3RU2A

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadph.
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
total genus 180
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3ru2A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3ru2A02
1RKSA 2PKNA 3NCAA 4S1IB 3OTXA 3NL5A 1TZ6A 3RO4A 3UMPA 3RSGA 3VAQA 4PVVA 4EBUA 3LKIA 2JGVA 3KZHA 3EWMA 1TYYA 2RBCA 1RK2A 2DCNA 2YXTA 3KEUA 3PL2A 4LC4A 4N08A 4O1GA 4U7XA 4E8ZA 5C40A 2ABSA 4KBEA 2XTBA 3VASA 4E8YA 1LIKA 4K8TA 4EUMA 3GO7A 2HQQA 5COJA 4YL5A 4N09A 3LOOA 4C5NA 3RQQA 4C5KA 4XF6A 4EN4A 3D3KA 4XDAA 4B8RA 3ROEA 1L2LA 4LBXA 2I5BA 3RTDA 3RSQA 5C3ZA 3PZSA 3KTNA 3QAIA 1LHRA 3GBUA 3HPDA 3ZS7A 5EYNA 1RFTA 2O8NA 3BF5A 5EY7A 3UQDA 2AFBA 1LIOA 3RT7A 3N1CA 1GC5A 1JXHA 2A9YA 3LHXA 5BYCA 3HICA 3IH0A 1V1AA 3RS9A 3FHXA 1KYHA 3RSFA 3RTBA 1BX4A 1TZ3A 4JJPA 3BGKA 3RU3A 3ROXA 1U2XA 3ROZA 3UBOA 4E84A 5CGAA 4E69A 3RPZA 1YGJA 2QHPA 3RQ6A 4JKUA 5B6AA 3DZVA 1GQTA 3H74A 3RQHA 3LJSA 3NBWA 3QA2A 2AJPA 2F7KA 1RKDA 4K8CA 3RQ2A 3RT9A 3K9EA 3RTAA 2I6BA 2Q5RA 4C5LA 4X8FA 1LIJA 3RRBA 3UQEA 3Q92A 5C3YA 1ESJA 1EKKA 2AWDA 3IBQA 4KALA 4E3AA 3NM3A 2PKKA 3RQ8A 3RNOA 2YXUA 4O1LA 1VM7A 2HW1A 2JG1A 1V1BA 4KAHA 4E8WA 2C49A 2DDOA 3ROGA 3KD6A 5F11A 4K8KA 4K8PA 2DDWA 4YWRA 4XCKA 3NC9A 2AX3A 1VK4A 2I6AA 1ESQA 2QCVA 5TRWA 5BYEA 3RQXA 4C5JA 3NL3A 3MBJA 3RM5A 2DDMA 2AA0A 1VI9A 2HLZA 3B1QA 3GO6A 1WYEA 3UMOA 5BYDA 4KADA 2R3EA 1LIIA 3RTEA 2JG5A 2NWHA 4K93A 4DU5A 3CQDA 3FHYA 3RRFA 1JZTA 3RQ5A 5TQIA 3UQ9A 1UB0A 3RO7A 3RSSA 1V1SA 2PKMA 3NL6A 3IN1A 4K9CA 1EKQA 4GM6A 4S1MA 3K5WA 1RFVA 1TD2A 1UA4A 2FV7A 3NM1A 2ABQA 2VARA 5CM5A 3RRJA 3I3YA 5CGEA 1DGMA 3IQ0A 1C3QA 3B1OA 3B1NA 4XF7A 3DRWA 3B3LA 5F0ZA 3IE7A 2F02A 1RFUA 4WJMA 3RPHA 3RU2A 2AB8A 4EOHA 3W4SA 4B8SA 5BYFA 5C41A 3UQ6A 3HYOA 4LCAA 2R3BA 3H49A 4K9IA 3Q1YA 3RS8A 3RTCA 2A9ZA 3B1PA 3RREA 1RKAA 3MBHA 2AJRA 3IKHA 4UBEA 1LHPA 4S1HA 3NC2A 4DC3A 4C5MA 3RTGA 4LBGA 3B1RA 1YHJA 2C4EA 3RY7A 4S1IA 3NL2A 2PKFA 1JXIA 1YGKA 4JKSA 4KANA 2V78A 1V19A 3D3JA 3NBVA 3JULA 2DG2A
chains in the Genus database with same CATH superfamily
3JD3A 1BGWA 1R8XA 3ZHXA 4PPGA 2GBPA 2J07A 4UPVA 1SXJD 4F8YA 1Z7YA 5DLYA 3OEYA 3KVVA 1H4SA 4HNUA 4NDZA 1UBOS 3CZMA 4UNRA 4S1PA 2WFZA 5JDCA 5C0OE 2IZOA 1O3YA 3NI2A 4XWTA 5B6PA 1V3UA 2HRBA 4OUDA 1K3FA 3HGTA 4EEKA 3GVIA 4JC0A 3HXMA 1E1YA 1PK9A 1TQ2A 3ESQA 3BB1A 3II6X 3RUPA 3OQPA 3SHOA 4P58A 2WVAA 1WW3A 4QBKA 5TEWA 4IHQA 2E85A 3I72A 4W1RA 5GM2A 2QRUA 1VLHA 2CMGA 4MARA 4Q18A 3HBLA 2D1YA 4N0PA 1SIBE 1E0AA 2CV2A 2JCSA 2QOEA 1G64A 2ODAA 2X2FA 4EEZA 4EOGA 4ZYXA 4JT4A 1DI0A 2VXYA 2YJ4A 3ZG6A 4ZO9A 5EWJA 1R7RA 3H2IA 3JALB 4UOZA 1N33B 3IB6A 2CD7A 1W0KA 1RRVA 4J0HA 2V65A 5EMMA 3DWIA 4IH4A 1JEAA 2IOFK 1NE7A 2M6RA 3IAS1 3O73A 3OX2A 3SS7X 3WAGA 5KYGA 4NEQA 3A1UA 3PHHA 1DC3A 2ZGVA 3CT4A 5LYJF 3X1XA 1BJRE 2ZPTX 3I76A 4MI3A 3F5MA 1SM4A 4WADA 2BW0A 1SUPA 3HXTA 2FJPA 3FNGA 3WBJA 1H6CA 3TFWA 1ZNXA 1EFPA 1CIPA 4R2LA 1LPPA 4QDOA 3AVVA 1H1LA 3A1SA 3F8WA 3IQXA 3H18A 2G1KA 3KWMA 1E3TA 2F3UA 2JCXA 4US1R 3JYHA 3RSHA 3UJAA 5DGDA 3MTBA 1U3UA 4MWEA 1YS1X 4MIYA 4YQFA 3N28A 1QRRA 1WU7A 3P0FA 3LY8A 1B8OA 1D6SA 3TB6A 4EMSA 1RZUA 4HYTA 3L0DA 4I1YA 3TQRA 4P5DA 1ULAA 3PD7A 3SKXA 1KOFA 5BWCA 1WYEA 4OMCA 5C8DA 4BMVA 2KSQA 3HZZA 1WULS 4MRSA 4ZOBA 4DQ0A 4EK9A 2VPYA 1FTNA 3QENA 4DNXA 3T3IA 1U7HA 1XF9A 4P3PA 5FNVF 4CTMA 6ABPA 5IMSA 4ZAYA 3ISTA 1PFUA 1LD3A 3CZRA 4HK4A 2VNSA 1IY9A 2IBMA 3ZUPA 3FPGA 1JNYA 1KFJB 4ESHA 3LA8A 4R2XA 4PSVA 3ZWYA 4URFA 1Q3HA 4LZZA 4I99A 2GLTA 2MSLA 4ES6A 1DUIA 1M6VA 1POWA 1B16A 3F2VA 2CLLB 3R3WA 5DNUA 2O6LA 1OYOA 2Q6OA 5IAGA 1RWMA 3GYGA 7AT1A 2A5LA 1POXA 2ZYGA 4PHFA 5MGNA 1QWOA 4RNCA 3AM4A 1UFRA 2OLEA 2W8BB 2XWSA 4E1BA 5F98A 1FEZA 1YHZA 3BRCA 3JQBA 4X94A 5CA0A 3UYKA 1GQRA 2PJUA 5FL7D 4AJLA 2O7RA 4Y2UA 4DSZA 4CIWA 1AQLA 1VHQA 4JGBA 1T8YA 3KELA 1OT3A 4O02B 4RY8A 4X6UA 2Q3HA 5AKZA 3T3EA 2NU9B 1JG3A 1RVDA 3K2EA 4E1AA 5I4KA 1EFCA 2V9ZA 1E3IA 2VDWA 3Q3GE 4LRXA 5NULA 4F5ZA 1KBOA 1XCBA 4OU5A 4X1OA 5DGTA 3WLLA 3AVUA 3RKSA 4HY3A 2LDXA 3DZ8A 5DHRA 1NJSA 3L01A 3TVTA 1JA1A 1QX4A 1QE5A 4ZEWA 4AICA 4ASUA 4WD3A 5BV0A 1RKVA 5K0ZA 4DANA 4O2BA 1IEQA 2ISSD 2V6GA 3JQPA 2ZRMA 1YKGA 4ALLA 2DSNA 2QAGC 1O94A 4AY3A 3W5HA 3LOOA 1FDOA 1XCLA 4BV8A 1Y8RB 1EA7A 1C3OA 4M1MA 1QHHB 1XU4A 1PX2A 4TRMA 2XKKA 3T1YB 1JEEA 3EAQA 1CXZA 1YCHA 3KOMA 2QGZA 2AQKA 4MWOA 5BQOA 3NIWA 4QTTB 2O2IA 3PD1A 2B34A 4V0QA 5IJXA 4FQ7A 4NBWA 3ANSA 5MHTA 5CH8A 3F67A 2Z2ZA 4WXMA 1XZMA 1ZC3A 1QLWA 1UZMA 4CMEA 4B40A 5GJCA 1HRDA 3C98A 5J2TF 4E33A 1ID1A 4ZRNA 2XVMA 1ZXXA 4OBXA 1BX4A 2QP4A 3Q6IA 4NMLA 2OQ2A 4BP9A 2DKFA 2GM3A 1Y6ZA 1YUNA 4FLEA 4MQEB 3WG9A 1FTWA 1YNOA 3BIXA 4GDMA 4E11A 1WM1A 3IAM1 2Y99A 1GGNA 2ZDHA 4TXNA 5KYYA 2IY7A 1MOZA 1OI7A 2B2CA 2ZDGA 4N3CA 4BB0A 3AEUB 1P80A 3FRHA 4WKOA 2I91A 4NJEA 2Q6IA 4PCUA 4YJHA 3QY9A 4ZJYA 1I7NA 1WUHS 4LJSA 4X1IA 4KALA 2JAOA 4DCPA 1GG9A 4IVPA 1RXYA 3Q9UA 4ZVSA 1N5MA 5CT4A 4HNGA 3FWPA 3KD6A 2F9FA 2OHIA 2WD7A 4KPUA 2AV6A 2C3MA 3SF0A 1E5LA 5LMNB 3TTUA 3NM6B 4YMLA 1ND5A 2ZUBA 4QWWA 1CB7A 3T4PA 3ZEAA 1EVIA 2BUBA 4NENA 1T2DA 5EWLA 3V4PB 1IXRC 1DRUA 1WXEA 2OKCA 3LCUA 3OZRA 4TT3D 4Z6KA 1O95D 4NONA 1U8UA 1UJBA 1ZKMA 3GJYA 2FWJA 5GGXA 1SVMA 4HOYA 3RUFA 1Z2NX 2WICA 2XZOA 4HPJB 2YQ5A 2FXVA 5M04A 3GVXA 4EUHA 4QOIA 1RYZA 3FSGD 4TQGA 1JLHA 3NEPX 3ND8A 5B30A 5AXDA 3DR3A 1GHTA 2HIGA 4RSGA 5EIEA 3UGKA 4DA7A 3F71A 4J07A 1NW3A 1XQWA 4IXDA 2HPAA 3MJCA 3VJKA 4QQ8A 1E2IA 1V4BA 3GPIA 4R1NA 5TARA 4RIGA 3L4SO 5IBQA 4ACAA 4CCYA 2IK8A 4NABA 1EIZA 4DYDA 3TJMA 1MO4A 3ELDA 2V59A 1HLFA 2EYQA 2VPIA 1RJWA 2H1CA 2NU6B 3DEYX 4HRVA 1Z0DA 4K6CA 5IU6A 3KQPA 4F4CA 2BI8A 2VATA 4W5TA 3UMFA 1K98A 1I0LA 1T36A 2BFDA 4YDHB 3WIUA 1E9CA 2QI9F 4FKZA 4KQEA 5KOJB 2Y6VA 2ZSEA 4RK7A 4HXYA 3RUEA 1T5LA 2PRZA 1BE0A 2Y76A 3VAAA 4ZQBA 1U0SY 4EB3A 1D4FA 2J0UA 4GXTA 4F3KA 4ZFNA 2DCNA 3IPXA 4I8DA 1AXGA 1P7WA 2KS6A 3AJ9A 4MAMA 1DIGA 1GRCA 4PG6A 2G07A 3GNQA 5JLAA 3S29A 2WUEA 1ZN2A 3VH1A 2YCBA 4I6JA 1OW3B 2A7QA 5K2MA 3WWYA 1IPEA 5LJLA 2WP0A 1I7SB 5ALKA 2FDRA 2YJ3A 3EZXA 4J7XA 1EEXB 2DJIA 4KLNA 5F9HA 1JTEA 1Z2PX 3GZNA 3MA0A 4ME6A 1ZRHA 1ES9A 4W5HA 2E2WA 3DBOB 1JKMA 3SWWA 2C5SA 2E49A 4QBTA 3R1IA 5IUJC 4PWYA 1DWQA 3QU9A 1IBKB 3OAAD 4OQDA 4JX8A 5AJWA 4C7XA 3F46A 5EHGA 4Z0TA 3ZWNA 3H9GA 2OHFA 1KF0A 2WF7A 3RG8A 2YCLA 2R4TA 4YQEA 4DR4B 3CS3A 3JYNA 1QR6A 1M1ZA 4OP1A 3U19A 3IDSA 3QMPA 2YINC 2FJUA 3QWHA 1A2KC 1A50B 1L8XA 2C4VA 1GGFA 5LB4A 2DT5A 5TY0A 2GH1A 3QWBA 1NF9A 5CTJA 2XXBA 3EDCA 2AG1A 1F1JA 4G0OA 5BN5A 1CUSA 2PJDA 1ST3A 4GKBA 3FKJA 4ZHQA 3KPJA 2DPYA 2OHVA 3P2OA 5AK4A 4FFVA 4DHEA 2R8OA 4KQKA 2ZW9A 3KSZO 1UMBA 4QXAA 5IT4A 1KEWA 1OAOA 3O1IC 4EARA 3GA0A 2QHPA 4Y9UA 5CXSA 1P5RA 4IQ0A 1CUUA 2NO1A 3KPYA 4QVIA 3GP5A 4RD2A 4X54A 2BTQA 3DEHA 2NGRA 2YIDA 1NI4B 4M1OA 4ZYWA 4KFUA 1MO3A 7MHTA 3ZV6A 1SCNE 5K03A 4A8JB 5CDFE 1RTKA 2C57A 2V45A 4K28A 1NHWA 1NFFA 4Z1MA 1KYZA 2ZUTA 2OV8A 2NXJA 5LZ7A 1S6YA 3AUSA 2CNBA 5HFJA 1QQ7A 3N74A 4PFSA 4TYMA 5D7BA 4D0GA 3A7EA 3BK2A 1OPRA 1KXJA 1KYQA 3ENQA 3ZPXA 5DT9A 1RQLA 1SD2A 3UWPA 1NN3A 3JPYA 5CDUA 2WPDA 5AKLA 2P9CA 5K3OA 3KE9A 3LT2A 3PIRA 4DTCA 4EDFA 2WIJA 1EP9A 4X7BA 2NIPA 2CF6A 4H4DA 1T2NA 2FOIA 3R76A 4C89A 4A27A 3OFKA 4JCOA 1HWYA 1U0RA 2X0IA 2YYYA 3B6ZA 1KI6B 1YBVA 4F21A 2PBZA 5AKGA 4CNQA 4GPTA 1BVRA 5LIRA 3RK1A 1XF1A 5H0IA 4CT4B 5JNTA 1PFYA 4QG7A 3MD0A 2V1UA 1IHOA 3MOGA 1QU2A 3EXHA 3KXIA 4J0IA 4AF7A 3FMFA 1I7DA 3ZCUA 2OO5C 1H0HA 3S2EA 3TGLA 1LQUA 1BH6A 1Q7RA 1SRRA 3DULA 1OBCA 2VSOA 2WWFA 1E2JA 1PUIA 2E55A 3CXUA 3WWPA 4DSTA 1IJKA 3BILA 4OSOA 5E6SA 4AIRA 5IZCC 2AB8A 1U0TA 1YNSA 4UUMA 1DTSA 2QHXA 2Q1YA 5AK6A 1OI2A 3CLUD 4CKZA 1PR1A 2VHYA 1I6KA 5G3YA 3TLGB 1HY3A 2AX4A 2P9TA 3EQ2A 3L7MA 3MFQA 5J9FA 3LHKA 3PRKE 2V4MA 5JZOA 4BE9A 1JDVA 1MO5A 4NKRA 5T4EA 1W1IA 1D2CA 2OCYC 3GLQA 1T5DX 5HQ3A 5HTKA 1T3ZA 2WTAA 3I9V6 2R8BA 4MGHA 5J5VA 4BQNA 4DL9A 1GNPA 3DMNA 4DRZA 4DSUA 2PZKA 3LK7A 3OOJA 3T4XA 3V8RA 1ZOSA 3K0BA 4XGQA 4QEDA 4XARA 5AJYA 5B7PA 1ODKA 4GVXA 1E7QA 3FDZA 1UJCA 3ZTWA 3Q9NA 2NZWA 4QPCA 1TJNA 4I7EA 5IVDA 3VFDA 1G9XA 3VVBA 2WFMA 1RLUA 2BFCB 1SWWA 1T1JA 3OEEA 4MWCA 5KQMA 2J3MA 5K0NA 1RPJA 5K0BA 4BFXA 4YV1A 5C2JB 5L53A 4BO0A 3HVKA 2QR5A 4GMKA 3QVXA 3KZMA 2PCLA 1XYYA 3SQOA 1JI3A 3DC7A 3E22B 4BCBA 5GIOE 4GAEA 4IJUA 4KQMA 3H11A 2P6RA 2HJVA 1QUFA 2ODBA 1Y7TA 5FWAA 4AG6A 4GGPA 3GYBA 4S2UA 1NNUA 1HV8A 3G2JA 1TVEA 3DKRA 1GAXA 3GJXC 5IAEA 5THQA 3RT7A 1Z5GA 3T5GA 5FOQA 5HKAA 2Q62A 1UBCA 1KR2A 1FFAA 2GBLC 1T2VA 1TMYA 1YE3A 2O6HA 2OQIA 3HCDA 3LHFA 3M1LA 3N0TA 3RS9A 1W2GA 4R2JA 3PDHA 3DVLA 1W30A 1FYEA 3H9CA 1EGAA 1QUEA 1UPBA 2Z58A 4D3XA 4UTPA 5K0EA 3FTFA 2MSWA 2VHUA 4RVFA 1DAIA 4QXRA 4DZTA 4IJVA 3SR0A 1YZNA 4KWEA 1E3LA 4EG7A 1GDDA 2XI4A 4GI7A 1EYZA 3EMBA 3WLHA 1BMFA 1X9IA 3TH5A 4NOLA 4OHBA 4CF3A 1RLMA 4OGKA 4HI0E 4HAVA 2XQJA 3JV7A 1SQ0A 3WKDA 1ZI9A 2WVJA 1VHLA 1UJ2A 4KDCA 1KEUA 3S8YA 4NWIA 4CDNA 3PL1A 1SKMA 4F04A 2QN1A 5HZMA 4WDRA 4HWOA 1NLZA 4A73A 1VLMA 1UPFA 2QB5A 3GMDA 3MJ4A 1R6DA 5JSFA 1JR6A 3ORRA 2P9HA 5K0JA 2W6CX 2ZAOA 1JG6A 2H8KA 2C2OA 2II6A 3T7EA 2B1IA 3SC2B 3ZWCA 4IZOA 4K9LA 1H42A 1KTVA 2XXJA 1ZIXA 4NVRA 5H83A 1Y4DE 3CVWA 2C31A 4UARA 2MYTA 2PRSA 1P4GA 4PXYA 2CFOA 2R66A 1FP7A 3ZXSA 2F2TA 4ZVPA 4MV9A 4BP1A 8LDHA 3NKFA 1THMA 4MWSA 5TQ0A 4Q3KA 2IZ0A 2VUHB 1FUUA 2CFTA 3O91A 2I3DA 3DM5A 1P2BA 2C20A 2XLCA 2I34A 2HA7A 4LKOA 3VV3A 3DKPA 1CRWG 4NQRA 4UKDA 4TS1A 3WK6A 1BNCA 1T2UA 4BGUA 4FE7A 4CF6A 3AERA 5L6MB 5L6LB 4A15A 2QLJA 1GV1A 3G2LA 1SCIA 2ZRGA 2GF9A 4JVMA 1P31A 1YV9A 5AW9A 3PDIA 2X9VA 1RAAA 4NH4A 5CH3A 4FT4A 2E4YA 1V6AA 2R8XA 1RHQA 1IUKA 4B75A 2GUWA 1F4PA 1CQXA 1U2DA 2AZTA 2B8EA 5C9ZA 3EZYA 1E9RA 1VRWA 2A9KA 1XXHB 2E4WA 1XJQA 5K8TA 4QGSA 1BDJA 4FWBA 3NASA 3NTXA 2N47A 5BT8A 6GPBA 4JBHA 4KGDA 3MWFA 1LV7A 4ZI7A 3TG2A 4BNJA 3WSVA 4X92A 1NWHA 3GLRA 4FI3F 1MAWA 1NXQA 4GZ5A 4A0RA 1PT7A 1W36D 1ZGHA 2GC6A 3ZU6A 3KUUA 3FNQA 3R7WA 2FI1A 2JH9A 3MHPA 2VTDA 1DEKA 2J48A 4LYDA 4QD3A 4D8YA 1T5HX 3WRXC 2VK4A 5EYPA 3RQQA 4B4UA 5C31A 2NAFA 2CVOA 4ER5A 2IYTA 3IUBA 1Y6RA 4A2WA 1N2JA 3NHAA 1Z2DA 2ZSDA 3HWWA 3IA2A 3MINA 4FW8A 4A6DA 5HJ7A 4MQFB 2IOHA 1NKVA 3W79A 1LPMA 3M6UA 1UBEA 1KMHB 1HLPA 1C3QA 1G8PA 1M2HA 1ANKA 1MIHA 1A88A 1Z7GA 1ZJ4A 3NWBA 3Q7PA 4PXAA 5SY9A 2QTTA 2NZJA 4HEQA 3RV3A 3QMWA 3BTOA 3I37X 4LWZA 2F48A 1E3WB 3SYKA 5L7WA 4TYWA 4D2IA 2EWMA 2JKZA 2PO7A 1V16B 3A06A 3AYXB 4ZAZA 1YZTA 4MVJP 2PUEA 2FZVA 2A9PA 2G06A 2J9XB 1M5TA 3EDQA 4BN4A 1J25A 3BMCB 1ZD2P 2XNHA 4QEZA 3MJFA 2OGWA 3AJ8A 4NF2A 4EG4A 1WS6A 1V8PA 2AB0A 3AF6A 2Q0XA 4YS6A 1GARA 1KZ9A 4XWOA 1F5SA 4KV9A 1MQ9A 4WY2A 4IJQA 3ZDYB 2WB2A 2Z5GA 3TQQA 2ZT5A 5AM2A 2IIQA 3CEHA 3O1JC 3HXPA 4W63A 2YRWA 4DLUA 3L6BA 2XE7A 1F6BA 2A86A 4FMBB 3LLSA 4PPFA 3Q9LA 4BJ6A 2MU1A 4IIGA 1T9HA 3RKUA 4HDMB 4E31A 5CX4A 1NOJA 3FY4A 2PX2A 3KSUA 4NBNA 4P33A 5FPSA 3ZXYA 3LY9A 4BMZA 1CJUC 4JQZA 4M0DA 1NYTA 1EHCA 3ZDFA 4RACA 4TV9F 2XGGA 2KLBA 3H1GA 4TLBA 4WASA 5COBA 4RXUA 4LXIA 3RIHA 5K45A 5KNCA 4DA4A 3D6NB 3E2IA 2JFWA 2JK1A 3L7AA 4DRXA 3TSOA 3ZGVA 1TKAA 2EFJA 3CLTD 1PS9A 3JW8A 1XNRB 2YXNA 4L8FA 2HKIA 1E2HA 3KSMA 2WHQA 2BDEA 2X0KA 3E61A 3OMLA 5M7EA 3UENA 4Z2YA 1GFZA 1JDNA 2AEFA 1K6EA 3C4VA 4XIGS 2NZXA 1FOEB 5BPHA 1N6HA 5BSKA 3G1UA 4JLAA 4M9UA 6YASA 2DULA 1UM9B 4N6GA 3RSLA 1W5TA 1IOWA 4OJQA 3STUA 3PE4A 1TCAA 1J06A 4QNMA 1YL6A 3EJ6A 1QIDA 4JKIA 2XUIA 4WESA 4TL7A 4AP6A 5BSRA 1Z2CA 5AVXA 1JECA 2WT9A 5MN6A 1WETA 2XNKA 1WB6A 1D0VA 2QE7D 2VQ6A 5J4VA 4PO8A 4RTKA 2CVPA 3SDSA 2AYXA 3D8BA 4ZARA 3Q85A 5F23A 2CXPA 1XTIA 5AKEA 4C0XA 4C4PA 3PRJA 4D7AA 1W96A 2MINA 3PEFA 3CMMA 1DRJA 1QS0B 4FSXA 3DKVA 4RKWA 3TNJA 3QFHA 1KDPA 1YJXA 3Q3EA 1RIFA 4LA4A 2OWEA 2JAXA 5TF4A 5AM0A 1CS4C 3L8HA 3VX4A 4C0QC 4F4UA 2O2SA 3AZQA 4IIUA 3P19A 3TBFA 1GRRA 3KT6A 1TYYA 2OO3A 1QHGA 3PL2A 3NC1C 4L9AA 3OZTA 4RTLA 4NXNB 3KQWA 1GZ6A 2CVFA 2E18A 1C80A 3LECA 4JLVA 4ZA2A 2NNLD 4C6SA 4CQMA 1ZOIA 1ST2A 2B6HA 3SBOA 4WQMA 2JGMA 5DOVA 1BH2A 1CIVA 2HF7A 3UMBA 5TMPA 1YVRA 4ARAA 2FW6A 2RBGA 2NV6A 4XOUA 1L2LA 3W8FA 1UPTA 4HDQB 1JE0A 4ZXFA 3TR5A 1TQ4A 2JEYA 2H6EA 3E48A 2J45A 3D8SA 2HR1A 2ZUEA 3JD2A 1DCKA 1QO0D 3H5RA 5TEVA 3T94A 5BV7A 5IDQA 2QRLA 1DQNA 2P1ZA 2PKXA 4FFOA 3RK4A 3JZDA 1NHGA 2JFFA 4INPA 3LXMA 3GRKA 3T54A 3ZCVA 1SBTA 1OFIA 1NXOA 2GT1A 2JIZA 4JKUA 4O5OA 3IQEA 1XT6A 2NUPA 3I3OA 4L6CA 4R8VA 4EJSC 4R1LA 4W8GA 1H9AA 3Q88A 4XUEA 1I33A 5AHWA 5C5EA 3T1VA 4NBTA 2WIFA 5KS2A 4MGKR 3T61A 3PUWA 3V4RA 5IX8A 4WLNA 4KKXB 5EP1A 5A1TA 4F2DA 3JRNA 2IQIA 1EM8B 1SFRA 4NAHA 3PFNA 2ZJ4A 3ZHUA 1XCPA 2HWXA 4F3YA 2GDJA 5CEEA 1K2WA 4EY7A 1J4AA 3A4LA 3FHOA 4EO4A 4B9AA 3DDOA 4IO0A 1AGRA 4MPTA 1TUBA 1XRMA 5LCXA 1OX4B 4B5KA 5ICEA 4ARSA 1SIWA 2I76A 4KC0A 2WSYB 4QGFA 4YQYA 4D80A 2FG7C 4URHA 4XE5A 2Q3BA 1J00A 4AP9A 4NBSA 2PGNA 2FQ1A 2V4UA 5AESA 5LKAA 4OJTA 4TL9A 3CEMA 1ZA2A 4ND7A 4OHRA 4D9FA 3WI7A 1JE1A 1JU9A 3FF4A 2BTOA 2HT6A 2NU8B 4B6JA 3RYIB 1A0OA 4D9NA 4DYHA 5U4XA 4QL3A 1Z3CA 4BNVA 4IHJB 5F78A 2QD3A 1QZUA 6AT1A 2X77A 1EVJA 3OQIA 5AJVB 1NL3A 4CIBA 2JIMA 3TLXA 2W4IA 2ZRFA 5MF6A 2WSSD 4BQEA 4OHVA 4TKUB 5F0ZA 2OOKA 4IRUB 3AESA 1XRQA 1S8OA 1U7PA 5CLHA 2BKLA 2XQVA 4ROSA 4N7JA 2HMUA 2SNIE 3W3AA 2WTBA 3OU2A 4IS2A 1R0ZA 3NDIA 821PA 1IHXA 4F5DA 1SEPA 1VC2A 4KU4A 3AU8A 3AR6A 4MMZB 3I8SA 3JWIA 1DUVG 3CZ4A 4XGIA 3GHHA 3PQEA 2VXBA 4MPDA 5KCZA 2QT1A 5C4GB 5AR1A 2PS1A 5B1SA 1WHTB 4QOFA 3RS4A 4C0HA 4X8OA 2BZSA 4A1FA 1ZMTA 2B4RO 2X86A 3PIIA 1YJCA 2HRRA 1H5UA 3WRYA 1FNDA 3N6RA 1QB8A 1I6LA 1C7RA 1CUFA 3QFTA 4UE2A 4YP1A 5LQRA 4HQ6A 2IHTA 2X7XA 3HKBB 3NM4A 1SY7A 4NZPA 5AHXA 3TN7A 3FGOA 3GV0A 2ZB7A 2X3YA 4AJEA 3AZOA 3X3HA 2XUPA 2N3ZA 4S1NA 1DC5A 2OG1A 2ZI4A 1C9MA 3NAZA 5CFNA 4TMKA 4KH0A 1VJ0A 2HX1A 3PPVA 1Q0SA 2R0QC 2NWQA 3N3BC 2VJDA 1NTRA 3DTVB 2P9QA 3LQYA 1ZGAA 3KBBA 1JLKA 1MABA 2CLHB 2F1IA 5D01A 3CPHA 3O03A 3QLUA 4L5YA 4RV9A 3W4JA 1OB2A 1C0IA 2QL7A 2ZWAA 3MVEA 4TRNA 4CXMA 4G5SA 2AC7A 4ZVRA 3VHQA 1RKQA 3BHJA 4XWAA 3AHHA 3DTTA 4UU7A 1R8SA 3T34A 1W7AA 1I5OA 4O1IA 1OXXK 1S2NA 2YZNA 2ZE8A 3EVGA 4I55B 1CVLA 3AHEA 4YJGA 1KSHA 3N2KA 3PSHA 4ZRDA 3RH0A 2B1JA 2GPBA 1MRZA 3PR2B 3DLPX 4BIIA 2HIMA 2VDUE 4AMZA 3EH1A 1HEIA 3EIOA 1KE1A 1G42A 3WGLA 3OIUA 1PD1A 1G5TA 1IN8A 5KNBH 3DPSA 3HI6A 3CCCA 4WNIA 1DAMA 3DJFA 2WT4A 4N5HX 2V6MA 3R5FA 3JYLA 4YJKA 5T67A 3EUEA 5JD6A 3U16A 1SKAA 1ZKDA 5I8PA 5B2EA 4OY3A 2GYYA 1V95A 3EGVA 3LP6A 3MCVA 5BN1A 4HMOA 3LVRE 2DE0X 4Q16A 3DOHA 4ZVOA 3ZZUA 1H1DA 4EO7A 4LJ7A 2WWWA 4CM7A 4R05A 3HB4X 3NZEA 3FI0A 3IP8A 3GX1A 1LWOA 3AHIA 4ZZ2A 1CULC 2F3TA 3LF2A 5FP0A 4BU1A 1PJCA 1W35A 2FEWB 3I52A 4D5EA 4MROA 2PS3A 5ITSA 1J0EA 5JD4A 1YZGA 4C43A 2GO1A 4RY0A 2O8CA 2Z09A 3LC2O 2HMTA 1J2YA 1WF6A 3AY6A 3BM5A 1SBNE 2PV0A 4A10A 4Q4HB 3CBGA 3E9MA 1KAMA 1BO6A 1R15A 3VOBA 1ILWA 2F7SA 3SF8A 1T91A 2AJLI 3EC7A 4Q47A 4GOOD 4EDHA 3K15A 2IJGX 2EW8A 4AJNA 2ZUVA 3S2SA 2R96A 1U8FO 2XDQA 5BSGA 4WKBA 1F0PA 1Q3KA 5KNDD 1UAGA 4A8TA 1TM2A 3ER9A 3EIHA 4RL6A 1RYYA 4R8LA 5FWYB 1IB0A 4MW5A 1K9SA 2EF0A 1X1DA 2NT4A 2JCYA 2LP4Y 2UKDA 1S3SA 3H13A 3PC6A 5IC6A 2A30A 5T4BA 2P6MA 4AF8A 1TU0A 5DI3A 1K92A 4MVCA 5CGZA 1QH0A 4RFLA 2UVDA 3RTCA 3OVMA 4Q9JA 4BKQA 1ODLA 2V0CA 1XC7A 4LDPA 3W2EA 4DC1A 4I4TA 4L2IB 1HX7A 1S2MA 3A1FA 4MS4B 4NFLA 3UFXB 1UMCA 3LDGA 2NZVG 1ULTA 5J2UB 2ZWMA 2GNPA 2XYPA 3K53A 4UW9A 3R9XA 3KZXA 1P2TA 1FSZA 1V5WA 2OC9A 2X0JA 1V25A 3F78A 3VH3A 3ZBQA 2VEDA 2X8LA 1H65A 1PYOA 2G6TA 3KQVA 4M83A 3BWCA 3FRJA 1Q95A 3W5VA 3A3YA 2YXTA 4LC4A 3Q41A 3Q7QA 4L15A 2GERA 1G5RA 1Z0FA 5HF6A 3L7CA 2GZ1A 2UVQA 8MHTA 1M33A 2N9UA 4IF4A 1H8HA 4C87A 1Z0SA 2A94A 2BFFA 4MVJA 1KWKA 2YYZA 5HYVA 1KPHA 3VNBA 4BX8A 1I14A 4GSLA 1XE3A 5KWSA 3D3KA 1NF2A 2J5BA 2WILA 4QFMA 3UK0A 3WMGA 5BSVA 2A88A 2N46A 4P5EA 2J0QA 2CJWA 3FLBA 3PD0A 1M0SA 1YZYA 4UUNA 3WL7A 5EHXA 2SKCA 5CIYA 4PGGA 2Y27A 3QYFA 1H3NA 1NOIA 5ADUS 4II2A 2NZYA 2O8NA 2O1XA 4O8CA 1ICIA 2O50A 1FVXA 1QYWA 3KLMX 4BRSA 3KJHA 1LK7A 1Y1SA 2VC2B 4FR0A 2FSFA 1DWPA 1SG0A 1XLUA 1EK6A 2JFQA 3MTIA 4LV8B 4LY0A 3KPWA 1JVNA 1T4DA 4NK5A 1YGJA 2R7LA 4WOPA 1JDUA 3R7DA 4NY1A 2FPIA 1ZK1A 2I8CA 3FVQA 1HYHA 3OC0A 4RLSA 1L5OA 1SA0B 3IEVA 4H9GA 3JQ8B 4AMGA 2EHDA 4R1PA 2YWFA 1QG0A 3CYFA 4WH0A 2ZI3A 3I23A 4HGQA 3BMXA 1D2AA 4GBGA 4TZ6A 2AOUB 3CUWA 1D2GA 3L7OA 4FB4A 4H27A 5DBIA 1WCIA 3KWFA 1JBEA 2K6GA 4INJA 2FWIA 1EB8A 1M8GA 4JJ6A 2VH1A 4B43A 4NARA 5AK0A 3VR6A 2R7AA 3OZIA 3NNSA 2G1UA 1IN4A 1IN7A 4Y2XA 3FZEA 3RS5A 4NPHA 3WZLA 3KVYA 2EX1A 3F5DA 1MJNA 5IZ4A 3RFXA 1GPDG 2YWRA 3R3VA 1UC8A 4D8XA 2CHFA 4NFSA 3HB7A 3TTYA 4NULA 5IFKA 1PZNA 4C0KA 2ECQA 3A3PA 1NI5A 3KB8A 3UJBA 3P32A 1IN6A 1E5TA 2XODA 3P0IA 1NJ6A 4RAQA 4B8YA 3FTDA 4B3JA 1OLSB 3KFVA 4FBLA 1R3UA 3CEPB 4R51A 3UPDA 4WTOA 1S4MA 2XMCA 4CVNA 2XUDA 3VU1A 5DNWA 4KG7A 4TZ0A 2ABQA 3GNTA 1XZPA 1YF3A 2O3TA 1ENYA 3Q8KA 2ZRCA 2IVZA 4YX9A 4EKDA 4ARVA 4BQSA 5JVDA 3D1JA 3OF3A 4RK4A 4NMHA 3QWIA 1L4NA 3DHYA 4BAZA 1VL5A 3FUTA 5IJ0B 1N6LA 4AQ7A 4HWRA 3G0BA 3JR7A 2HRCA 1LS1A 3BH6A 3ASZA 1EPUA 3KK0A 1GNRA 2AN9A 3HB1A 5EXEA 3U9SA 3E9DA 2RGWA 4ZT6A 3ROKA 4G5OA 1F3LA 2GZ2A 2IODA 3CU5A 2V1XA 1YBHA 1E5XA 2CL5A 3JXEA 4XQ9A 4Q3BA 2OUIA 4OIMA 1J56A 4JJKA 4IFTA 1EKXA 1IHPA 5JZSA 1G2OA 4RXTA 5I7EA 4LC1A 4E5KA 2H65A 4MHTA 1ZU5A 1L7AA 2ANCA 1A8SA 4HN9A 1WMBA 1Z39A 5AVKA 3WNQA 1HA3A 2HBYA 3LO8A 1CR0A 4GMGA 1DKPA 3IAS6 1E1RD 4KQIA 5JDCC 3C0KA 3Q87B 3MSXA 3FNBA 3N8NA 1FDSA 2ZB8A 2B61A 2IV7A 1CUDA 1TCUA 4RF5A 4EBUA 3D3WB 1JQ3A 2X4DA 2GCGA 2NO4A 1AU9A 4BQIA 1GPUA 2TS1A 1I80A 5C4MA 5B53A 5KQRA 1SQFA 1DG1G 1K6XA 2EBFX 4HRXA 3K8QA 3P0RA 4KIUA 5E7QA 3VR2A 4MVYA 2WKWA 3V1KA 4KR7A 4H7PA 3RBZA 3DZGA 1DG3A 2F8LA 4OH1A 1XDGA 3FYCA 2FPKA 4BLOA 4XWWA 3IIJA 1XVLA 3IUJA 3PUJA 3DOUA 2FVXA 2WKPA 1KGDA 2PKRA 2ZEJA 3FFAA 3JALA 1A9PA 4G23A 1YUMA 4IFIA 4IPTA 4M88A 4U9UA 4WFJA 5FPTA 2P2ZA 5FAKA 1GPBA 5CFQA 1Z7EA 1UB0A 4UBOA 3EDOA 4QUBA 3I5XA 2RGDA 3BG5A 2JGKA 2PXCA 2OZKA 1Y7HA 3E7WA 3HKDB 2HL6A 3VC7A 2YVAA 4R3UC 4K3VA 4CU2A 4KX5A 4DLRA 3Q12A 3U0BA 4BQRA 5B6AA 4M89A 4JI4B 1KBZA 2I3ZA 3RNLA 4XB2A 4K87A 3G5AA 3G9UA 5KTSA 3HC7A 2HWYA 5KHLB 2KPOA 1UZNA 1DLJA 4H7EA 1X7HA 4GECA 3W5IA 4ITUA 1ONPA 4EIWA 4BLRA 5C8ZA 1M2VB 4NEHB 4B31A 3G3EA 3O4VA 1DC4A 4GD3Q 4JJ8A 4N12A 1J0BA 4IWNA 4BQQA 5WRFA 4M0FA 1U65A 4LHXA 3FOFC 1QF6A 4ZDJA 1OIVA 3LC0A 1WZNA 4KAAA 1V9LA 2ZJ7A 5IM5A 3HMKA 1VL1A 3DDZX 2ZSFA 4ZCMA 1ENPA 1UK9A 4KTTE 4C05A 4L6AA 2GD6A 1IL0A 4BATA 2YYSA 4K1XA 1RJ9B 1KVSA 1YGYA 5FBRB 4C14A 3HV2A 4C22A 1AS3A 3E0QA 1CHNA 1G66A 4BZXA 4CEHB 4LJ9A 5U4QA 4CT5A 5EE9A 4HVLA 4H0NA 2G7MC 2IT1A 2BN4A 4IG4A 4LDZA 5JMPA 3VPSA 1BEUB 2WZDA 5G0UA 1P7PA 4YUXA 1AV7A 1OT5A 1MU0A 4JVNA 3I3YA 2X9NA 5EZYF 1PK7A 5AO9A 1RFVA 1SKYB 3A1WA 2XB4A 4IICA 1TA0A 4UAGA 4XQ0A 4HVTA 2R11A 4MV7A 2N1BA 3KQNA 3VX3A 2OGTA 1LSUA 2W8BA 4LHWA 4NV1A 3UJDA 4MJ3A 2J6HA 3JQBC 2CLKB 5MN4A 4K3UA 5B64A 3AUYA 3L02A 2PA0A 4KN9S 1Y63A 2EFHB 4Y2RA 4YT8A 1FFCA 2TECE 1CUVA 2CK3A 5KVSA 2I1QA 2JCVA 4ZVKA 4CEJB 1Z6AA 1NUQA 4NBLA 3OO1A 3AJRA 1BWSA 2HA2A 1DWUA 1GFSA 3AVQA 2NU9A 1E32A 3L0ZA 3OKFA 4P7GA 1N4AA 1T1EA 2R8EA 1WLSA 5HFNA 3O8RA 1QYRA 3UWSA 1N5DA 1TFRA 1RC8A 1YDHA 2IH4A 4EQ6B 4CLOB 4QUIA 1L4UA 4F86A 1K6JA 1LQTA 1RJFA 2B94A 1C0PA 2Z5FA 1GRQA 1W4AA 2IDKA 1Z6PA 1Y5LA 5EY5B 3N87A 5EMJA 3FX2A 3TG8A 3KEUA 5DW3A 1OXVA 1PJAA 3RIGA 2O20A 5DNYB 4B3MB 2OECA 3KUDA 4KO1S 2NVUB 1EFTA 1EWTA 1YB4A 1JDBC 1D04A 4LCBA 3DHWC 4Q4JB 5C5IA 1RM4A 1UFKA 1Y8RA 2JGFA 4JA0A 1L7BA 1QHHA 1P9LA 2XTZA 3DG9A 3A1DA 2TMYA 3GEBA 3DMFA 3DWGA 2DPMA 3QVSA 4JFAA 1G3QA 2HLPA 4XKJA 4BLQA 1NFRA 1XPUA 4EFLA 2O0HA 3GJ6A 2DBYA 2OCDA 3UUEA 4C7BA 1EUDB 2IE8A 1RMYA 1Z8HA 2VNAA 3BDAA 2QX6A 2WLTA 5E3IA 1JB9A 1C14A 1DFIA 3GRVA 2NNWB 4L5JA 4RC9A 4YRPA 3W78A 3WO1A 3I1IA 4NSNA 2QRHA 4PANA 4JDUA 4I1PA 2LXNA 4MQEA 2HA5A 3RHTA 1BMTA 3JATB 4HQLA 2JEZA 1ORRA 4FMCF 4OA8A 4DMFA 2I78A 4M0EA 3GXBA 1LWNA 5D3KA 4MZXA 2I8AA 1C3XA 5AM3A 1EK5A 3KSRA 4PC6A 3D0QA 3AEUA 3BRQA 3UHPA 2QPTA 3O1HB 2P9YA 4BUZA 3EY9A 4IQ8A 1ZUHA 1WLYA 4KYTA 5FOVA 5TGTA 4BEJA 3DCJA 3HUDA 3RTAA 1ESDA 4NCIA 4C5LA 1ZZGA 2D5LA 4QBIA 4S1OA 5HCIA 4M9SA 3URMA 3F4BA 4LRUA 2AYYA 4ZQIA 4DLYA 5JPCA 5JYEA 1MDFA 4WZBB 3CG0A 4H7HA 2PLWA 4PYMA 3TOSA 3UJ3X 3BIFA 3SEZA 3JAKB 2X5XA 4JJ4A 2C00A 1S8NA 3JQAD 3JVDA 3WVNA 2R48A 4OREX 2QU7A 3C4JA 4TL8A 3E9EA 2XRMA 4BVLA 3CUKA 3P4YA 3CNOA 2ZS9A 3RS7A 3IBYA 2XIQA 3VDRA 5CFMA 4JN6B 1UBNA 4QULA 2OAEA 4H1HA 1Z63A 1J23A 3E05A 4G37A 1RZRD 1RAIA 4RIEA 3VISA 4C5JA 2ROQA 1GN9A 3AONB 2CNWA 3D02A 1GZ3A 5KUTA 3U1BA 1Z2OX 2Q5EA 1E2KA 3DDNA 3WL4A 3FKQA 2IYLD 1NBMA 1SPBS 4RTQA 5I7OA 4IZ6A 5CFZA 3RAPR 1DO2A 2ZXEA 1YDFA 3LA6A 2A57A 3MCWA 2HV9A 3AJDA 3V3TA 4B3XA 3ZYZA 4INAA 1V39A 4NBRA 3HR7A 3WYFA 2ZTSA 2NXEA 3DWFA 3LY5A 2R6CA 2IH5A 3RODA 3BH0A 2NU6A 1X13A 4FOTA 1C0LA 3WGYA 3TSAA 3VO9A 3HYRA 4BWYA 5DLDA 3T95A 2JJ2D 3AUFA 3I4FA 1KZ1A 3T99A 3HCRA 5KOJA 3ZI0A 1EUYA 2IEZA 4ZWNA 2AOXA 3L07A 2H2WA 2NQTA 1ZBDA 3LLVA 1Z8FA 5K3AA 3UC5A 3GT3A 3I2GA 4KDRA 1ADBA 4D57A 4YRQA 1QGUB 2XADA 3GJZA 4YFYA 3H5LA 3QF4B 4CYMA 5CVTA 3UHOA 2XDAA 1HDGO 1HZZC 4NCJA 4RANA 5E4JA 1T0HB 2CSUA 2NV2B 2C61A 3A36A 3D3NA 2H1LA 2OB1A 5DCYA 4LGMA 5F5XA 3R24A 2FQYA 2SKDA 3MBHA 3GDOA 3NBAA 2QRQA 1RYMA 4HLNA 4X61A 1KAQA 3WY9A 3DQZA 4RLFA 4BO3A 2FEOA 1KZYC 4WKCA 1HFKA 1X7GA 1Y4AE 4KANA 2IYYA 4OL9A 1L6IA 3D3JA 2V78A 1CR4A 3WKEA 4MAFA 1X9HA 1DQRA 2VHJA 4N76A 5L3RA 3HFJA 1KY2A 3E70C 1DQPA 3LUBA 2AS0A 1ZBQA 3ACDA 2H1FA 3NHYA 3M89A 4MYSA 4CU5A 2MSKA 3UT5B 1P19A 1SCQA 4JYCA 2OMKA 4LDQA 2QUBA 4EMBA 1GKIA 3BMNB 1EG2A 2Y0PA 3PHGA 3V8PA 1ZK2A 4FDTA 5I4BA 2NYRA 3KDSE 1DS6A 4EPXA 4CIAA 2MYPA 1LDBA 5THKA 4NG4A 1ZITA 1JHXA 5KC9A 5AKJA 2OHXA 4DTIA 4F2PA 1VRVA 2G9ZA 3LT1A 2FSUA 3DO6A 2H9AA 3SIWA 2IGTA 4K9QA 1JGTA 1EXMA 1IBSA 2QUIA 5IM4F 4FHZA 2PZLA 4KIJA 4QYIB 1VBKA 4DU5A 1J07A 1W0JD 1USUA 3A1VA 1OAOC 1P77A 4WK4B 1TVKB 2XNDA 3L7JA 4NJMA 4RDXA 4QUGA 5GTDA 3W2FA 3FD8A 2ZVPX 3RU3A 1GILA 2BRUA 3CX8A 2EX4A 2Y0BA 4ZU6X 4XYEA 3V48A 3GH3A 1KZ7B 4D6YA 1NI4A 2HWUA 5JROA 4LMRA 4R41A 1ISMA 3ZZNA 2Z9CA 3DZDA 4XM0A 5I9BA 5B4TA 5KC8A 2PAFA 3AL3A 4QC2A 4R83A 2QTCA 3H1FA 1EE9A 4JUFA 4A8JA 4RKQA 9ATCA 4DG8A 3DLTA 3V1LA 3W6ZA 3R75A 5BW8A 4QPNA 4LI0A 4P2GA 5BURA 1VBNA 2EIXA 1P1FA 1IAQA 2RAFA 3PF8A 1Y6JA 2AFHB 2FZCA 2R5WA 1F6DA 2W6OA 2NYAA 4QPJC 4C0BA 5JZMA 2NTEA 2INGX 1QRSA 3U80A 3CGGA 1AMOA 1K97A 5FUXA 1W5SA 4TMZA 4FHFA 2O5VA 1QQTA 2MYUA 2WYVA 3I58A 4KLAA 4IQGA 3BWEA 1RT9A 3UAOA 3RAGA 2C9OA 3C3BA 1FGSA 1KI6A 2Z8ZA 3JS5A 3B5EA 1A97A 4U6QA 1W4BA 3WRVA 3AW8A 3QQPA 3UXEA 1MC4A 3PJDA 2D62A 3FZNA 1R0CA 3EXHC 3NX4A 4OP2A 3WQBA 4RA9B 2WAYA 2WZQA 3VOTA 4IMPA 1YR1A 4FYXA 1PV4A 1C9EA 4BB6A 4UC0A 3U3DA 1G6KA 1CZOA 3LZ6A 2FE4A 3MMSA 4A16A 2WJJA 8GPBA 3LXRA 5ALDA 3TAHA 4E5DA 2HYDA 1XMSA 5H5JA 4KWTA 2MIIA 5TJHA 4QZVA 4D42A 4MDFA 2PLAA 1Y7PA 2C3UA 3UJNA 3N2YA 2ZRBA 4P80A 1R10A 3DDUA 3ZJ5A 1F20A 2YHSA 2P3LA 3MS4A 3EQ7A 3JARB 1LJUA 2JASA 5CVJA 1ZCZA 3TLGA 4EOHA 3NDJA 3TRDA 3GRCA 1QDUA 4LRWA 1EUZA 1R18A 2YY6A 4DC0A 2PV7A 4YDRA 3WBKA 3ADDA 1GQYA 4JB0A 5ENDA 3L1HA 4ARZB 3GLVA 3EDRA 3NH6A 3L4JA 3Q1YA 1W5FA 4FHDA 1QK3A 2F4NA 3S5JA 4UDYX 2I1VB 1FE8A 1HH4A 4PX5A 1S2LA 4OI1A 3JAMA 4Y2TA 5JXIA 1CEXA 2IV3A 3IT0A 4I9UA 4IIFA 3PGKA 1M72A 1XZJA 4U6SA 1J2RA 4JKSA 4HS9A 3HYCA 3IH5A 4MS1B 3MJHA 2FSPA 3GMIA 4L51A 4WCDA 1P44A 2BFCA 4JT8A 3ADBA 2BCEA 3FCEA 1UZUA 4N5MA 4W99A 3QJYA 2ONJA 3Q8MA 3CKMA 2F3PA 3DL0A 3HJCA 6PFKA 1D0IA 3DBRA 3A26A 4OM7A 4HX2A 1I10A 2QPLA 1YA4A 3NB0A 1RI5A 2TMKA 2Q9BA 2PGDA 3C1UA 4IG9A 4IV8A 4HJXA 1DEAA 1QJCA 2RHTA 4QQNA 1UXJA 5LMUB 3TCKA 3LCVB 3LQKA 5HRUA 1DV2A 3G2IA 4GUDA 3R6TA 3FZYA 4YJ2F 1RLIA 3C43A 1KEEB 3ZE7A 4ZDKA 5B3KA 4LCEA 5LZ9A 2AUMA 4LXUA 3VBCA 5LQAA 1T5TA 2DBQA 2YV3A 1I5EA 5FLEX 2F67A 3NV9A 3V42A 4WI1A 3G02A 3TXYA 1W94A 3I0NA 1U5BB 1B15A 1CY7A 3K20A 2UYQA 4L16A 3ZW7A 1TZ3A 3BREA 4MCIA 3H0CA 2VH5R 4O0MA 5EZYA 1EWYA 1O97C 1L3CA 2Q7XA 3U4AA 1L5HB 3DCIA 3DZBA 3E3LA 3G5LA 1EFKA 4YMTA 1U31A 2FQXA 2IYRA 5DW0A 3B89A 5ARDA 4COKA 4O2RA 1C9JA 3MWLA 3AUAA 4MTLA 2ZIVB 1EDOA 4TSFD 4WRRA 3VZSA 3IP9A 4EA8A 5LXTB 1UCFA 5ECYA 3QNWA 4O4JF 5JALA 1AV6A 3Q8LA 4DLWA 3R0VA 4PTLA 2Y4NA 3IUMA 1AQ6A 3PHBE 2G77B 3DUWA 4G0NA 1XQXA 1Y8CA 1L7OA 5JCPA 2Y1KA 3GG2A 5TQJA 2DYKA 3ZJUA 3WLJA 4FGUA 4WT7A 3D0OA 4MVJM 2WJ6A 3HADA 3E0XA 4NTZA 2IUSA 4DIKA 4JD5A 2M6LA 2FLWA 1QR2A 3NT4A 2JRCA 3CH5A 4FQ5A 4JNKA 4O5AA 4XPZA 5EJFA 4U0JA 2X9GA 4UTRA 5BYDA 3B6KA 3O84A 1Z12A 2HCFA 4C4YA 2E48A 3E5NA 3V6MA 4ENQA 1DEHA 3E53A 1G6Q1 2FW7A 5EIBD 5BRJA 3WJAA 3FXAA 3VR3A 1PWYE 4G0QA 4YTEA 1RKXA 4YI3A 3NV7A 4KQJA 2WIKA 3A6JA 5CA0F 1KDZA 1NJFA 4JLMA 4CM1A 1NX6A 1TF7A 2JD1A 2XDYA 5ILQA 4OK5A 5IS2A 1WDKA 1D07A 2EGUA 3PGLA 4Q34A 5CYFA 3LHIA 4E88A 1OI4A 2SBTA 1HXHA 1W85B 5DNEA 4B6RA 5KWJA 3N59A 1IH8A 1UK6A 3QU7A 4UHDA 4KYUA 4UDNA 1TM4E 3ZWPA 3D43A 5BYFA 1J5XA 1OKKA 2XMSA 4Z0HO 3MB8A 1MT3A 2XAAA 3D59A 3TXAA 4TT8A 1R0YA 4ARUA 2PS9A 3QFSA 1U2DC 2FQWA 1S1CA 2GPAA 1G8KA 4O2BF 2R6DA 5E1OA 4AZ3B 4ZI5A 2C7RA 3U5TA 3O94A 4OQMA 4JVOA 3K0CA 4YROA 1DEOA 4XLZA 1PGJA 1XXHA 4UBEA 5ALMA 1SUSA 3KUXA 4CIDA 2YN0A 3Q3JB 4QBGB 3RQSA 1UKCA 1VE3A 4PX3A 4RD3A 5TE9A 5J5CA 1X7ZB 1WZ2A 4F4FA 4LIPD 3R3HA 3KJEA 1VPWA 1SURA 2B0CA 5CLJA 2A92A 4Z2AA 3BD6A 4OGFA 5EERA 4LXYA 4BO7A 1PFQA 1CY6A 2LTAA 2CNOA 1HG1A 4AX4A 1NW9B 4BFWA 2BGRA 3TOZA 3V00A 4AN1A 5IDWA 4FYPA 1A8IA 1TQ6A 4WX2B 3GT4A 1GADO 1M7BA 1E9SA 2QRZA 2QTHA 5MN5A 2HZBA 1NVKA 4XIFA 3LPLA 1UKEA 4MWTA 4ID9A 2W6ID 1WQ4A 2ZJ6A 4D0RA 4PRKA 4YREA 3K0FB 1J33A 5BQXA 3PCTA 1GPH1 3SM3A 2XKBA 3OZXA 2OCPA 3AHGA 1SD1A 3QVMA 1CERA 4UQPA 1KMHA 2A9RA 2P0AA 3B8EA 3DBVO 4O4IF 3UJ6A 1FXWA 5CFPA 2V5VA 3ZVNA 2FFAA 2Q07A 3ZNQA 1TMOA 5JSKA 3E9RA 2DR0A 3NBZC 4I4CA 2A3RA 3TCXB 1E3WA 4PLYA 1O6FA 4BEWA 2GZ3A 4AQDA 4EGJA 1BRTA 1Y8ZA 1XRLA 5G2OA 1V16A 2QXUA 1SD5A 1QVRA 2B0JA 3DV9A 3MPUA 4WOBA 3LCCA 1F2UB 3G8DA 4TMTA 3HZRA 3BMCA 1LLQA 3ERCA 2X1HA 2K4MA 3AUKA 4OXRA 4KR6A 4KGVA 3SY8A 3RQ6A 3DZVA 2ID7A 4JU8A 1COWD 1F38A 1PBNA 1YB6A 2COUA 1RJEA 4NNPA 1XZKA 3CJRA 1E1QA 1H2WA 1WDWB 5LOVF 1CQWA 1TO1E 2OD2A 3B5JA 3ELUA 4G4SO 2V0NA 5LWQA 1CUGA 4EO9A 3FPJA 2O2EA 4E3AA 1T3SA 3OUTA 4XB6B 1P18A 1SBCA 1XQ6A 1WO8A 1KR5A 1T4BA 2QTWB 1KOJA 3K2IA 5C51B 4KK3A 5CNJA 3NPAA 3PC7A 1M2WA 1OF1A 2AZ4A 4FFRA 4HDMA 1UKYA 2C3YA 4HYEA 3M4ZA 3UV6A 2IXBA 1VHWA 3VSAA 5FHRA 1U7UA 3FYTA 2R44A 1IOLA 2VDJA 1VK4A 2JHAA 2Z9DA 3GRRA 1ESQA 2UV8A 1GQQA 2WWXA 4CN9A 3DMRA 2OAQ1 3KJFA 4GT1A 4AM8A 5KAPA 1U2ZA 4BGIA 4YCSA 1WBBA 1MTOA 4FILA 1L5SA 3PT5A 4RSHA 2BGTA 3P5SA 3H5TA 3DZCA 3H2KA 1T8WA 2BE7A 3EFEA 3PEYA 5L51A 1KSGA 1W75A 2IDMA 3R9WA 3X2FA 3KOWA 4K93A 1M2FA 1Y3HA 1XZBA 4KK4A 1YI0A 3BXHA 5E3HA 2JGNA 5CLQA 4QU9A 1C30B 1WW8A 4CR7A 2CHUA 4AKIA 3W8RA 2ATCA 1V0JA 2W37A 1PGPA 2YN4A 3HO6A 4IKOA 4K86A 4R2HA 4YAJA 4ZVNA 5ARBA 4RY2A 3WC4A 1PYGA 2IHJA 5GJWC 1M2NA 4OV6B 2QMHA 2Y93A 1UM9A 5BOSA 5H9WA 2P65A 2QYOA 3LF1A 5JNRA 5LSAA 3GFPA 4J0DA 1EBUA 1TD1A 1TA4A 3A28A 2C82A 1EX9A 4EG5A 4R2KA 2B7CA 3HDTA 3EWAA 1C1DB 2Q7DA 5AW5A 5BNTA 2PMDA 1UM8A 2QUZA 1FY2A 2DUUA 3ZU5A 5F7XA 1PTJA 3KVOA 2IPLA 3RBAA 1Y1LA 3EF3A 1XKTA 4JZYA 1E6KA 1KPGA 1O89A 1FSPA 2EIHA 3L5KA 3K0SA 3FR8A 1J39A 1M76A 3ISJA 3OE1A 3GROA 3SYLA 3TW0A 1QS0A 4CLXA 3NHZA 4DDHA 3CBQA 3MCZA 2C07A 3VYSB 2BGNA 2QUJA 4CTOA 4D4JA 1DO8A 3HVJA 4L22A 4IKEA 5EXSA 4DJEC 2G80A 3DAHA 3BL8A 3KQHA 4IBOA 3ZVLA 5EJ5A 2V8OA 3IXQA 3PNVA 4IUYA 3R0IA 2XJAA 1DC8A 1YZQA 3L0IB 3KLBA 5EI5A 3ILXA 5DNVA 1QSGA 4E5VA 4GKKB 1U2SA 3GVCA 3UOGA 3LQQA 3VASA 2Z6QA 5KTKA 4CWAA 3LS2A 2EEZA 3DEZA 4BN0A 2WI8A 4EJ6A 4P3XA 3M9XA 1G0OA 4YJDA 1AKUA 4ABTA 2WMNB 4CMKA 3S27A 1JHDA 3RYFB 1DQZA 4YRCA 2QRKA 4EM6A 5AI8A 4DJJA 1ZCAA 3OZAA 1VZ2A 2ISCA 4A2QA 5K0LA 3IDFA 4GOND 1XJWA 2COEA 4PAQA 2XV1A 3DPUA 4OFWA 2VBCA 1FFBA 2B1QA 1FMCA 3SSOA 5AVSA 3NYWA 1I5RA 2PKCA 5TPZD 3FMIA 2Q4BA 4MLDA 2J3HA 3PR3A 3USES 4GDFA 4U7DA 2ZETA 4KBFA 4UTNA 1RWQA 2V7WA 5F12A 3GBVA 4YV0A 1XGKA 3G2PA 2GEFA 3IR6A 4HWTA 1OMOA 4L9WA 1ZG3A 4WSOA 4OQPA 2VP4A 3S5UA 3E4CA 1EM8A 1Z35A 2CXHA 5IN4A 4QRHA 2GN4A 1QGZA 1RI4A 2WHPB 1VIAA 4KQHA 1PQ4A 4ZK2A 4Y6OA 1KS2A 1L7DA 2CXNA 4P3KA 1FUEA 3HM2A 3OCWA 3UAZA 3SHTA 1BVUA 2HREA 2A0XA 1DFGA 1Y9EA 2NSHA 1OX4A 2IP1A 4NP6A 4F1KA 1P33A 1W4CA 2G36A 3RB8A 5DN6D 4PAGA 3ST7A 3HEMA 1SPXA 4F85A 2YICA 3O7WA 4ZO4A 4GP7A 5HEKA 4X00A 4HAXA 4XJSA 5LQMA 1E2BA 3RQXA 1RSZA 2RJ3A 5ECWA 2GBIA 1WXGA 3OI7A 4YRLA 3PYXA 4W9RA 2DQSA 5HUHA 3Q1KA 2J0EA 3DV0B 5JU6A 3SZOA 2RGRA 2QD2A 3L0CA 2ORIA 3LOPA 1IDN1 3C3YA 3HPRA 3RYIA 2DY1A 2JFGA 3TIGA 3UAVA 3DV2A 3HWRA 4IHJA 3IE0A 1LA2A 4RPKA 4BB5A 1H4TA 1IIRA 2ID4A 5CLFA 5ICSA 4ADSG 4FFDA 1PSZA 2H2HA 2YMQA 2VZ8A 4D8UA 4TKUA 2O3UA 3NHBA 5A5GA 3M1AA 5DX0A 1ZGJA 4XVRA 1KI7A 4KR9A 2RBKA 3FIUA 4GSKA 2NO6A 5FTLA 1IVYA 4OOFA 2LRHA 2VHCA 2JH8A 2PD3A 3IR5A 2QQGA 3OFVA 2VSFA 3CB4A 3HGQA 4HFRA 2VQDA 5HIMA 3HYLA 2H63A 1AQUA 2WJ4A 3TZ6A 1FXSA 3JQ7B 3W8EA 1Z7BA 2VZ0A 3HRKA 4OQXA 4BQFA 1A9ZA 2VPZA 2G9UA 1WHTA 1P5ZB 1QP8A 1AUVA 4NR0A 1J09A 2J9YB 9LDTA 2R00A 3W2TA 3QELB 3WRYC 5FTJA 1XQ1A 4R9UC 4RQBA 1AH2A 1ONNA 3IXLA 4I50B 3HKBA 1QP4A 4M8KA 1YRBA 3B48A 3BN3A 3DMPA 3IFSA 3M4JA 1AZSC 2FZWA 2HHCA 1KYYA 2FFRA 3N07A 4FOPA 4E08A 1B23P 2AW3A 4FONA 3ETDA 3L8YA 4PVVA 1OTYA 1PDOA 1WKBA 2EW2A 1WA5A 2BP7B 5F52A 2AOTB 2I80A 4POAA 1UT5A 2PFKA 1G5QA 1WXDA 3DTVA 4E8ZA 2A1TR 3NG1A 3P7MA 3T3GA 2B99A 2ABSA 3PNSA 1E7MA 1K5HA 2FHSA 2W71A 1H4QA 2OK8A 2ZKLA 1O8BA 3QLUC 2C2BA 1Y5NA 5HIJA 1IEVA 1QGDA 4KI7A 3S28A 3P96A 1J0DA 2CLFB 3NIDB 1FC0A 2BM0A 4YRTA 1L5KA 1E6EA 3T06B 4YLYA 1PEAA 3CSDA 4MDEA 1R00A 2RG1A 1GTL1 4HDSA 1R5OA 2A5FA 2H00A 2RK6A 2V3WA 4I55A 3D5QA 2MOKA 3H9EO 1B8NA 3AI1A 3KQLA 3KAKA 5D7NA 4QOJA 4OG2A 4ESOA 1YAJA 2CCGA 1YSCA 3OQHA 5B1YA 4A36A 1VJGA 1A1SA 1CY8A 3CF4G 4KR0A 1RU3A 1P5JA 3HCOA 5EE3A 3LLUA 5ALHA 5CT9A 3OX1A 1WCV1 3HA2A 2JG1A 2HCBA 1UQTA 2A4KA 2IIBA 2Q2VA 4QSHA 1KS9A 5IBCA 2VI5A 1WCYA 3OQBA 5F5NA 4E2FA 2G3YA 1M6WA 1XFDA 5HPYB 1SVUA 2GX6A 1XPOA 5A71A 1RRKA 3ENKA 2J6IA 4LECA 4BJ5A 3BORA 2X76A 2XH8A 3DE5X 3SSAA 4DSOA 1B4DA 3C7CB 1NG9A 2PZMA 4EKIA 3CZ5A 4PICA 4YC7A 1V37A 2PY6A 3QPUA 1U9YA 4ZV7A 1G6OA 5FA8A 5IK2D 4PSCA 1W581 2B92A 2H4ZA 2BBOA 3M6LA 3EZ9A 2RHCA 4Q4AB 4RBNA 4CFSA 3KKOA 2IH2A 1UZLA 1AS0A 1EB9A 4K40A 4YB8A 3P26A 4AX8A 2D2FA 3LMKA 1NJ8A 2PX4A 2PUGA 2CJXA 4HRAA 2I55A 3L1IA 4OXQA 4AB1A 1U7TA 1HE4A 1RBZA 2IUEA 4NNJA 2HI0A 2HJ9A 3VUFA 1ZWKA 4Q4HA 3F9RA 1YKFA 4EHKA 3LFUA 3R40A 4OM8A 1NF8A 3D4BA 1EAYA 4BVEA 2IZZA 2R8RA 2R8YA 4DR7B 1GVHA 5JCJA 2XZTA 4BFLA 3HRHA 1R2QA 2I1LA 9ABPA 1G1MA 3LYHA 5CM5A 1JKXA 1KH1A 4DLSA 3SBEA 2ZZMA 1F4LA 5FWYA 1CR2A 3CLHA 4Q82A 5E4TA 1TJ5A 4N3AA 4HB3A 4P7JA 3TMYA 5B6JA 3DE1X 3PKJA 2IF0A 1T29A 3COSA 3ZD8A 4RLQA 3D7NA 1G8AA 3T4UA 1SCKA 3ZCXA 3ZD9A 2I1WA 4BWFB 5IP5A 2JKVA 1K4KA 1C1YA 2DOKA 4BNGA 1N6OA 2BMJA 1FU4A 3VDXA 4MXDA 4B6SA 3ORYA 4L2IA 1NIJA 1NPDA 2ONZA 4C7KA 5HOEA 4MS4A 3T12A 2LIVA 3UFXA 3NEJA 4R9NA 5FQOA 1TU4A 2BWJA 5G3ZA 5IKEA 5LQUA 1PP4A 5J2UA 1J6UA 1MO2A 1E1MA 2B9EA 3GA5A 3O90A 4IJWA 5C52B 3O21A 1F51E 5BNIA 3JQFA 2C3PA 3O38A 4MAAA 5AUPB 4PHGA 2BBTA 3IDQA 2NO0A 4CGYA 1P6QA 3F9CA 2B8JA 1NPYA 4XCXA 1KU0A 2JFUA 4EJ2A 5JNWA 3J7TA 1OAKA 4QPDA 3U3KA 2B3DA 4OB6A 3PUIA 4G63A 2Y05A 4DR3B 4G81A 3S4YA 5IT5A 5IJ9B 3G9TA 2VXCA 3DVAA 3QF7A 4V03A 3PX3A 3CW8X 4W5OA 4OXNA 5HE9A 4X24A 1U0JA 1Z13A 3H9QA 1EQAA 3LLCA 1ZW6A 4QT0A 1DEXA 3UTDA 5IKPA 4CVLA 2QBYB 3AO0B 5EG5A 3HYSA 3NIBA 4MP3A 2LGJA 1QFXA 4PG7A 1B8UA 1HL7A 2R97A 2XMZA 1J97A 4RAOA 3VPCA 4BZZA 1JB1A 3FJYA 4QECA 3BFJA 2ZKIA 4MKZA 1YDEA 3UWDA 4GPAA 1ZM3A 2RJNA 5KSPA 3VPHA 3HA7A 4ZIYA 4X95A 1Z7WA 2QZJA 3GGSA 1SA0A 1LZLA 3I2YX 1T8PA 2OLJA 3BTVA 3JQ8A 4ZALA 1YL5A 5A4IS 1GNSA 1QZTA 4GLJA 2ZRJA 4ZC1A 1E3SA 2A1IA 4MUYA 5HGXA 4LJ6A 4PIVA 2AOUA 4G1MB 2BJWA 4AJ9A 1JLSA 3CN9A 2VK2A 2VJPA 3F8TA 5E8JA 3TNFA 2P9FA 3G85A 3UQEA 2QR3A 5I8WA 3QXGA 4PGFA 1ZQ9A 3RVMA 1VTKA 4RVUA 2A9VA 1CZNA 1FUIA 2GPYA 1HF3A 1OBVA 3A4VA 2DDOA 2A9FA 5K4HA 4U02A 5KYWB 3L7NA 4RV4A 4TPKA 2E0IA 3T7DA 3W77A 2YN2A 3D4NA 2XWPA 3FSEA 1SC3A 4R2WA 1ZRMA 3PQ6A 1CRQA 2OMEA 3MN1A 5KI6A 4OPMA 3U7GA 4G8CA 5BNWA 3GW8A 4GBMA 2W48A 3GNSA 3TLCA 5IT0A 3M0EA 3BWBA 4G4IA 4OCZA 5D5PA 1OGJA 4XLLA 4N01A 2IVFA 3M49A 3TLYA 3ZW8A 1OLSA 1ZMBA 2FRDA 2YXDA 4FPXA 1XMQB 3OPXA 2W58A 3FHYA 2QL6A 4PX9A 4GZLA 2JJ1A 2DBVO 5ULLA 5KVVA 4C2UA 2DMRA 4Q4CA 3T9EA 5JSHA 1GNQA 3ADKA 1QAMA 3CNLA 3EGEA 3FFXA 3NALA 3QX8A 4HSGA 3V97A 3CCFA 2J7PD 1G98A 5C81A 5JI2E 3VDNB 5CGEA 1R12A 3ODPA 5IJ0A 5A4JA 1ORIA 3L05A 3GU3A 2PQ2A 1Z22A 4P4NA 1WG8A 2DY0A 2RAVA 3DMGA 1IEWA 1KJQA 1L6RA 2E4VA 521PA 3EYAA 4LK3A 5T6BA 1PZHA 3DHVA 3V8EA 2EKPA 1WVMA 1PU2A 2PL3A 5JMTA 1KVQA 2JARA 1QF9A 1CS0B 2BH9A 5HJ5A 4OHKA 2OR3A 3KB2A 1C4WA 3CPEA 4IJ6A 4JLJA 2XEXA 1C7EA 5JAMA 1DE0A 3MQ2A 3M81A 4HBZA 4D9MA 3JYOA 6NULA 4XVCA 3MRTA 3ONEA 4U2DA 5KX5B 3DE4X 4UHJA 4BX0A 3P0EA 3E8XA 1IHYA 2JFZA 4R2IA 3B9QA 3TXXA 2OCKA 1XVAA 1NU6A 1O5IA 1B3RA 4Q00A 3D3WA 4LY3A 3GVHA 4H2DA 5TIIA 4RTMA 4UMDA 1ODTC 2O59A 4K0RA 2AWOA 3UV7A 1N6KA 3FYDA 3PQ8A 5E9AA 3I9FA 2V54A 4RMHA 4O8ZA 3VC2A 1PT5A 1XLVA 1GEEA 1RABA 1ZRSA 2TYSB 2PUDA 1CLUA 1G5HA 2V7GA 4O2AF 1SNYA 5E1DA 2QQ0A 1ISFA 1Z47A 4MUEA 3ORHA 5F21A 2AM2A 1WPRA 3L6UA 4TV8A 2R87A 5DHTA 4PX2A 1Z4LA 2I4RA 1YB2A 2VP9A 1IHDA 5J4KA 1I7QB 2ZSHA 3N8IA 2XUGA 3FJOA 3FTQA 2A9OA 1GPKA 1THGA 4REQB 3WIBA 3W04A 5K01A 1KEPA 1E4EB 3HKDA 3UVEA 2XWBF 4ZPJA 3Q8XB 4ZVTA 2NU7B 3GUCA 3ULKA 1WUIS 3L0SA 3OBIA 1A2BA 1QPGA 1FYWA 2MSNA 2PGXA 2XR1A 4YT2A 1TTHA 2RK4A 3I6ZA 4M49A 2PGAA 4G0ZA 5GJBA 1ZZEA 4JZKA 5HF5A 1OV4A 1GO2A 3A6DA 2AR9A 1OFTA 4RABA 3H9BA 3I8OA 2ZI9A 5IEBA 3LUJA 1PK8A 2ON6A 3EA4A 1M2VA 1CTQA 1XR3A 1XZ8A 1TLLA 4N41A 1ECPA 1IXYA 4BE4A 3ZHBA 1KFEB 3PDUA 1E79D 3RGWS 4LHVA 4KMSA 1YVDA 2HTFA 2NTYC 5FWXB 1DJNA 2M32A 4NV3A 2EQAA 3COZA 1BX3A 4PM4A 5K6TA 1YAHA 1BYUA 3EIUA 2LV8A 3RASA 1RJ9A 2IEAA 4PV7A 5D3QA 2C9ZA 5JSYA 1ZDMA 1CY4A 4AMUA 3HR8A 1V5FA 2ZAMA 3QWFA 4MWGA 3QVWA 4CEHA 3NIGB 1ZIPA 3WNCA 3IIIA 3CCBA 3PX7A 4NOJA 3EGCA 1HYBA 2QX4A 4JQSA 3UW1A 5JWOA 3K70B 2XBMA 4B3SB 1Y82A 1U1FA 1GL7A 1JZTA 3HY6A 5TQIA 1SQ5A 4R98A 1QDLB 3ICVA 2I8LA 4NYJR 2NTNA 3L2OB 5I7AA 1X8XA 4XGRA 1RQPA 5DWVA 3PP8A 1O4VA 4JI7B 3KDPA 2ET6A 2O05A 3T8YA 3HBAA 3LHDA 3QITA 3B1NA 1NQOA 2VDMB 5TF0A 3BK7A 3GQBB 3GEIA 4LCJA 4UUQA 5DCUA 5FR2A 3K9BA 1O5ZA 1M67A 4KE7A 4FZVA 5DM2A 3EEFA 5I9SA 3C1OA 3G2OA 3OM8A 1QCZA 2E3JA 4IH9A 3TQIA 4CEJA 1SC1A 1SHUX 2VQSA 3OOHA 3GMTA 3ZV7A 1ZU4A 1FQKA 4RYLA 3PKIA 3LOQA 2QIOA 4FYYA 2E4ZA 4EQ6A 4EYQA 4CLOA 1GCOA 3TD6A 3DF9A 2CV0A 2A0WA 1DDIA 4K81B 4MUJA 4PPNA 3C3PA 4QO8A 4PYJA 1HFEL 2DKNA 4NESA 2Q4TA 4TWAA 2XSZD 5BSTA 4X1YB 4DY4A 3H0EA 2OCGA 3VV2A 4Q7QA 4WBNB 4UU1A 3RM3A 2GWHA 1CD5A 2QYSA 5GJVC 1PZGA 3HSSA 3DS8A 2ZS7A 1B41A 2NVUA 4JGIA 4Q4JA 4TXLA 2R1TB 5FFNA 5LA6B 1VE9A 5JISA 3GCDA 1CJSA 4U6NA 4FN4A 2QM7A 1NFQA 2I4TA 4IIBA 1YS6A 1E7WA 1P1IA 1UBRS 1PL6A 2MYNA 4MVWA 1KBQA 2C96A 1CFZA 4Q1CA 4QVKA 5COJA 4HTFB 3RJ9A 2CHGA 2IXGA 3ETJA 2Z4RA 4BOYA 3DSRA 4MINA 4O4LF 2HJRA 4G4SP 5A02A 1HQCA 1X2EA 1PNOA 3FDFA 3NHWA 1N0HA 4EFKA 2F62A 4WXPA 1NMXA 1A9RA 1R4MB 4DDTA 1KDTA 5ALXA 3UAGA 4CZ2A 1V7PC 4I1SA 4FUTA 1ADJA 4YRJA 4ZIRB 3IMGA 1PIWA 1QHYA 2VJMB 1VE6A 3LKVA 5EKDA 4NU0A 3AI7A 4X41A 1S0UA 2VYND 3DR5A 4F4JA 1NM5A 1V1AA 5H3HA 2ADMA 1BE6A 1JDTA 4IHKA 3WLTA 1C7ZA 1O2DA 3BGWA 4QELA 5SYAA 2QQEA 3AKZA 1ZH8A 2W11A 4RIHA 1I1QB 2FP3A 3H7AA 4H3SA 4TTJA 1N1DA 2AXEA 4TYQA 4AZVA 1VZ3A 1EHIA 1TO2E 2ID9A 2JHPA 2L18A 1E0DA 2QMUA 3PUXA 5G0WA 1R66A 1RAFA 3A04A 3OM1A 3PHCA 4WZBA 3TCNA 2QZ9A 4CM9A 1QYIA 3ETHA 3FN4A 1X15A 3ABZA 3RRBA 5C3YA 2Q5LA 2QJRA 1ORVA 1T9GR 2I7VA 1CU1A 2JJYA 1OLUB 4M8LA 1AM4D 3SR3A 4BNYA 1TYCA 4XR4A 3DHEA 2B30A 4Y7CA 4DCNA 3F7NA 4RIFA 1PJ3A 1GZUA 4GNRA 2VT7A 2VRWA 5B58C 1Y8QA 1YZKA 2O2DA 5AWFC 1U2TA 4R3NA 3WNVA 3BE4A 3C1AA 1DG9A 4PAOA 3ZE8A 4YRBA 4PXSA 1FQJA 5GP1A 2ZYTX 1A8QA 3NUGA 4EH1A 2GHRA 3TZKA 3IEXA 3AR7A 3UPTA 1MNAA 1KARA 1SQGA 3IIMA 3PNKA 3N0XA 4KXVA 2P4EA 1OROA 2FCAA 3HCFA 1MR3F 4RVDA 5EKXA 2VHQA 4NYMQ 3RSZA 3KX2A 1U5AA 3EUWA 3NHKA 3RQ5A 3M6FA 3CKKA 3D6VA 2PKMA 2PO5A 4DQDA 4ZU3A 1M83A 4MO9A 1KRXA 2NSYA 4DA0A 2O52A 1U7OA 3WNZA 1GPNA 1GXSB 1XZHA 2DU8A 1QONA 3QVTA 1GZVA 2VWGA 5DJ5A 5ALJA 1Z88A 2QZZA 4IVNA 2OV2A 4XXHA 4JV5B 3ZTTA 3A6EA 3NXSA 3ZJVA 2XUQA 3I05A 1C8KA 1XN4A 1QGUA 1ZMRA 2FQQA 4J94A 3QF4A 3WIVA 5IJWA 3UIEA 4K7JA 3WZMA 2Z3ZA 4PVDA 1JMYA 2PH5A 5AHKA 2YIVX 3CRRA 5EXXA 5JH7F 3VMFA 2BHTA 1K8ZB 1IZ9A 2ZRIA 3JRXA 3WWOA 4K9OA 4B33A 3K7EA 3IVCA 3RHZA 5KYVA 1Y9ZA 3E2MA 4MVJF 1MRNA 4KHPB 4KNWA 2ILTA 3OX3A 1K2VN 1L5QA 3JZFA 2JG5A 4ER6A 1TUGA 5FIUA 4WN9A 3WOHA 3H5AA 5B1HA 3PEWA 2O0JA 3L1JA 5B7NA 2AT1A 1GD1O 3A9RA 4JKOA 5JV5A 3UMPA 4RUKA 1R50A 3UT5A 5F1OA 3BMNA 3L6OO 3OZSA 4Q9NA 1FSGA 421PA 1NP3A 1OXUA 3Q3IA 2OOSA 4L75A 1RACA 1QHEA 4YIKA 3TE7A 1T4GA 4UVGA 1UFOA 2F43B 4LOIA 2XZLA 2DUMA 5IJZA 1UQRA 2CDBA 2YJ6A 1H2XA 3OEHD 4A2CA 3LUCA 2AQ8A 2AW5A 5AUOB 2AEJA 1EJ0A 4CGZA 1E63A 3R2JA 2QSJA 1PR5A 4MICA 4XGKA 4OHXA 3G7NA 5HS6A 4RV5A 2RGNA 3DOOA 4QYIA 1AN0A 2O57A 2IHNA 4CN8A 1G7SA 4LG1A 1CJCA 2WM8A 4YWHA 3KYCA 3TX6A 3IC5A 1M2JA 1Z5UA 3ZXXA 4FKMA 1IBRA 3CEAA 4B84A 4EECA 1TVKA 4E1VA 1AQNA 3UQDA 1Z74A 2BRUC 5EQTA 2A9YA 5LM3A 3I9MA 3M1IA 4NCHA 1TJ3A 3ZIAA 3G68A 2OP0A 1JH9A 4OD0A 2NACA 2BKUA 1JQEA 4GL4A 1QHSA 2P4UA 3IRVA 4QYWA 4A8JC 3OESA 4Z3KA 2P5SA 3TSZA 4J0KA 4DG9A 2OD9A 2QROA 1JF8A 2JRLA 3WL6A 5LZ8A 3X1KA 2AFHA 2E5FA 2IF2A 3HK2A 3Q8WA 2CFRA 3OIVA 2WMOB 2ZI5A 5E1MA 1UXKA 4GKVA 4NV0A 3R7FA 4ZYLA 1JSLA 1MP0A 3SEAA 2AZXA 1Q77A 2AN5A 4XCQA 1PJZA 4F93B 4M86A 3BZBA 1T24A 3T15A 1XYVA 2ZIXB 1GZ5A 3OE7D 4FCTA 3BIOA 3LBAA 4U5QA 4U7WA 1KRHA 5LJIA 3SPXA 3VR5D 1NRXA 4HQOA 3W9YA 3ZWWA 1WIWA 5FO0A 2Q8NA 3GAMA 2ZTHA 4AZWA 4BFYA 3E18A 4I9HA 2C59A 2ERXA 4M7PA 7YASA 3GOHA 4O4HF 2UYGA 5IAJA 3KXPA 4QJBA 4TZTA 4TRRA 4P0QB 5KTYA 5HHTA 1FSFA 4UUAA 3R7LA 1IXZA 2V7EA 4RA9A 3G2MA 2H1VA 2QJTA 4D3SA 3VHLB 4KRFA 3C5WP 3L5OA 1A9QA 1SUEA 2VYQA 1JLLB 3IUEA 3PVSA 4IUDS 1BZYA 4XDYA 3RIMA 1U81A 4LZWA 1AF7A 1D03A 1P0IA 1JQLB 3ANMA 4R1OA 3FOWA 4FYKA 4IKPA 1EM6A 5A6SB 5HUQA 5I7SA 1Y7LA 1Z4JA 1SUIA 3INTA 5F73A 1W9HA 1MGOA 1ZCBA 3P9SA 3JARA 4C06A 3D4IA 3PNBA 1U8AA 3BXFA 4H0FA 4QUEA 4XWKA 4KREA 2Q2WA 3UK2A 1QRDA 1FJ2A 1O57A 2DFTA 4ARZA 1ZONA 1FNCA 4L8WB 1S9DA 4V02A 4EMUA 1Z75A 4UQOA 4DQKA 4FIDA 3KB1A 1TW3A 3DXFA 4D9HA 4WERA 1PL7A 4P4LA 4O3MA 1Q7BA 1X94A 1MOQA 1ELOA 2BM1A 2Y9MB 5BQFA 3SLKA 1YR6A 4E7OA 5LYJB 4BKOA 3WQQA 3K6SB 3PGVA 3TAXA 3UKOA 2MMCA 2BFEB 1WUTA 1ZP6A 3VAYA 3UB2A 2B1GA 3QKSB 4NCKA 4FUQA 4MS1A 3H9UA 1NULA 4Q9LA 3RBVA 4C7VA 2FUG1 2QAIA 4I4NA 1SOVA 3H1BA 1FNNA 5EMLA 5T41A 2E87A 1CNFA 2X40A 3ANYB 1U4OA 2H48A 1H5NA 2VTKA 2MMGA 4N6OA 4OMUA 4KUHA 1AC5A 1RJDA 2AJDA 2W0MA 2IYPA 3EIXA 3FKSD 1GPAA 3AX6A 4HATA 4N49A 4C20A 3U4QB 1AX9A 4ZCRA 5KJ6A 4UFPA 1FRNA 3QUBA 2OORA 4HAZA 2ZBDA 4G1CA 4WJKB 3CX3A 1TK3A 3TJZA 1KHTA 4O1GA 4IGAA 4RKRA 4V0NA 4CETA 1CJVC 3HNRA 4NAVA 5HFAA 2DTXA 1G4AE 1QWSA 1TFUA 1UXOA 1ZPDA 1UT8A 1IG0A 4II3A 5G4KB 4Q15A 3A4IA 1RRFA 2V3CC 5LNK1 1KEEA 5L7TA 4LJAA 2OQVA 5JQWA 5FBHA 4F2WA 4EN4A 1LB1B 5TMBA 3QOFA 4BL5A 5IPFA 5KQGA 4NG5A 4UM9D 5JDIA 2EC5A 4ERNA 4KQCA 1KMNA 16PKA 1L1QA 1HLDA 1V47A 2PD4A 1U5BA 2VTVA 4CTKA 2YWHA 5J3JA 3BAFA 1YOBA 1GC5A 1MCZA 2IWHA 1L7VC 1FFGA 3K31A 1PAUA 1ODJA 2GD2A 5CLIA 5TT1A 1Z28A 2UUPA 4G56A 1L5HA 4BZWA 2DWPA 2VZEA 3X1WA 4MYHA 4P93A 5DU2A 5BYJA 2ZPAA 4G2NA 4X20B 1F7UA 1XHFA 3T7JA 5CVCA 5LXTA 2NUTB 4AKHA 2AJPA 2HIAA 2ZT7A 3HBNA 2Y1EA 4QICA 2L0XA 2WYUA 4JP3A 4MQ4A 1LIJA 3UMYA 4PS1A 1LF0A 4PHHA 5HCUA 2YBDA 5EJGA 2GILA 1FYVA 4OLBA 3KSDO 4OHFA 1CUCA 4ENUA 2Z8YM 2D5IA 4ZOAA 2X42A 1ACLA 4P1ZA 3N2IA 2BFNA 4DXHA 4KQ1A 3WGOA 5J58A 4D4LA 5KPJA 4R1MA 3NAGA 4FZRA 4WUTA 5E9WA 1DLIA 3U49A 1ZD5A 3VTAA 1JFFB 3GJ3A 3KQKA 3IALA 2QLFA 1JR2A 5ITVA 3P9KA 1YJ8A 1XTSA 4OJMX 5HMMA 2NADA 4Q3AA 3RWBA 1KMCA 2G1AA 4I0WB 4K9NA 4AUEA 4GYJA 5GONB 2DB3A 2UZ1B 5AJUA 4OF4A 3L41A 1PO7A 1E0JA 3CF2A 2P69A 1F0YA 3JWGA 1P3DA 3C6ZA 1JFTA 1G8SA 3HUTA 2OCXA 1QC5B 3RRNA 4IDGA 2JFYA 2ODTX 4I3GA 1U3TA 1W85A 4OGWA 2IQ5A 3IQ0A 1A4UA 3L40A 3RHSA 1L9XA 1N5LA 4JASB 1B73A 5KWEA 3HZHA 3KEFA 5J2TB 1RFUA 1FMJA 3I8XA 2BFBB 2VIIA 1EFRA 1P91A 2WU8A 3A2MA 2E1RA 1OFHA 1VJCA 4GZ6A 3ZR4B 4AZ3A 2ZYDA 3HCAA 3DYIA 5ALGA 3WK7A 3K0CC 2RHGB 5J5AA 3OMXA 1QO9A 2XDWA 1ZEJA 4TSKA 3WISA 4RGQA 3ZWKA 2B25A 4EUEA 3R3XA 2IBTA 4C4AA 2A9ZA 4F46A 5IVHA 3IOBA 1X7ZA 1G21B 3P4UA 3QMVA 1TZJA 2BHLA 4OMDA 5CW2A 5DH9A 1UINA 4KI0A 2GXSA 1SB9A 1RM3A 2L2QA 4N4AA 2XQFA 2IV2X 1XZGA 4Z7QB 1ZVJA 2VYVD 2VPXA 3B60A 4IDCA 2AMYA