH9A 2BFOA 2Z2IA 4B7AA 3Q2IA 1Z35A 3CLKA 1DO2A 1SXIA 1ZM9A 3FCOA 1ML4A 3D5TA 1MX9A 1VL6A 4W1RA 4ARIA 3CSSA 4FFSA 4S3MA 2W98A 1Z73A 6GPBA 1CQIA 5BT8A 1RWOA 1O96B 2PQ6A 4F91B 4NARA 3VJRA 4G23A 5HF9A 1GL3A 2QX9A 1KDPA 5E4YA 4CL3A 4DXDA 4D8VA 1Z37A 1QCYA 2HU5A 4L51A 4HVLA 2PJDA 1I4TD 3B89A 3CB2A 1OH6A 2IYPA 1ZCZA 2BIFA 3FOFC 2FG5A 4CLHA 1L2LA 5C4GB 4E5MA 3QLEA 4U1RA 1US8B 4RELA 2WY2D 3WGYA 3LP8A 1S2MA 3IBTA 1T4GA 2IXFA 1Q0UA 3STWA 3R9WA 1WPRA 2GPTA 4U6NA 3VO8A 1R66A 5SICE 3F49S 1A0OA 2BFBA 3THXB 3B3LA 4ZDKA 4HTFB 1PP4A 4OUDB 5EP2A 2CFTA 1VPWA 2OSVA 4QATA 4LOIA 4HX2A 1UKBA 4TMXA 2F4VB 4C1NA 3O4HA 4GFDA 4NS1A 4NJOA 4BQNA 1OZFA 1TU0A 3REFA 4AECA 2PRSA 1QU2A 3IUNA 3MLEA 4P22A 2O52A 4KQXA 2PUCA 1PT7A 2AI1A 2UZ0A 3CY6A 1C1DB 1IOVA 3HACA 1ESEA 3QPWA 1JS1X 4KV9A 5B4VA 2PUAA 2H1CA 3F5FA 1Y63A 1GWNA 4QGAA 1BX4A 1IM8A 4PGGA 4R2JA 4R41A 4KADA 4HNUA 1EIZA 3A06A 3AFMA 4ZCRA 4V03A 4X1KA 1N6KA 4Y98A 4DAOA 5BN4B 2GK7A 4Z51A 4BGDA 4BRWA 1ZZEA 2VSXA 1YZYA 3PS9A 4ZJPA 1OXSC 3IT3A 1ECLA 1G63A 2GEDA 4KX5A 4MGHA 2BMDA 5HCNA 4CM7A 4Q16A 3R77A 2GRAA 1K1EA 4INZA 4ER0A 1TM5E 1L3BA 5CA1B 5TY0A 1SM4A 4YJHA 1N2BA 1T34A 3V8NA 5DASA 4IDNA 4YQEA 1YF3A 5HF8A 1EDEA 4NULA 1KVUA 4TXLA 5T64A 1SD2A 1M3SA 2RH5A 2WWIA 3L1KA 4RTPA 4B2YA 1VXRA 2Q29A 3O38A 1VP3A 4FFBA 4UNRA 4Y3UA 5D6OA 4ZV7A 4RENA 3RBVA 1VCIA 2XCQA 5BO5A 3D4LA 5IJ0B 2V0GA 4B1FA 2I6UA 1D2GA 1I3NA 1S8NA 2NTJA 5FEUA 4IIUA 4EA8A 2OQRA 2OFWA 2DVMA 8ADHA 5BR8B 3LQRA 4HGRA 1IN1A 1V45E 2L2QA 1HFJA 1HURA 4C1BA 2WT4A 3IR6A 1QHXA 2ONZA 5BVHA 5ITVA 4HNGA 2VIIA 4NCBA 2X58A 1ZSYA 5EZ5A 3BPSA 2W37A 2X7JA 3E7PA 3ZNQA 2YJ4A 3CPEA 4Y0AA 1XEFA 4ZJZA 4OLBA 5F73A 4BB9A 3IAM6 2CLIB 3HYNA 3ONVA 4X00A 1QORA 2Q1XA 3KKZA 3DV0B 3CLVA 1MKYA 3BD6A 1P31A 1LTKA 4OUDA 5EHXA 3P9NA 4D92A 3SLRA 1MB4A 1R9NA 2VTBA 2Q6LA 1MJGA 3H5AA 5AVQA 2YJ6A 2QLMA 2ZB8A 4M0DA 1XHFA 1BWQA 2BGIA 2P35A 3KKLA 2X0FA 4D9JA 2HV9A 4U8HA 4A16A 3HJUA 3OIUA 4JLPA 3RRZA 4ZJYA 2KYRA 3H1GA 5HOQA 2GLXA 5L4SA 2VLIA 5IM4F 1W2WB 2F90A 1ZPDA 2LPMA 1HE4A 4K26A 1GCOA 2VSNA 1I9GA 2PU5A 2XUOA 2AD1A 5AKEA 2GDZA 3RRXA 1C0PA 1WCWA 1N0VC 1XMQB 1UPCA 3DBHB 3GG9A 3ZCPA 1PDVA 4DQVA 2CHQA 3JD3A 4C7OB 5F5XA 3FIJA 1AUPA 3FPAA 2WWYA 1YS9A 2PEZA 3FYDA 2CFCA 3ROMA 4M0FA 4BMYA 1ENOA 2VPXA 1PS0A 1GCUA 3ADDA 3MWJA 1IOWA 2OD9A 4FS3A 2JIOA 2ZFUA 3AV0B 3DD5A 4GMGA 4LMPA 1Z8DA 3TSWA 4TVSA 1P1RA 3DXZA 3A11A 4PINA 3F97A 2J0SA 4HDKA 2CJWA 3HBLA 1QUFA 1NF3A 5DEIA 4DJFC 4TZ6A 4QPJC 5HQJA 1C7FA 2FN4A 4RIGA 3S2IA 4UPVA 4ZRDA 3K9QO 5DNAA 1J9EA 1U9IA 4IZHA 3W2EA 2V6GA 4TYNA 3QMWA 1W4AA 4RD4A 3RT1A 4I4CA 2HV8A 3ITNA 3MCAA 3AVYA 2WWHA 4MITA 3MWLA 1UBOS 4JQSA 3TAHA 2I6GA 2AQKA 2YWRA 3O94A 3FNFA 2ZE5A 4YLEA 1DOAA 4A10A 1FUIA 1M0WA 1SMKA 3H75A 3HO1A 1TVCA 4K9QA 5AW3A 1GRCA 1LNQA 1RPTA 4NP6A 3ONNA 4AFNA 4ALNA 1WMAA 1B00A 1JTFA 1O6ZA 2E18A 3EZXA 3SBOA 1Y80A 5TPZA 1SNYA 3UIEA 2FPWA 4L5CA 2JD0A 1PFWA 4MROA 3GV0A 4DYVA 1BW9A 1U8FO 2H4YA 4NK5A 1ZQ1A 3QELA 5A1TA 2P7HA 1QKJA 4ER6A 1QJ4A 1SG9A 3HCFA 4FSDA 5IM5A 4GOMD 5THKA 2O54A 1N5KA 2OT3B 1S7GA 4OYYA 5HNKA 3X1XA 1UJCA 4RZXA 1NWCA 3PXBA 4WW0A 3R9KA 3NP7A 2R87A 1ZD5A 3I2GA 1AN0A 3HKEB 1QIFA 3DOCA 1P2DA 1JG1A 3CO0S 1VLVA 1XAGA 3IXMA 1BJTA 4NNPA 1M7GA 1ZJYA 1E1CA 1ZDMA 4L3VA 2CB0A 1VI2A 2YKGA 1LC3A 4HAOA 3MINB 3MTIA 1D0IA 1E64A 3DEAA 4AD8A 1AQNA 1E3TA 2DUWA 2PQ0A 3BHMA 3DR5A 3Q11A 5EXTA 1EI9A 1Z62A 4J7CA 2AXEA 1M75A 1A7KA 1E9CA 1FLAA 4KI0A 5P21A 1COZA 4NQZA 1KK2A 1IHOA 3MWEA 4PLGA 2FMHA 3AEQA 2XR1A 1YCHA 3C3WA 3IEKA 1FTSA 3H84A 4EDHA 1D0SA 1GKKA 2WSSA 3TTXA 4XE5A 5BV1A 2WFAA 1FVOA 2OORA 1P81A 4I50A 5A3JA 2FUCA 1A2QA 4WXYB 4IYJA 2HHHB 1U0RA 3WK4A 3NIBA 1UUFA 4BFUA 3PKZA 2BVNA 1DQRA 2PH7A 2JGFA 3DDOA 1XDGA 4Y9SA 1QQ5A 2JI8A 4K1LA 3GA5A 4EH1A 3I05A 4RCYA 1QRSA 1SXJC 1NJGA 4EUKA 3CINA 3UWDA 4COKA 1Z74A 3ELYA 3GL9A 4FIDA 2O19A 2H2HA 4JI2B 4ZO8A 2NZYA 3H42B 4IHJF 4A8PA 3LTEA 4I14A 2XDWA 3UCFA 3PC8C 3W34A 5KCZA 4F2PA 5K3FB 2C2XA 3EBOA 4KLCA 1YVRA 3GRAA 3NM4A 1N5MA 4MB0A 4MI3A 3DYIA 3U1BA 5JZSA 3RB8A 4R1MA 4O4LA 2RGDA 4O1MA 2DDMA 4JS0A 3WO1A 4ABYA 5GV8A 4KQKA 4RVDA 5H82A 1AKWA 2CGEA 3N59A 1KI9A 5E9JA 1ZICA 4GS5A 2VTEA 4LQ4A 2C7QA 4XX1A 1YJXA 5B7PA 2ZIFA 1PDWA 1JHXA 1NR1A 3AZOA 3FLBA 4GXTA 4OMCA 4U9UA 1V1SA 3WRXC 3UGJA 1DE0A 4HGZA 4GLBA 2PMDA 4QDTA 5K0LA 3MIZA 4TLAA 2Z5VA 5T3YA 4L2IB 1O87A 1TRHA 2Q4BA 3EBPA 1EFDN 5JMWA 5K1ZA 1U7WA 2IHUA 3FD8A 3LUKA 4MIOA 5DU2A 3ZJUA 4KQEA 2C4EA 1JDBC 1VE5A 3QUCA 4QODA 3IVXA 1C81A 4MW4A 5BV2P 2M98A 4G5HA 3RARA 2HBRA 1G8AA 4JJIA 4LDRA 5CDSA 1UMKA 3MRXA 3COPA 2UZ1A 3VR6H 2BGGA 1VKNA 4L5YA 4NH4A 1B3RA 2QROA 4TV8A 4BO6A 1MXFA 4NYMR 1RNLA 3AG6A 3V3KA 3BK7A 4HG2A 2JFUA 4WBNB 4LF7B 1M8GA 2YZ2A 4M1OA 4DIMA 4P32A 1DADA 2WMNB 3IQIX 1P9OA 4L5JA 3K70D 3M9LA 2EW1A 2FQ1A 3HZOA 1GYQA 5F2EA 2BWJA 3PXUA 4RK7A 4BNUA 4P3YA 3ZTTA 5IANA 2MU1A 4CYMA 4OQFA 4Q05A 3UHJA 3DVQX 5LUAA 3Q3JB 2WFLA 3UMBA 4KPYA 1UB0A 3D3QA 3JQPA 4ZPXA 3RAGA 1ZD4A 1LI7A 1JVBA 2IP4A 3HP7A 1H85A 4LHVA 2WIAA 2PU7A 3A1VA 1JTEA 3UV3A 2OEPA 2OM2A 4A03A 4ZICA 3AIKA 2ZTHA 3IQXA 3U3KA 4NL4H 1RHMA 1QWSA 4AIIA 4G1VA 3RO7A 1JNXX 1II0A 3FSGD 2KI5A 3VX3A 1NVUQ 3ZW7A 4MWZA 4ZTZB 2HWKA 1R5NA 3L4JA 3L02A 3FM9A 4MQLA 1EIWA 821PA 3L1HA 2HU2A 1F0KA 2E5WA 3ABZA 3C6ZA 3HCBA 2WTUA 1H2AS 5LMNB 4LZOA 5K4GA 1RHQA 1XCBA 4UHEA 1AXRA 3HHEA 3V4LA 3TSZA 2HRRA 2HRCA 2WJHA 3TIVA 3TECE 1N1EA 3B5IA 2JHCA 4WXMA 4TWIA 4NYMQ 2I4MA 2X1LA 2GWHA 1PL6A 4R01A 1FVHA 1X2BA 3I8OA 2FFBA 2NO9A 2QAGC 1PWYE 1B73A 4K8TA 3SDZA 3PC2A 2XNHA 5J4YA 1TCCA 4AK9A 3PD0A 3H18A 3STVA 2FEXA 5KVQA 4D81A 1WOYA 2A58A 1R9GA 3CNBA 2HA6A 2J30A 5CB0A 1PSWA 3MK31 3AK4A 3HP4A 2HGZA 3ICPA 4YV1A 1JG2A 4BAZA 3JQ9A 4QLOA 3UB4A 2VG8A 2B7LA 3K8QA 4PBSA 3OWHA 2W2TA 3RWMB 5C31A 2FXIA 1FUYB 1FYEA 4GYKA 3DFKA 4GD3Q 5JMPA 1MP0A 3E15A 2OBBA 1NXWA 2DFNA 2RONA 4QYSA 4Z1MA 2COUA 4RACA 2GCIA 1QP4A 1PJSA 4DNPA 4RY8A 5JPCA 1RMQA 3E9RA 3HPRA 5FR1A 1K08A 1DKUA 3UMCA 5E3HA 2VT7A 4A6PA 1ZR4A 1YJCA 2OD2A 2Q5FA 4TL7A 5JWHA 1I14A 3AQ4A 5C80A 1UJBA 2DPLA 1D03A 2F9FA 1LSSA 2B8JA 421PA 4YRKA 3F2IA 3DEZA 3PX2A 2BKXA 3FMVA 1MRSA 1HDXA 1Z06A 1ZOPA 4JBLA 3QPAA 4DSZA 1VK4A 1FYXA 4BVJA 4JNKA 4AJNA 4ZXFA 5KNBH 4WKGA 4FI3F 5JIBA 3RUAA 5EE1A 4UNSA 4AS2A 1EM8A 2P75A 4BDTA 1WHTA 1J23A 1NQTA 1P7CA 2DKOA 3BUSA 3O93A 3PDIB 1MENA 4W7HA 2P77A 3CW2A 4H7FA 4FNGA 2OYRA 4JX9A 3BF7A 3KHUA 1LHPA 4J1TC 2BJWA 2XRYA 5F78A 3A3KA 4W5QA 2B4KA 1RABA 2CF5A 1OU0A 2VH1A 1FYWA 3MOGA 5A9TA 5IJ9B 1Y8QA 1ZNXA 1VM7A 3C48A 3AF4A 1BU5A 1TIPA 4XA8A 2MSLA 2Q46A 2NO7A 3ZYCA 4Q3CA 4C4AA 3B1VA 4KHZA 3RVSA 4BZPA 3RTCA 4ES6A 1EXMA 3FBWA 4OUKX 3WJ1A 2P6PA 5ITZA 3THRA 3COVA 3ZXIA 1P5FA 4F4FA 4WHMA 2IH5A 2AFBA 1RYNA 4UHFA 3LA6A 3OY7A 3NUZA 4QU8A 4DTIA 1DC4A 3IFSA 4D9GA 1S7CA 3Q8LA 5IASA 3OCJA 3THYB 3FCAA 2GN4A 5ALIA 4C4ZA 1QFXA 3KZCA 2JIQA 2Q5CA 1F38A 2QUIA 5M29A 4MVXA 3RC7A 1NDUA 1K8XB 2NTYC 3ESZA 2BMJA 2ATXA 3EXHA 2HLPA 2C61A 2FX2A 3LQ1A 1ZM2A 1K6MA 2Y0DA 3F2VA 5FUVA 4QPDA 2G9QA 1F6DA 2G88A 3KJXA 3W5JA 1KR5A 3JR7A 3OEHA 4NBTA 3TGLA 3UA3A 1XVUA 1U0FA 2GPNA 5TDHA 1ZITA 1E2QA 2RSLA 1J39A 1JAHA 4O6VA 5LMCA 3ZS8A 1SUWA 4R8KA 3QTLA 2ZBFA 5KTNA 4BLOA 3N2KB 1K6JA 1F48A 2Q5HA 2OLEA 4ECAA 4F0JA 1K3UB 1SC9A 5IVHA 1D1TA 3B6JA 5BRJA 1JR2A 2QYHA 5CD1A 1GL6A 1TVKB 5G2OA 4DSAA 1LZLA 1HDZA 1DBPA 2DLNA 1DAGA 2MCFA 3SF0A 1IQRA 2UXDB 4OLAA 2EHDA 2GJKA 1A71A 2IEAA 2X2OA 3JQCA 3R09A 1S3SA 4PQEA 5F1KA 5AVJA 3WLOA 4Y9TA 4LCJA 4TZ0A 2PRYA 5FIUA 3FTEA 5ADHA 3KNZA 4DXAA 4V0QA 1EM8B 1MJHA 1P5ZB 13PKA 2VRNA 4DQLA 3LCRA 4I6EA 5D85A 4L72A 1GPAA 3OUZA 3SEFA 5DOVA 2Y4OA 4M6WB 6REQB 5EGSA 1KERA 1L4EA 4MVJD 4AO6A 4LF9B 1FU8A 3PNBA 4UM7A 2OHXA 2QI9F 1JJBA 3GP5A 1FU7A 3A9TA 2QQEA 4QOHA 5TLSA 4OIMA 3AUUA 4N4AA 3S2FA 3X1DA 721PA 3O82A 3O1JC 2W42A 3L8MA 4XCXA 3HXTA 1XEWY 4QJ4A 2DFTA 3FDXA 1LZKA 2DULA 1WMFA 4LJ8A 4ZAVA 4G5SA 1P7ZA 1PT8A 2AC2A 2NW6A 4QQFA 4E5PA 5JZBA 1Z29A 1KARA 3A9WA 2AUTA 2LWIA 1M8FA 1N2JA 2R85A 3TN7A 1GO2A 3TBKA 4MI6A 3MXTA 2C8VA 1N92A 4LHZA 5IAKA 1D0VA 3BC1A 5CDUA 3PR1A 3R74A 1ISFA 3QIVA 3ZVKA 1JQJC 3VX4A 3O95A 3N2IA 5EHNA 4ZCQA 3KQMA 4P0QB 1JDUA 3NV9A 4PM4A 5EL0A 2VPYA 2GF2A 1BC5A 2J31A 3IUSA 1BW9B 2P2GA 5D7BA 4I9GA 3WGKA 2GC5A 1H2RS 1LWOA 5JYDA 2JKYA 4HX5A 1CE8A 4OMFG 5E95A 5K8UA 3OX3A 2C5BA 1NJ6A 2UXCB 1WCYA 4NMWA 2JK1A 5F0ZA 4J7XA 1KZ7B 4WXPA 1THGA 4RH3A 3T0FA 3ZK9A 4LW8A 1XTPA 4MSUA 4A8JB 4I3FA 4MWBA 2FW8A 1CY6A 3HUFA 3PRHA 4LDAA 4RVCA 3N0RA 1BJKA 3UB2A 2H2DA 4IAOA 5H3LA 4JUCA 4A8JA 1W4BA 1ZJ6A 2HPVA 4B87A 5DXFA 3O0TA 1W0KA 3N39C 4KGXA 2ISQA 2AQIA 3OG9A 3DOEA 5AW8A 5ENVA 2P6RA 2HF9A 3ASZA 4WVFA 4EVSA 2ZRFA 3U5TA 2GNPA 3KXIA 4GGOA 3VMMA 1FU4A 2VNAA 3AUFA 1EUDB 2O3UA 2HCFA 3EGDA 3HNOA 3RSQA 3CLUD 1RI3A 2GN6A 5FL7A 4AU1A 2H2FA 5AUOB 2WFZA 2FN7A 4DR7B 3UFXB 2RGYA 2CMDA 2QJWA 3MT9A 1V5WA 3OUUA 4QBFA 1ILWA 4R8MA 5LLTA 1NVBA 1C1HA 1HT0A 1LTQA 1M6EX 1ZISA 4MZXA 1RRGA 3H83A 1ZN9A 2GFIA 3ECAA 4MKRA 5EA2A 1DIAA 1M33A 2BF4A 2PT5A 3G2NA 4RLQA 1HI9A 5AO9A 4A0GA 1P3JA 5JDIC 3LVFO 2GXUA 2GK3A 3DZCA 4FOPA 1DUSA 2J32A 1C3XA 1JXOA 1WQ3A 2AR7A