3RU3A

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadph and atp.
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 179
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3ru3A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3ru3A02
1BX4A 1EKKA 2V78A 1UA4A 3K9EA 3RQ2A 3RNOA 1LHPA 3KZHA 2R3BA 3KTNA 1V1AA 4N09A 3RSGA 3UMOA 2C4EA 3ZS7A 3UQ6A 3N1CA 3KD6A 1LHRA 3DZVA 3H49A 4O1LA 1TZ3A 3KEUA 5BYFA 1VK4A 4DU5A 4KALA 3RPZA 4E8YA 2A9ZA 1ESJA 4K8CA 5CM5A 3D3JA 3RQ6A 5TQIA 3RREA 2ABQA 2JG1A 2FV7A 2I6AA 2AFBA 3RSSA 3MBJA 3B1PA 3FHYA 4KBEA 3RQXA 3B1QA 5CGAA 1JXHA 3OTXA 3IN1A 4LCAA 3NM1A 3UBOA 2XTBA 4C5MA 3NCAA 1GC5A 4E8WA 5F0ZA 2JGVA 3RTCA 3UQ9A 2QHPA 1TZ6A 4LBXA 4N08A 3ROEA 5C40A 3HICA 1VI9A 2DCNA 3HPDA 1LIKA 3NL2A 2I5BA 4S1MA 3PZSA 3RRJA 3NC2A 2DG2A 3VASA 4PVVA 2DDOA 2A9YA 3B1RA 2AX3A 3NBVA 3HYOA 2AJPA 1RKSA 4YWRA 2AB8A 3LHXA 3IH0A 3RTDA 5BYEA 2DDMA 3EWMA 1YGJA 3RQ8A 1JZTA 1WYEA 4KADA 4LBGA 3FHXA 4EBUA 2HQQA 3B1OA 3RQQA 3RQ5A 4E8ZA 3RU2A 1KYHA 3RTEA 1JXIA 4O1GA 4XF6A 1GQTA 3RS9A 3RSFA 3Q92A 4XF7A 3UMPA 4YL5A 3UQDA 4K8PA 2F7KA 1C3QA 3GO6A 2AWDA 3NL6A 3NL3A 4E84A 3CQDA 5B6AA 3JULA 2R3EA 3QA2A 4JKUA 1RFVA 4UBEA 2PKMA 3RU3A 2QCVA 3RRBA 3LJSA 4S1IB 4C5KA 1DGMA 3RTGA 1TYYA 3IE7A 1RKDA 1U2XA 4XDAA 2PKNA 4C5LA 5CGEA 1V1BA 2RBCA 4LC4A 4DC3A 1LIOA 3ROZA 4GM6A 5COJA 5BYDA 5TRWA 4XCKA 4K93A 3VAQA 2PKFA 3I3YA 4E3AA 1RFTA 4EN4A 1V19A 4B8RA 4U7XA 4K8KA 4JJPA 3IQ0A 3K5WA 1RK2A 3MBHA 2ABSA 1TD2A 4C5NA 3LOOA 1ESQA 1RFUA 3RRFA 3UQEA 2HLZA 1RKAA 5BYCA 4EOHA 3RT9A 1VM7A 3RM5A 2AJRA 3RS8A 3GBUA 3RY7A 4EUMA 2I6BA 2Q5RA 3LKIA 3B1NA 4K9CA 4X8FA 2HW1A 3BF5A 5C3YA 3RT7A 4B8SA 1LIIA 3RSQA 1YHJA 2O8NA 3RO7A 3IBQA 4JKSA 5EY7A 3W4SA 5F11A 3PL2A 3QAIA 3ROGA 2JG5A 3IKHA 3NC9A 3RO4A 2YXTA 2DDWA 2VARA 1V1SA 2F02A 3RTAA 2YXUA 3NM3A 2C49A 4K8TA 3NL5A 3NBWA 3GO7A 3RQHA 1YGKA 3H74A 3D3KA 4KANA 4C5JA 4WJMA 2PKKA 1LIJA 4KAHA 5C41A 4E69A 3RPHA 3DRWA 3Q1YA 2NWHA 3RTBA 4S1HA 5EYNA 2AA0A 1UB0A 4S1IA 3B3LA 3BGKA 4K9IA 5C3ZA 1EKQA 3ROXA 1L2LA
chains in the Genus database with same CATH superfamily
3FPEA 2XNKA 4MRSA 1X86B 2PMBA 4H7HA 5HTOA 2XCOA 2GTPA 4D6XA 1V45E 1U4OA 5KTRA 4D3YA 5KPDA 3JXEA 3HHEA 1K8RA 3GB9A 4IJQA 1GGHA 4GFDA 5CM8B 1WUHS 3TZLA 5D84A 5ERGB 4Y6LA 3CXUA 3TZ6A 2JH9A 3OG9A 4Y6GB 4TS3A 3OY2A 3EMBA 1SXJA 1Q20A 4Q7QA 1IG0A 2XTAA 5HKLA 5K8VA 2WSYB 1ESJA 4BB9A 5FP0A 1A7AA 2OUIA 4OUDA 4KQ6A 2KX7A 5I5GA 3KSAC 2P79A 2ERXA 3DBOB 4Q9HA 2PY6A 1Q2UA 1Y7TA 1KOLA 3U3XA 3ZDZB 4CQMD 4JI7B 5JJIA 4CFZA 1XKXA 3GLGE 5CR9A 1N6LA 4MS3B 2ORYA 4OF4A 4ZIRB 3C3DA 4UDNA 1SD5A 5BR1A 4JT9A 2IZ6A 2PWAA 3HPRA 4CBVA 2DKNA 4G0OA 1EXNA 2B1RA 4U00A 4BLWA 2E7ZA 1OA1A 2GN8A 1HM5A 3F4KA 4OHZA 3ROEA 4AUKA 2HK6A 3A9WA 1BCSA 3AHHA 1JQBA 4D2IA 2HIAA 1XFAA 2BW0A 3GOHA 2QA5A 4FKZA 1E7WA 1Z4IA 2H07A 2VHWA 1P0MA 4KBYA 5TMEA 3TI7A 4O4IB 2BH2A 2QRUA 1KKUA 2W6QA 4M7OA 4XLTA 2AQHA 2XDYA 4BQRA 1GZ4A 5JSZB 5E8JA 4D3XA 5DI3B 1FRZA 3QXCA 1FJXA 1MO3A 3M4JA 3KETA 1E8DA 1Z45A 4GL2A 3LUGA 3L8MA 4L3WA 1NNSA 5SZIA 1XI2A 3TSAA 1YVEI 3HSKA 1WULS 1DJOA 1OREA 1IBMB 3OKCA 1NI3A 3U1BA 2YQ4A 4KR2A 2VCHA 5L3SA 3FCEA 5K6AA 1T36B 1C4WA 2O0MA 4G81A 2WYHA 1T43A 3ZGLA 3TUZC 4R98A 4Z49A 1T3TA 3K92A 3MJVA 4FZVA 1YF3A 3HJ6A 1OLXB 1OF1A 1Z6AA 2PX8A 2EFEB 4M7PA 5E2BA 2Q1WA 1U28A 2A35A 2HIGA 3V3KA 3NW9A 4GOND 5H8WA 5B6AA 1IH8A 3T0FA 3DKPA 2JI8A 3ZNPA 4G5OA 1LVHA 2ZBVA 1E1MA 1FU7A 1ST2A 4UTZA 3Q7SA 4IXTA 2H29A 4HXFB 4DRXA 3KOXA 3TMKA 4JLOA 3GZNB 4JQCA 4UEOA 2PGLA 2X7XA 3BMQA 5AXAA 2IITA 2F3SA 4HN9A 1OAKA 1V9SA 3OJCA 1USVA 1TOAA 1OQAA 1XEFA 4P80A 5C46F 2C4KA 1I7PA 1WHTA 2C7GA 4XFDA 3FZGA 1F20A 3LUFA 3K0EA 3SX4A 3DB2A 2YVAA 2JZOA 3JYLA 2W9XA 4E03A 5K8UA 1TT7A 2KBEA 4FGJA 4YIHA 4RKEA 3AYXB 3T9FA 3TSYA 3DZBA 4UBKA 1CU1A 2F8LA 3QBEA 4YJ3F 2VHUA 3GJQA 2IW3A 3QHPA 5D3KA 3WO0A 3S7TA 3GT3A 3NEJA 4TLDA 4OQMA 4EB3A 2O6LA 5KNBD 3PKIA 5H7XA 2WK1A 1J0AA 3OZSA 4P4TA 2J9FA 2O3QA 2QRZA 5AVSA 1YI8A 1DIBA 3PHGA 5DT2A 2DT8A 1NXWA 3I5MA 4PNEA 3OWXA 4KANA 4OK6A 1RMYA 5AIAA 4OCZA 5E1OA 4J2OA 2HFJA 4HD8A 2JFNA 3L7NA 3A6HA 3UT0A 4HBZA 1U80A 4J0JA 3OQNA 1H2EA 3ROXA 4FOSA 3S81A 2CDNA 5K0SA 1KQNA 1EFVB 2ZWMA 4B4KA 4E88A 3JATA 1UOPA 3BBLA 1TUBA 1SHJA 5EHQA 3Q8MA 3RABA 3PTAA 3U9LA 3W8RA 2YHSA 1GQFA 4L5CA 2FPPA 3QF4A 1E2UA 1H22A 1VKJA 4QPCA 5MF6A 4NOLA 2BDUA 2IK8A 2QX9A 3ZWQA 1MA3A 3KSMA 4M49A 3DE0X 3DM9B 4ZV4A 1LLFA 3CIOA 5GVSA 3JYNA 3A6LA 2A14A 4JAVC 2ZUBA 3WK7A 2WYWA 3THXA 1P77A 3G88A 5CCEA 4IXWA 4KPUB 5F73A 2FDRA 2FZLA 1FVXA 2G08A 3DKVA 4REOA 1KI7A 3TRIA 1N2SA 1N9GA 4NULA 1N3LA 3T7JA 4ZDJA 2P1RA 2XECA 4JC5A 4BPRA 3NT2A 1T2DA 3NI2A 1F48A 4LRQA 1U2SA 3HPDA 1CR0A 3EXHA 1LIKA 3VUFA 2ZQ5A 1ZMOA 1L5HA 1M2EA 2GZHA 3IB6A 4DV3B 4PRYA 1D9ZA 3WB0A 1NFRA 1VL1A 2DDOA 4BMDA 4ECAA 3DHYA 3DSRA 2BSXA 2HD4A 3B52X 3QUSA 2ROQA 3DO6A 4ACBA 3IO5A 4ETWA 4LBGA 3LT1A 1HSOA 4UUBA 1XLTA 1UBOS 3NHRA 1ZZEA 2OZLB 4UKDA 3CF4A 1T25A 1RI1A 4EB6A 1PYGA 3VAYA 4LF7B 2IHZA 5I8ZA 4MJ3A 2C42A 4CV0A 4DDWA 1GUAA 1WMFA 2IDJA 1ACLA 2GBLA 1UQTA 4LOJA 5TXGA 4WNAA 4HRYA 1W8IA 2VJLA 2Y2VA 5EP3A 5H83A 2Q2OA 5H3CA 2CY0A 3ZWAA 4DBZA 4Y18A 5AVXA 4PZ0A 4Z4EA 3NL6A 4DQKA 5AJZA 4OK3A 3GQBB 1YMUA 4Q21A 1RAEA 4J2TA 5AKXA 3RBVA 3NMUF 3BB1A 3EHDA 3PTZA 3SZLA 4L4SA 3IIIA 1E98A 4YCDA 2EKZA 2QCVA 3V4PB 1HZJA 4LDNA 4ZCPA 5K3DA 2ONJA 4W5NA 3HYNA 2V59A 3GHYA 1BQ3A 3LX8A 4B32A 4NIMA 1FLAA 4QYMA 4DCNA 2MSWA 4AP5A 2FGKA 3ZE9A 4YXWD 4K1XA 4AN0A 3L1IA 4H4EA 2X9VA 3P26A 4HZIA 4WUTA 3U48A 2A0KA 3BFXA 3KJIA 3WL5A 1EK6A 1S8FA 1UIMA 3GO4A 3M6WA 1MC8A 2OYSA 4D3ZA 4WJLA 3PHLA 2L69A 2I91A 4FYWA 4EG3A 1C9MA 5BUCA 4B6PA 1J39A 1P4AA 4WK2B 4K9CA 4LXUA 3T7RA 2JJYA 4XQ0A 4EIWA 3BF5A 3V00A 1N25A 3UAOA 1GAJA 2C3OA 2GAOA 3PFNA 3J7TA 3QVJA 1TFUA 2VBIA 1LK7A 5BOVA 1LS1A 1N3BA 2GJ4A 3N5CA 5HDQA 1EFLA 1ZPDA 4IEEA 1A9OA 1CUIA 1T2AA 4GD3Q 4IL5A 1KQFA 4I9GA 1U1IA 4GX1A 1KZHA 1K7XB 4CR7A 4DOMA 5BN1A 4P81A 4FS8A 1E3QA 1MBZA 1TMGE 2R96A 3F97A 1KVUA 5HKKD 4DIDA 1GVHA 3RSZA 3F96A 4JUBA 4M99A 4AJOA 3ZHVA 3RPHA 3UMCA 5EYNA 4K8OA 1H0RA 2AHOA 1G9TA 1I2ZA 2HQBA 4GX5A 1NMXA 3FCSB 1QKJA 3VTFA 1HG0A 4KQWA 5L7WA 3PSHA 3VNSA 2BE9A 5CUQA 1LHPA 2IU0A 2P4QA 1ZVJA 4XVUA 3MXOA 3OZTA 2E89A 1Q1BA 5FRDA 3S5UA 2OXIA 2NM0A 2APJA 3WGHA 1JT9A 4FGUA 3PHCA 3QY0A 1P5FA 4HF7A 2HREA 3COZA 1ECFA 4GPBA 4RK1A 4N3NA 1BVYF 1Z0JA 2JEOA 3E35A 1GPH1 4XGRA 3B3FA 3UJNA 2W58A 4D8UA 1RP7A 2P9FA 4M54A 4OGLA 3W34A 4DM4A 4DQDA 2X19A 2X9LA 1ZUHA 2AXQA 1QH9A 1FF9A 1QWOA 2IZ5A 1MIOA 2QZZA 1EFPA 2YYSA 1J8QA 4RABA 3KV1A 1BYUA 4RJ2A 4WE3A 2JGVA 2Y0EA 1QGUB 4K6HA 1WDMA 1XE3A 3FPGA 3H99A 3I92A 5COAA 5CIYA 3HWX1 4LKOA 2JLCA 3TH5A 2P1ZA 4UPEA 5IC6A 4W63A 4TSRA 2FEPA 2ZEJA 3SC6A 5IJAA 2PRKA 3PNBA 2QTNA 3T99A 2X5XA 2IUEA 3N0XA 3P2MA 2VUIB 2C3MA 4WJKB 3IKTA 4RZXA 4MNTA 5IAJA 3S7ZA 2QGFA 4YUXA 4Y9DA 3PCXA 5AJWA 4YV1A 2I6TA 4NVRA 1F06A 5LPNA 5BMVF 3PJDA 3BJIC 5EZQA 4RDCA 5I7UA 2FCRA 3H9QA 3KHUA 4MQ4A 1ZUD1 4GMGA 4W1SA 3W90A 2VF2A 2XOEA 4JJ6A 3IRUA 2QX8A 1DC3A 1WP4A 3DE3X 4R4JA 1K66A 4OP1A 1R12A 4YPFA 5HFNA 4Z0HO 4XUCA 4ZD6A 1Z75A 1ZRHA 4UPVA 1ZH0A 2TYSB 5JRDS 1AN9A 4KNYA 1RPTA 3C6KA 3FKSD 2F67A 1FNNA 1YZYA 4ALNA 4QFMA 3THOA 4B87A 1SEPA 5LXTA 3CR8A 1V0JA 2VAMA 4I36A 1JYFA 1JHYA 1HEUA 3MCTA 4WA7A 1G6Q1 1N34B 4Z0PA 4C0LA 5H5JA 2X0DA 2CUNA 3UMVA 3H1TA 2ZYGA 4R51A 3SDBA 4P34A 4KN9S 3T7IA 1S4QA 4GI1A 4CQNA 4P83A 1XQXA 5BWLA 4EN4A 4UUNA 4W7HA 2PKWA 3H4MA 4XUDA 1JKXA 5TJ9A 1LPOA 5LDGA 3JQAB 3AM4A 3RVBA 4RHUA 3TJMA 3QPWA 2WAXA 4C2TA 3I73A 4X84A 2QQ0A 1YQEA 2CHUA 1UZUA 1V8PA 3L7AA 3EVFA 5IDWA 1XCMA 1U2RA 2B4TO 4N82A 4EY8A 3F90A 2YXLA 4XZ3A 2F48A 1V5IA 1X9HA 3CZ4A 3M0EA 3NIBA 1E2FA 3HZZA 4JR1A 3ZTYA 3B3JA 4NMHA 2CVPA 4PQFA 5MDHA 1IYZA 1EGAA 1HY3A 4G0NA 3E9DA 3CNOA 3WWZA 1Q83A 4RGQA 3PD0A 1BXKA 4GI5A 2XMGA 2XDAA 4MW0A 4NZNA 4UFNA 5A06A 3IJEB 2I6XA 3PR1A 4FJ0A 5J23A 3I61A 1HA3A 3RFUA 4HUQA 1T8PA 2RKOA 1XD2A 2M6RA 3JQFA 4FFBB 4AQYB 5KPJA 2HMAA 1HYEA 2W2QA 1T9BA 3UMGA 4ZHQB 3LO5A 4J1QA 1J2EA 3F7NA 2GPYA 1I0IA 4EUNA 4Z2AA 3G9UA 5CFPA 1GYQA 4RE5A 5AVJA 4DCJA 1IDN1 4OQ4A 1JBEA 2C61A 3NKLA 4FP9A 5LP6A 1GR1A 1ZU5A 3H1BA 5AVWA 2FFAA 2NO4A 2C07A 3WBJA 1HDRA 1YBVA 3HP4A 3LUCA 2W8BB 1BE6A 3MCVA 4TV8B 2I2CA 2XNJA 3JQFC 3PC6A 4JI5B 1G21A 3E3NA 2AYXA 2XQKA 4C4TA 4X1IB 1NVMB 1NE2A 2FLWA 5HF9A 3SBOA 2CV2A 1I3MA 4KPFC 2I6AA 3U26A 1YR1A 2CNNA 4BQQA 3DMYA 2ZJ8A 3UUWA 3M83A 2HU5A 3KHSA 1GG8A 2XUAA 1FFEA 1RM5A 1ZCZA 4UE6A 5ALMA 1W1IA 4FW9A 3O38A 4WNIA 4CKYA 1SQSA 3K9LA 2EJVA 3V3TA 2ZFUA 1BSVA 4G4JA 4I0WB 4X8HA 1KZ6A 1IMOA 3ABQB 4L8VA 5AVOA 3T15A 1AD2A 1NF3A 4M22A 3I2IA 4XSGA 4MB6A 4YH1A 3S2FA 1G5HA 2DM6A 3NBVA 3GC6A 1FTNA 1GVNB 1X1DA 2RKWA 2J8ZA 3H9GA 4RW0A 3AEQA 3MUOA 1THMA 3VISA 3ADDA 2FZEA 5BRJA 3D54D 2PV7A 3B13B 2YV2A 4ZC1A 3T34A 4M46A 1IHOA 2PRIA 3VR3A 1U2GC 1BQ4A 4D4MA 5A2QA 2QRPA 2QOEA 3NJ4A 1DAHA 1Z0FA 4MPPA 5KKAA 3UMMA 3K71B 3DKRA 3RT1A 3C1UA 2CVZA 1LH0A 1H2RS 2XYQA 3BCSA 1NLFA 5HJEA 4CN9A 3L9XA 1E94E 1TPZA 4OI1A 1W5AA 2XRFA 2WAMA 3OFVA 1V37A 621PA 1I4TD 1XTKA 4GPEA 4NZZA 5IWAB 4KAXA 1N8NA 2H5IA 1LDGA 3EZ2A 1DKOA 3V2IA 3HKEB 4KWCA 1SC1A 1KZ1A 1VDMA 5HCIA 3FCUB 1NVUQ 3FPAA 4G86A 3V2HA 1MKYA 2JGDB 4Q4JB 2BFCA 2WPNA 3O8DA 5A5VA 3PQDA 1PWEA 4GZ3A 5AK0A 5KDLA 2FUG6 1XJQA 4TXHA 1ZGAA 2OE2A 3E3OA 3CCBA 1XLTC 3L82B 4MITA 3RK1A 2C49A 3SZRA 4NCHA 4HVCA 3KZMA 1WXXA 2J85A 1ZBDA 3HVUA 3OIYA 5AESA 1I6MA 3HRKA 3SJAA 3C15C 1QHSA 1R6XA 1U8EA 3SCZA 4JWTA 1E3IA 2GN0A 4AMGA 1NI4B 4RACA 5KYXB 1XVAA 4M53A 4BO0A 3KLMX 2I67A 4IIGA 1NVEA 2ZSAA 1QYDA 2DVMA 4F71A 2PRZA 2R1UA 5DM70 1EJ0A 1P2GA 4LKRA 1VL0A 2CFSA 3R3JA 1PR2A 1NW9B 3FZEA 4ZT6A 4MGEA 3JRNA 3AKZA 3WB2A 4RSHA 1PU2A 3CBQA 3ESXA 3FGOA 4IFEA 4UJ3A 1GTL1 2ONYA 4DVJA 1CUBA 2P9GA 1PD1A 1KDYA 2WF6A 3A9VA 4ONEA 1CUHA 4QJ5A 1ZM4A 3NL5A 4US0R 2SECE 4BNZA 3KQVA 4NARA 2UXBB 4D4IA 1Z88A 2VQFB 2NVBA 5IEBA 2K5UA 1JF8A 3PLRA 4G0YA 2YXBA 5T4HA 1X42A 4JR0A 1P4JA 4D0SA 4H7KA 4R81A 2ZAMA 3ZX5A 2I2BA 2YH2A 3T9CA 3PHIA 5EIBD 4HLDA 5EMKA 3ZXIA 3VR5H 2XMCA 4HGQA 3N7UA 1UPUA 1VJTA 3OICA 3IP6A 3RVNA 1NW4A 4TWJA 4JENA 1PNTA 5FTNA 3D4OA 4QTXA 1T6BY 1V7PC 1MPTA 1H1LB 2OORA 4FKMA 3PLAE 1KI6A 3GEIA 2AOTB 2Q4EA 3LUKA 3DE4X 1EK1A 1U81A 1HT3A 2WSLA 3A4LA 3QP9A 4U5XA 5A5DA 1QC5B 2AZ4A 5JNVA 4N49A 4C7VA 5CB4F 1PGOA 4TUYF 4GR5A 1I1QB 1D0IA 3IPLA 4KODA 4R8VA 1WZUA 4W5HA 4D5EA 1E79A 5D1NA 1JRLA 3T1HB 4F5EA 1VYVA 2C82A 1A69A 3DEFA 3ZYZA 5F9MA 4IUBS 5ALJA 3BXPA 2H9YA 3CVWA 3ZXXA 1P1JA 2O8CA 3KWFA 2PGIA 3OTHA 3UAXA 4ND1A 2VUHB 4TYNA 3ROPA 3B5IA 4Q48A 3AOEC 4C2BA 1PBTA 5JTTA 1XCJA 4XLLA 1CCWA 2AX3A 3MERA 1TTPB 3RKRA 2W6ID 3P9NA 4UMVA 3I2GA 4HXEB 1GAWA 4LX0A 3RC1A 4D43A 2F8TA 4G9BA 3LHXA 1I3LA 3T5GA 4R0MA 2WD7B 3BTVA 3L6OO 2ZUEA 1EM6A 4CLOA 3ZHXA 3DLPX 4KXFB 2J5QA 2Q6OA 2P6OA 3L41A 3SM3A 5EZ5A 3N74A 4X20B 1I0LA 3U4MA 3AFMA 1B6GA 3WJ1A 5T4FA 2WMYA 3C6MA 2ESRA 4JQSA 5KVCA 2OCKA 5U1PA 4TV9B 2AYYA 4NJMA 3CBGA 2D74A 1XEWY 1AKEA 2NPIA 5CW1A 3UNXA 1Y3AA 5EOVA 5LQJA 1C2YA 1HLPA 3A1NA 3AEUB 4RM3A 4WK6A 5FWYB 4OB6A 5BW6B 1Y34E 3LT2A 3QH4A 4H3KB 5DIZA 1KWKA 4NNOA 2Z0MA 2ZRPA 4RU1A 1B42A 4D9EA 4JVLA 3OBIA 5LQUA 2P9BA 2C2MA 4Q1FA 3OOHA 2XVAA 4O5OA 2H85A 2QNIA 1N5OX 3EUAA 3QKIA 4U02A 4AURA 2FSIA 3FR8A 4K81B 3WBBA 1H23A 2R00A 1DB3A 5B12A 1M73E 3TNLA 2EEZA 3H97A 3SE0A 1GQRA 3LX5A 3U37A 1KY5A 5K3BA 3O2SB 1XXHA 3AL3A 3EUWA 2VF5X 3R5JA 4XVHA 1XNQB 1KK1A 2YV4A 5JNRA 2PD4A 1M6HA 3A11A 1FL9A 1KPIA 1ZRMA 2XYGA 3RT7A 4NFYA 2W7TA 4RKYA 3DPIA 4NONA 4WOJA 1F8FA 5AI9A 5AW0A 4ZOAA 3H9JA 3G0OA 4KUEA 3OTQA 2B82A 2H0QA 2E37A 2C88A 2UVPB 1Y0BA 4E5NA 2IH2A 4QGFA 3DDZX 2MT9A 3PPXA 1GG9A 4B3CA 1IHUA 2OR3A 4IJKA 1JAYA 1SBNE 1T9GS 4CEJB 2H2IA 3TFOA 1WJGA 2PZFA 2AG6A 2O4CA 1H69A 3LUDA 3H2HA 2XJAA 1XBTA 2NADA 2VA9A 4Q3NA 3GPLA 2QGNA 1G4UR 3AB7A 3B2QA 3V8RA 4PANA 3MNFA 1JHZA 3L2OB 4C5MA 3GUZA 5EQJB 4LE0A 2BM1A 1PEYA 4GVPA 2D4AA 5EIAA 4LXIA 3CF0A 4D9NA 4LDAA 5BWNA 1CS0B 1NW7A 1LC0A 4K3UA 3RFCA 3WWOA 4DMRA 1AOXA 2UZ1A 1E3WB 4XD7D 3FBWA 1K6MA 4LJ9A 1L1RA 4RZ2A 2ARKA 4MQFB 5DEIA 5IEJA 3ZZNA 3OZ7A 1IPFA 2H7YA 2WUFA 2H54A 3R44A 3ORHA 4P7GA 4Z4HA 1OYWA 2R6CA 3JSAA 1MTZA 2FEOA 4AZSA 3TYXA 3M1AA 1A4RA 3GRPA 4B33A 5CXQA 3A31A 4DILA 4WPGA 1SBYA 2NPOA 3GJ4A 5LA6B 5LZ5A 2TSYB 2W22A 3IBGA 3MXTA 1XMSA 1ZIOA 4I46A 2AG1A 2PVPA 2IS2A 2QZSA 4AF7A 4Z0NA 4TL6A 3DMHA 1TQ2A 4LXGA 5JSQA 5JQWA 2BHRA 3TRKA 1HTBA 2R8PA 1OZAA 3DO8A 5G0TA 1XZLA 1RWKA 4P98A 2RMKA 1E79D 2YW9A 1NJSA 1WP9A 3MTQA 2ZIXA 4CHTA 4HI0E 1NVWQ 2R47A 3QVMA 4XIFA 2IDKA 4YNBA 4N3GA 4O8ZA 5CJ2A 2EP7A 3JQ7A 3KQYA 3R3HA 4LMRA 3DOEA 1T8UA 4PAMA 1IM5A 2HA4A 3D31A 1QQTA 3RSOA 5DWDA 2H06A 2GAFA 2YJ3A 1D1QA 3C8UA 3LYUA 2QLBA 3EZ9A 4E31A 1OGIA 2WD7A 2H2WA 3B6EA 5C8YF 2NV2B 5A7GA 1UP6A 1KWGA 4MWCA 1CR1A 2H7VA 2HX1A 1JEDA 2WP8J 2XGGA 3E9EA 3ELUA 3ZNQA 3ZZ1A 3GEDA 2AUNA 2OT3B 4W6QA 5GOTA 2Z2YA 1SZDA 1LS6A 1Z38A 1C0IA 2JGIA 1NQ5A 1IY0A 3A9RA 4M0FA 4W1RA 3JU3A 4GX0A 5JZSA 4C5KA 1CR4A 3CN7A 1XU9A 1WEKA 4EB0A 3BJZA 3EH2A 5T67A 3ZUPA 1SKUA 4F46A 4DC3A 5K51A 2XITA 3VOBA 4QSHA 4ZEXA 2JFXA 4W9NA 2QRVB 1G20A 3EGEA 3P9IA 3ICVA 4R1PA 2XTMA 4EL0A 2ISQA 3A3PA 3SLKA 4P38A 1EVZA 4UEWA 4URZR 2Y6UA 3JR7A 4X6YA 2AS0A 1N0UA 2PXCA 3WJ7A 2EJCA 3WIDA 3OTIA 3UEOA 1PQUA 4EG0A 2CB0A 2XIJA 1OFTA 5JEDA 4IHKA 4WCDA 1JDJA 2ERCA 3U49A 4D46A 2ZYIA 3HSSA 1GN9A 4D9BA 5F9FA 5J1SB 2D59A 4DANA 2H8KA 2GO7A 4YECA 3TWOA 3VJRA 5BPHA 1QORA 2PUJA 4Q39A 4N0EA 1ZISA 2CD9A 3LOUA 4OU5A 2OXFA 3CKKA 3QE4A 3NC9A 3X1JA 4KRXA 4PU0A 2JKYA 5JYCA 1JU3A 2YFQA 4DDVA 4HRAA 5E9WA 2YKGA 1JDVA 2JBHA 5P21A 1MZVA 3GVHA 2FP3A 3IVMA 1NZDA 4HCJA 4XVQA 2RHOA 1Y37A 1RAIA 3FR7A 4PR3A 4Q03A 2JH8A 2K2QB 1QFZA 3PUKA 3MINA 4Q7JB 4RJTA 5LZ2A 3W4JA 3FCXA 1T6NA 4QSMA 4F3CA 2WSSA 4KOAA 4QXQA 3DZCA 3DVRX 2P3LA 2CF5A 2W83A 4PBRA 1CJUC 4WLOA 1TYCA 3GLFE 2R3BA 3UVEA 3BHJA 3OZGA 3ZE7A 1QNFA 2PANA 2QPAA 1E7RA 1FDSA 1LSUA 1DKMA 1GFWA 5FUYA 3PWKA 3QW4B 4FQ5A 1ZD3A 5EE3A 4NMLA 4WXRA 4RKQA 4I3HA 1ZS9A 3QU9A 4S04A 3QBTA 1SHTX 2YWBA 4YJ2B 1CS4C 1RQLA 4KO1S 4KIWA 3CQ9A 3PUHA 4A8JB 4IICA 5K8TA 4Y9TA 3LYLA 2FPUA 1XX6A 4M1ZA 4P3KA 1SKQA 4Y2VA 2C92A 3SJBA 1N2HA 1F1BA 3P9ZA 2B5OA 4KV7A 2GC5A 1Z5NA 3SZ3A 1W36C 3SYRA 3SQNA 2G83A 3GRKA 3I3SR 3EODA 1QGUA 3SJUA 3P4YA 1CUFA 2RG7A 2IZ7A 1H8EA 1LLCA 1QFSA 2Q0QA 4X0EA 4RETA 2AW5A 1GNPA 4YONB 5AXDA 3D0KA 2XKBA 3FTPA 3R9XB 3PNMA 3KVOA 2FPKA 3QJ5A 5GIPE 3TKAA 4MUMA 3QFFA 1FPMA 2YRWA 4HLNA 2MYTA 5SY9A 1SR8A 5DNDA 4EENA 3NBXX 4B3DA 1LXCA 3DHNA 2CNBA 1L5QA 3JZMA 4MR8B 1QAMA 5DFAA 1FTSA 5A5FA 3L1UA 4LNHA 3ET4A 5TMPA 2LIVA 5BW5A 1SCUA 1DOAA 1T4MA 1W6RA 1X19A 3DBHB 4FPXA 5JSYA 3V33A 4V2IA 3H11B 5AJHA 4EPTA 1KJNA 4GDMA 4PZ9A 3HV0A 2B3DA 1LKZA 3ZIUA 4BQSA 4OQPA 1ZK4A 4GI7A 5A05A 4Z2YA 4DUYB 3DEKA 1QG4A 3T5TA 1OV4A 3BWBA 4CIWA 1OE0A 2Q46A 2R1TA 3KVNA 1OZFA 4JZYA 4MTLA 4O4LF 5KWSA 3A04A 2UV8A 1ENPA 4V0MA 1W5SA 4JOBA 4RHTA 1N2JA 1B2LA 1OT3A 1Z4QA 3HXLA 1W4AA 1GPKA 2OEPA 2VEDA 4FILA 221PA 4GMFA 5EE5B 3BGSA 3F47A 721PA 5AD1A 1LBQA 3HU3A 3QWBA 1XDGA 1YS6A 4FZ3A 3I42A 3C3JA 4HQ0A 1P0FA 4M87A 4N1AA 5HHTA 3T4EA 4BO4A 1GTZA 3C39A 4CM4A 5EHZA 1CB0A 3G6WA 4XWAA 4EZEA 3AC0A 3JPYA 3QMVA 1RK2A 2QYOA 3LBHA 2R2AA 4YRNA 5C5IA 2DBZA 2KLBA 1E77A 4E0BA 1X70A 3OLYA 2ES4A 2OLJA 4JEIA 1BQEA 1G20B 1ZC4A 3U2QA 4MQUA 1GO2A 3DUWA 5EWMB 4HNQA 4DYDA 5LNK1 4I1YA 2VCYA 3VHXA 4QO7A 3MUEA 1QFXA 3DO5A 4D3SA 1WW3A 3B78A 1E2MA 5B6JA 1M1YE 3T6KA 1J8DA 1GKIA 2ZJBA 1IL0A 4C03A 3W6UA 2XYVA 5C1BA 2I7CA 1OA0A 2W2KB 4QRDA 5LQDA 3VR1A 4MUXA 2J9FB 4LV8B 1V96A 1TEXA 4FK8A 1B16A 1Q3HA 1MGPA 4FGKA 4C3ZA 4R6XA 2FA9A 3OE5A 3GW8A 4KFSA 1ZM7A 4H1UA 4X63A 3E5RA 3AJ8A 3NR2A 2WQZA 1LSSA 2PR7A 4TTTS 5KNDH 3KQLA 2R4TA 3BMXA 4ES6A 4CDMA 4CIBA 1A8HA 2C8JA 4PLVA 5EZSA 2ILVA 1UMBB 1YQXA 5KHLB 1WKVA 1G19A 1QCZA 4MAFA 1X7ZB 3P0JA 2Q0XA 3I4CA 2HU7A 4M0EA 2FUEA 2JIMA 3KTNA 4DY4A 2LR0A 2Q21A 3A4NA 1XF9A 1JKIA 4TT8A 1T9DA 1UBTS 2FW7A 3B5JA 4H6VA 1LPPA 4DE5A 5IDQA 5EJ2A 3VV3A 1OWLA 4EG1A 3H5OA 3KD2A 3DD1A 3HNRA 5H70A 4IIYA 1X1CA 1NJFA 1P19A 2CWWA 1DO0A 3LUAA 4PCUA 4ER7A 3HB0A 1U1EA 5HP4A 3HZHA 4FUTA 4OTZA 3C8DA 4FWIB 5KNCA 4P8RA 1Z7EA 4PC2A 5I9IA 4OIMA 4TYYA 4CF7A 1E9CA 3GEHA 4MRMA 4XB2A 1RXVA 4G5FA 4MO9A 1DRVA 3GJSA 4NFHA 5DN9A 3ZTTA 4DC0A 1YGYA 4E8WA 4AKHA 1KR2A 2CDRA 1Z35A 5ALRA 3RC2A 4BNKA 2CJXA 1ZGJA 1CRPA 2ZWVA 3TLAA 4KXQA 1I1HA 1MQAA 4TRNA 4OXRA 4HADA 1ABEA 4ZVMA 3RYFA 3I34X 3K1ZA 2BFEB 4K6CA 5L9AA 3OZRA 5BSWA 5IASA 4NYIQ 2R85A 1R0ZA 4OEHA 1O96B 2XGMA 1C7IA 1DHRA 4MIOA 2PMFA 5CHYA 3GIWA 3VTKA 4RS3A 1SCIA 4I50A 4RY2A 5FLEX 1E64A 3ZD7A 1YCFA 2QVCA 3PD1A 3CTMA 3FYTA 3E0XA 3O7WA 1UJMA 3E1KA 4BGEA 5LIRA 2J3JA 3EG9A 4O5AA 1OU0A 2ZIXB 3HDVA 3Q7IA 2NZJA 4OHPA 3RW9A 3NBAA 4DHEA 4E84A 1QAQA 2KMLA 4MCJA 1U3DA 2ZSFA 3LCRA 1L4UA 3Q9SA 2IGBA 3TCXB 1XYYA 1T2UA 2OHJA 3FLMA 3T54A 1GUDA 3C3XA 3RAFC 3ND8A 2ORIA 2XB9A 3OJFA 5IYZF 1SNYA 1N0IA 3RYIA 2CFIA 1PYDA 3I64A 2R68A 5KVQA 3TD6A 4IOMA 1RWBA 3N75A 1A95A 1DAKA 2EYQA 4DJAA 4HQFA 3PBKA 5J2UF 5LDDC 1SU7A 4O59O 3LDGA 1RFTA 1KERA 1CK4A 4YRGA 4W5JA 3U5TA 3QXHA 3I8OA 3KDAA 4XX1A 3S3TA 3TLGB 1SPBS 5DBHX 1AQIA 5IVHA 3L5KA 4XYBA 1MU0A 2EQBA 3OU6A 2JGJA 2I7DA 1BS9A 4B3TB 3WLRA 1WBBA 2ZRJA 2HCJB 3E3LA 5CB0A 3BWVA 2DECA 1N8SA 3PHBE 1Y8ZA 4QFDA 2CBXA 1PE0A 3ES9A 2AR0A 4R83A 4RULA 2B94A 3OWOA 3D8HA 1GQQA 2HK9A 3THYB 1O95C 1UDCA 2YWXA 3KT6A 4QYIA 5F11A 3K6SA 1Z33A 2Q5IA 4TWRA 2PA3A 3H04A 5HBGA 1W9HA 2FF7A 2Z57A 4BGVA 3SHOA 2EZUA 1PZHA 2ZVPX 1L7VC 1MVNA 2DKFA 3E9CA 5ALYA 2QT0A 5GZ6A 3EXG1 2QR5A 4Q3LA 4R2MA 4YJ2F 4P7KA 3QXGA 3GFPA 4B7UA 3LW7A 1FP2A 3EEBA 4Q4HB 5EKUA 4QLBA 1EX9A 5EWJA 5HIAA 1Q7RA 4IFTA 2GPWA 3NRCA 3A4YA 2C3PA 2XWJI 3IH5A 1YU9A 3BB4A 4YP6A 5JLAA 3KSUA 1F9EA 5CCXA 4BJ6A 4ALLA 2DR0A 1U7OA 4AQ7A 2UUCB 1CUEA 4HAVA 2FR1A 2NVUA 2XT0A 3KB6A 1UBLS 2NU6B 1DZIA 2VSXA 4KAJA 4ZV7A 1AKMA 2GZ3A 3K1AB 4D9KA 3AU9A 4ON9A 4XGIA 4KL8S 3HRIA 2RGXA 4IFIA 4XIIA 1CUSA 2PSFA 3NTXA 4C4SA 2YZNA 4R2JA 5CNKA 1HT2E 3I52A 3I53A 5I9BA 5JJ5A 3HGMA 2ODWA 3PQ5A 3MBOA 5HEKA 3ZK8A 5JHGB 4KR3A 2GDZA 2XHEA 3PYXA 1U4SA 3QEAZ 1W1UA 5BV2P 2YHAA 3T1VA 2P0YA 3MBJA 3FZNA 3LDFA 3BAFA 3VZDA 3KR1A 3V6MA 4RPKA 2CBGA 3X1DA 4GM4A 1RPAA 1ZD5A 4JBLA 1QV7A 2RCYA 4L2IA 4NENB 2P3SA 2IKSA 3H1FA 1L7BA 4RLFA 3S2ZA 2LBPA 3DHWC 3JTMA 1I5OA 3QUBA 4C7OB 1TU0A 1M0EA 1Z37A 3LXUX 3WNZA 3S4YA 4D44A 1FCJA 4W5WA 3U17A 1YK1A 3Q41A 1RJ9A 3RF7A 5IAOA 2DG2A 2MIIA 1L1EA 3WFIA 3ZDDA 1M1XB 1NVGA 2NVWA 3KFXA 4QU0A 1XDBA 2IXTA 2W8BA 4AJNA 4INZA 3U6KA 1Z08A 3KTAB 4G1UC 3MGKA 3ZLBA 1RWPA 4WDRA 2QN1A 4GQIA 1HETA 2O8EA 3RQQA 1GPMA 3FH0A 5AOAA 1FYDA 1RTTA 3EFEA 1JDBC 4UULA 3ORRA 2PX4A 3HJBA 1SY7A 1JR6A 1FE8A 2DRIA 4OGFA 3QMMA 2E4YA 4RC9A 1TKCA 1IONA 1QH0A 1TJ3A 2ZI5A 1IZ9A 4BO1A 1G8GA 4U7XA 2ZSKA 4X1KB 4WZ6A 1V11B 5KOJA 4M6WA 1KP9A 2H1CA 4RFSA 1M2VA 2XA2A 1AT1A 4ZPXA 3WLSA 1AJEA 1GU1A 3MELA 2YVQA 2I87A 3QX9A 5FWXA 5CDYA 5IH7A 4WZAA 2PZ8A 4KGXA 3RUFA 2O3SA 2KWIA 3G82C 3WLMA 4IDFA 4ZV9A 2VTBA 2V5UA 2ZYAA 1TLLA 4EW3A 4MV1A 5HIJA 3RK4A 3H17A 1PJQA 4KKXB 4LW8A 4XQCA 3PNSA 3QBVA 4ER6A 5CLIA 5AJYA 3IUNA 5IABA 3M4ZA 3LXRA 4OH7A 1POWA 4Q4HA 5KTSA 2HWXA 1KVTA 4ARZB 4IDBA 1FS5A 3OSZA 2PUAA 4YRBA 5K0ZA 3JQRA 4C5NA 2A7QA 2HRZA 2W4IA 3VAAA 3SZGA 1NSYA 2A1UB 3LM8A 3A28A 1EPUA 3AFHA 3CRRA 3KOMA 4WMLA 1M34B 1QTIA 4QYXA 3ZVLA 3G8DA 4OY3A 2VF7A 2V7EA 3VVCA 2FLVA 2XRMA 3KKOA 2BISA 3CUSA 3UHFA 1ATIA 3EZNA 4Q4JA 4JB8A 5AK4A 2FFHA 2NUAA 1AGYA 3NYIA 3FOEC 1ETHA 2ODQA 3CY6A 3LL7A 5DBGA 1P3DA 3SVZA 1U1FA 3WDMA 4B4DA 2RH4A 5KNDA 1X7XB 3JD2A 4RXTA 4PX5A 5AO9A 1ODJA 4JHXA 3KKQA 5ALEA 3TO5A 3GO7A 3N28A 1ZIYA 4CF4A 3OZVA 4X3CA 4PC6A 3M5DA 3ZHBA 4C1BA 2CXQA 3KFLA 2NYRA 2G9UA 3D0RA 3HGTA 1OI3A 4FOLA 4BJ5A 1UB0A 4CKZA 5B4VA 3BYZA 1P7YA 5IXSA 1D0VA 3KIPA 4BKMA 2GASA 1F6BA 4FHCA 4JBIA 5AI8A 3EYWA 2NO0A 3F3KA 4JJ7A 5ERXA 1EXMA 2EF0A 1RI4A 1WCWA 3OIGA 2O19A 3D7LA 4FSXA 2IOFA 5ESXA 1RZUA 2COKA 2W00A 4HDMB 5F12A 4Y1RA 3NP7A 3THSA 4TLAA 3OHPA 4B73A 1P5HA 2BYTA 5C8ZA 1LC3A 1K27A 1NI4A 1XC7A 1AU9A 2ZLBA 3DZJA 1SA0A 2AC4A 2IYPA 4MUYA 4P54A 3L4BC 5JNUA 4F56A 4DR2B 3NBUA 3DAFA 3DXZA 3E1SA 5KTYA 2NN3C 2CB9A 4YAFA 1M76A 1DIOB 4G0UA 4YT8A 4BMZA 1CY1A 2R62A 4Y6SA 5T41A 4KBEA 4HEJA 3QWHA 5FBRB 1R0BA 1UADA 3GJTA 3NCHA 4MW2A 3DBLB 4XQEA 4ZOBA 4DCTA 2HGSA 2OY0A 2Q3HA 3KBBA 2HCFA 2OGUA 2UDPA 3FVQA 3LPAA 3UMSA 3VU1A 4G5GA 1B4DA 3K0HA 3K0AB 4BEWA 2HF9A 5EI5A 2G88A 4JNCA 4ZOLB 4IVQA 1ZVMA 3HK2A 1G42A 1XCLA 2FMUA 1M1YA 3MVEA 4QWMA 4EGFA 3NAQA 4S12A 1G3QA 1RKVA 3ANYB 1Q15A 3AJAA 1BTOA 2VHEA 4MP6A 2ZB4A 1J21A 5L3SB 1PG5A 1ZY2A 5BMOA 2BOVA 2UU9B 2GRAA 4KLRA 1R50A 2CV1A 5FOQA 1Z4OA 4ZZ1A 2C7VA 2ZWPA 1NJGA 3D0OA 1RADA 5TV2A 2NUAB 5BQ5A 2EQAA 2NZXA 5F2NA 4HQ6A 1FBNA 1XZBA 2QL7A 2O57A 1IAQA 2W98A 4GPAA 1VHTA 3LKDA 4RA9B 3UWDA 4BNLA 2VP3A 2R3EA 3L18A 1U0RA 2Q1YA 3LUHA 1A4IA 1T4GA 2IHVA 4G1FA 4BDTA 2IY7A 3F4LA 4D4JA 4F91B 4F3KA 5JI2E 4O33A 2BH9A 4MROA 2XEDA 3GFSA 4W9RA 3DCNA 3L05A 1XQYA 3IVRA 2OVBA 1IHPA 1NLMA 3LC7O 2V7PA 3P32A 1V1RB 1BWPA 5DU2A 3D4IA 2Q8QA 4F8EA 4QTYA 5KUTA 3L7KA 1ISIA 2WHPA 1S3IA 4X00A 1C7JA 3MF4A 2ZPTX 2VPQA 3NEPX 4FOPA 2QDKA 2Z3WA 3FZYA 4NABA 4TQAA 5JNSA 1U02A 2HTFA 1EDZA 1OFUA 3G0IA 5KOHB 2FJPA 4Y7DA 5CB4B 2YMMA 1CQIA 1OBCA 3D3NA 3R3ZA 3C7TA 1PQYA 2Q5RA 4Z0TA 1OLUA 4MQ5A 5J4KA 2WU1A 5C3YA 1INLA 4UOEA 4WD3A 2O0LA 1Q0UA 5JZ9A 2AFIB 2QUHA 4B3MB 4FYMA 1ND5A 5FA5A 3DJYA 5IJ9A 1DGQA 5IMBA 4Y2HA 1RYNA 3GY0A 1B2RA 1J1UA 1W4LA 3A3YA 4RAOA 4FLEA 3ABZA 1UJCA 1YRQA 3KYDA 1D03A 5G3YA 2OA0A 3T95A 3UQZA 4MUHA 4CFSA 3LSTA 3ZGNA 1L1QA 4DDUA 1HQYE 3H7IA 4OUKX 2C84A 1B14A 2JFOA 3E48A 3LBYA 5AICA 5JEEA 1PT9A 1ZHOA 4U9UA 3ESDA 3TVTA 4EB8A 2J5BA 4M83A 1NQUA 2QYSA 1N5JA 4B47A 4FEGA 3SXPA 2LCQA 1KEVA 1U0OC 3W8NA 4DY6A 1L5MA 3I1FA 2X13A 1RBQA 4JI1B 3V32A 6PFKA 1NNLA 3OLXA 2GM9A 3KU4A 3ASYA 5F5LA 4KWHA 3HCBA 3MCZA 2NZ2A 3F71A 3VFDA 4E2ZA 1YDHA 2LD4A 3GOQA 5AVRA 4WOPA 3FX2A 3R3VA 3HM9A 4OHOA 4B6QA 4FWBA 4JI3B 3E9YA 4UAJA 1K5PA 2BGMA 4IHJB 1XWWA 2V5VA 2V6FA 3C8MA 4X1YA 3VR3D 1QTQA 4CTNA 3BH0A 4F4DA 2CUTA 1WUYA 3ZU5A 1SXJD 3I45A 1EGHA 1Y8CA 2C00A 2BEKA 4AJHA 2VT6A 3IKMB 4MR8A 2OV6A 1H1TA 5BSEA 1G41A 1BXRB 1HG1A 3JQ8B 3FSGA 4QBIA 2VWHA 1KFCB 2OG2A 4W1QA 3WKEA 4I4CA 1HDGO 3MMXA 4MPRA 5KU1A 3WL3A 1UL1X 3O8CA 5EUMA 2NNLD 4LYYA 4N7BA 1JR3D 1QIJA 3EF3A 2B1QA 3Q7EA 1EUCB 4J07A 4ZANA 4N47A 5KYGA 1HX7A 1QS0B 2DWPA 5I7SA 4C4YA 1MDBA 4P0TA 2R1VA 4FNGA 2A9QA 2IXDA 1E3WA 4JP8A 5ECYA 1W46A 3G85A 1F4PA 5AI6A 1OB2A 3ZZ0A 1I1NA 3OTOB 4PQYA 1YA8A 3ENZA 2RGAA 5DO9A 3TLBA 4PLHA 3CA8A 3TSWA 1QRUA 4KVFA 4PCVA 3LZDA 2H1VA 2NO9A 3RU2A 3L7IA 3V1TC 1JXIA 1F2VA 2FE4A 3K2IA 1RI3A 4HDAA 3LK6A 4XQ9A 3COWA 3E6AA 4G6ZA 2DHQA 1H6BA 5TB5A 1KIAA 4IBOA 4X85A 3CV3A 2IOYA 3IR6A 2GHTA 4QG3A 3EQZA 1JIJA 3QI7A 2IHKA 1CUAA 2N9UA 4UD6A 3ON5A 1WB9A 1NT2A 2FETA 3RRMA 1S2GA 2Q07A 4BY9E 1GM5A 4NV0A 4XIGS 4OYHA 2P90A 1QHXA 1T15A 4IQFA 4Q7MB 3FNQA 5IAGA 3WA6A 5C7LO 1V1BA 3NIDB 4LDPA 3U3OA 1NG1A 3I72A 5HILA 3V8QA 1JJ7A 2QZPA 2ZTHA 4YO8A 5HDBB 3I3YA 4QUGA 1ZGZA 1WOMA 4JKIA 3D1LA 1FRFS 3PNPA 3H9EO 3U62A 1EJ6A 5IKEA 1NQVA 1R9GA 3IQHX 3TRFA 4NESA 4NBRA 5JOQA 3UAVA 5K9ZA 3U6BA 2VBCA 4OHBA 5FB3A 2O59A 1MGOA 1GIAA 5BWCA 2XKKA 5C18A 5JZBA 3L79A 3PITA 4KLCA 2SCUB 5EUCA 3WGLA 4ZEVA 4G1CA 3X1ZA 2B9EA 2GLUA 5BNWA 3T3OA 1YHJA 2VT2A 3LHKA 4IIFA 4DJ5X 4DKJA 1DJNA 3CFYA 2KB0A 4IEIA 4UOQA 2FY8A 3L92A 3SYTA 3NOVA 1GTMA 2FAXA 2V4UA 4TMWA 1GNTA 4XM0A 3I09A 4N6OA 4NRDA 1NOJA 1CR2A 3P94A 1GY8A 3F9IA 1RKQA 3B2EA 3N2KB 3QX7A 4IPTA 5ALUA 2RHGB 4NMMA 2Y2UA 1OXMA 3D2BA 1OC2A 2MYNA 1VTKA 1X7DA 1Y1TA 4NSNA 3CNBA 1H4VB 4ZMSA 1YE8A 3GFFA 5EGNA 1QFYA 2FMIA 3EVGA 3NBYC 4MIKA 3GBVA 4RK0A 1DEOA 5HK8A 5AW8A 1EJ2A 1P7PA 1T1EA 1XCPA 2OCYC 3ZDXB 3NRBA 2REQB 1YUNA 1OXUA 2MOKA 4PBSA 1I13A 2J4DA 4XPIB 4DBLC 3GCXA 1E3TA 5IJZA 4PW0A 2O1WA 3GVXA 3QTTA 4N48A 4BE7B 1M75A 2W6ZA 2HWWA 2YFKA 3D59A 1A27A 1G8PA 1R0SA 3B60A 5HCUA 1IULA 3Q2OA 5JR3A 1F2UA 1YRLA 4DQVA 2QN8A 3LHDA 5ICEA 4HQKA 2WHYA 4PTLA 4KEAA 3OQ6A 4QL3A 4Z7QB 5JNTA 4KALA 1EB9A 1H85A 4KVAA 1SURA 4GZ6A 5FAKA 1RQ7A 2GCGA 4K0RA 1XSEA 1BRTA 2IC5A 3TQQA 5JBIA 5BQOA 4EYKA 3N2GB 4U4AA 3RUCA 1KR5A 2TMYA 2YN0A 3F7TA 4MLDA 4KPYA 3HUEA 3NNNA 3VDMA 2EWMA 2X0JA 4DQ0A 5I6DA 1ECPA 2E55A 4N7JA 1GYPA 1LW6E 3AO0B 3TAHA 3THRA 5DSZA 1ZMRA 4JI8B 5I45A 3GLSA 3WGJA 3L8FA 1OTHA 4BBAA 1JPVA 1A1VA 1FP7A 3DMPA 4G5RA 3LDUA 3LFUA 2VNHA 2YHIA 1A8PA 2FYTA 3KTFA 3K9HA 2P2NA 1PBNA 4HWOA 5EYPA 4PE5B 3RQSA 3VASA 4MVJE 2H9IA 3HYOA 5FUXA 5IDXA 2CEKA 2IY9A 4I9UA 4AW9A 4HT3B 1SXJB 5KVSA 3EPLA 2Q49A 4I6GA 4LI0A 1DL5A 1R2QA 4WESB 1LVUA 1T3HA 1KK0A 1BN7A 1EGQA 4GGOA 4TT3D 5CM9C 3SNKA 3WQQA 5FDFA 4Q3BA 1FNMA 1GQTA 4PX2A 3NGXA 1WQ3A 1NONA 4LWQA 4OMFG 4CHGA 1BVHA 3U3RA 3EDOA 1C30A 1KI2A 4UU0A 1NXTA 1JHUA 4J29A 1N2GA 1WB5A 4X71A 3GF4A 1ZGGA 3KZ1E 5DB4A 3QEKA 1TUEA 2GYVA 2NV0A 3OH8A 4I5DA 3ZN2A 4HFMA 1I2MA 5DP1A 4A6XA 5ITVA 4PWYA 3FMOB 3DZDA 1O97D 2VP5A 3M6FA 4TROA 2P2DA 1G5FA 4PXAA 3KVYA 5DXAA 1OXVA 1U2TA 5DASA 4ARCA 3L49A 2IE0A 1ZXLA 2O0HA 3NM5A 4JOQA 2HBYA 2QJRA 1LI5A 4I81A 1DKRA 2VYFA 2Y92A 1JJAA 2VDVE 5GM2A 1ZK3A 3WMRA 3RR2A 3C97A 1B0PA 3G2MA 2FPIA 2HA5A 5IRCD 1M8JA 2MDTA 1HPLA 1T2FA 2CVQA 3EZYA 3GWZA 4ITVA 3UUGA 1SCJA 1SO8A 3LYAA 5D85A 1L1FA 1XPOA 2F3PA 3AVYA 3VO2A 3O4FA 1O95A 2ECPA 2CLHB 1XZAA 1SC9A 1E9DA 5K0EA 1KI8A 1YR7A 5AW7A 3TUIC 4MMZB 1A8IA 2R65A 4I1OA 1ECGA 1IWBB 3UA3A 3RD5A 1NMQA 1U3GA 2I4OA 1JJFA 2OBNA 4B81A 1IWOA 1NM5C 3BH6A 1Z26A 4QD3A 1KXZA 2HADA 2PCLA 1ZUWA 3TE7A 1IDOA 2PGAA 4KJXA 4EQ6A 4E5DA 3S99A 4JBNA 1SQFA 4MUFA 4ENQA 4INJA 2CKMA 3D3KA 5U4XA 4XH9B 4F9TA 2XZOA 5E9AA 2IP1A 2Q3DA 1X0XA 2R4UA 4LJ7A 3L7YA 5EIFA 3WZMA 4KVZA 5G02A 2J9ZB 2NPFA 4CTKA 4AD8A 1WKBA 3C5WP 4G67A 4HH1A 4M9ZA 3A9SA 2PIDA 4WV3A 1I01A 1K4KA 1SWWA 2M1ZA 2XTZA 4C43A 1E2BA 3M6MD 1KU0A 3NJRA 4YJFB 3SSMA 1SAYA 2C4WA 3BRCA 1DQZA 2WTEA 3PB3A 4RQUA 4B2IA 2FK7A 3OCYA 4WAUA 5CDFE 3AESA 3CEHA 4KZPA 1ZYUA 3VPFA 4URWR 3UXHA 4UTRA 1Z6XA 2NZYA 2ZKIA 1SXIA 4RPHA 5EYPB 2NSLA 2PDAA 4YT4A 4DV7B 2AFIE 2QRKA 3OPQA 1EWRA 2ZULA 1HC7A 3JQ7B 1IY2A 2A5YB 1FZQA 2CSUA 1KSJA 4YREA 3ZLVA 3SZUA 5LZ7A 1CUCA 5CFRA 5JADA 2ZITA 4GPIB 2FOLA 1YKFA 2QRJA 4ZOEA 1VRCA 4ZIRA 5BOSB 1ANKA 1WXWA 1ZLXA 3FI0A 1MV5A 4UXHA 5HMLA 5C8VA 4NCJA 1ZIDA 4FDLA 1NBHA 3RC8A 3CX6A 5CVJA 3EQ6A 3RRZA 3VX3A 1ZD1A 3FPFA 2O8VA 1RS0A 1VSVA 4U6NA 1WCV1 1R9NA 5FLYA 4ZEOA 4DPLA 4V02A 2KI5A 5JH7B 1GL6A 5IPFA 3KXKA 4KH0A 1XZCA 3EVTA 3KKPA 5J63A 5EQDA 3ENVA 4OHKA 4A8JC 4N3AA 5AOBA 2X0IA 3O3CA 1XTSA 4CMKA 3HVRA 1T36A 2PAFA 3R3YA 1B8OA 4MVJI 5KYYB 3S8YA 2FOIA 4FCVA 3GUHA 4UMDA 2PA0A 3VR6A 3B1OA 1Y33E 2VDMB 5EXDA 3QKUA 4LYAA 1YB6A 1ORRA 1YVUA 4LJYA 1Z7BA 1UKEA 3DV2A 4RIIA 1C50A 3TRJA 4ASUD 4C4OA 4BTVA 5A3RA 3D9QX 3N6RA 3HYCA 5BQ3A 1G20E 3MQFA 4HJXA 1LGYA 1U65A 4L6CA 1VMKA 4LSZA 2EX4A 5HM8A 2AWDA 1HFWA 2Q6VA 3OIWA 2X2PA 3E53A 1TQ4A 2VPZA 3ILSA 1XTTA 3OZUA 3QLEA 2Z8XA 1W5EA 2JAWA 1VE9A 4LK3A 2PKMA 4HPWA 5IFLA 3C6QA 4I1VA 1J8MF 4QNMA 4QVKA 4TYMA 3HO6A 1XKQA 1UPXA 1ZM2A 5LNK6 4IF6A 2PKNA 1Z4NA 2NUBA 4YYZA 5C3MA 1N5RA 1Z6GA 4XYGA 3U0VA 4CMIB 4CIAA 3SFVA 4EK9A 5CTJA 5LA6F 2JIZA 4K6FA 4QPZA 1Z17A 3W3AA 2P9TA 4RUKA 1UWCA 4KC0A 1P9LA 3ZCTA 1NW6A 3L7JA 4M9RA 1QIEA 1TZ2A 4GWGA 4ZQGA 1B93A 3AF4A 1QE5A 4JB0A 3WWEA 4MOWA 3WK6A 4MQEB 4UHJA 3QKRB 4KDRA 3ETHA 4LN1A 4MJ7A 4NYJR 4YGXB 2ENWA 1V8FA 4AUEA 2P67A 5A9SA 4INPA 5IZCC 4UEQA 3QYJA 2BGUA 4ZTZB 1T0UA 3V8PA 5CJPA 5AHWA 1L4MA 1LCIA 4P4UA 1WHTB 4UHFA 1WUTA 3D3QA 2EW8A 2EARA 3NHFA 4YMVA 5TMDA 4B1FA 4G85A 1GG4A 1CP3A 1ORTA 2HSZA 3OT1A 1RWWA 4RQBA 1AKRA 4C3UA 3Q15C 3GAAA 4OYRA 4Q9KA 4RZUA 2HRRA 2FKNA 1EDBA 3CRVA 5I3CA 1PGPA 1U7XA 5EMJA 3RROA 4FONA 3K8ZA 2FTKE 1AHPA 3QHQA 1SQGA 2FKAA 3LQFA 4HLUA 1RYEA 5CFMA 3BDIA 4UVDA 4NJMB 1RABA 3DVAB 1C80A 5EJFA 3I37X 1Y1KE 3LV8A 3RNOA 2XUHA 5DLPA 1GUBA 1GWNA 3ETEA 4JDPA 2WJGA 4A7PA 4C7XA 4DIFA 2HK7A 2WIDA 1XZIA 2Z2KA 2X5NA 4H1TA 3QTBA 4YRFA 1XNJA 1SIUA 3T4PA 5KQPA 4WTOA 2XXAA 1RI2A 4CI0B 3DDHA 4JQOA 2X1MA 3PNLA 1LVGA 4IKPA 3IUEA 5T8KC 1J0XO 3HLYA 3GQVA 3LVFO 3UFXA 1O58A 2Q6TA 5EZ6B 1V71A 3O90A 1EP9A 1VG9B 1UAAA 4URXR 2XNCA 4LGMA 2G9ZA 1CS0A 1UKAA 2A9OA 4AI6A 4WKOA 1GC5A 2YQ5A 1WHSB 1J9ZA 3KYIB 5FH9A 1XAGA 2YBEA 3MW8A 1E1QD 5E1MA 1VHJA 3NWEA 1VE1A 2D7JA 4IVRA 2DCNA 1WXIA 2D62A 1ZW1A 3L7DA 4BU0A 1NYTA 1TGVA 1RE1A 2DSTA 4RF2A 1YR6A 1JZQA 1PJRA 2P2GA 2V7VA 1P2UA 3QENA 3TMAA 4H9GA 4ZI5A 1RZRA 4ZOQI 1IQPA 3U40A 2W42A 3R0ZA 3BHMA 5AW2A 1ZK1A 4TLEA 2AB8A 3F8WA 3NVKI 1TQDA 1NI5A 5AW5A 1ZA1A 1IC6A 1NJ2A 3KZNA 1ZG3A 4YRAA 3TW8A 1QH8A 3RQ8A 5FEUA 4FI3C 4KHZA 4LBWA 4BNHA 2IKQA 5ADWA 5JZOA 4OGGA 5T3UA 4HB0A 3DBRA 5D5PA 3HYRA 3VV2A 4BO3A 4PZAA 1YAJA 3ND9A 1QGDA 1NOIA 1CQJB 4UUPA 4DA8A 4DV5B 1OJ7A 4KZKA 2H4WA 3JQGA 3D6MA 4V0NA 4QVIA 3AONB 1Z2NX 1EX6A 2DY0A 2QMYA 3DEZA 2ZPAA 3KXIA 3KDPA 4HFJA 5IJ0A 1P73A 4DR4B 5AQEA 3LC1O 2R8YA 2ZKLA 1J8VA 2ZQYA 1U4NA 1MB9A 1TO2E 2V7TA 3G49A 4G0PA 4UUOA 1A2BA 3RIEA 1CEQA 4YMIA 3U4DA 2E9SA 5GGXA 4V0ME 3RJ5A 1C7EA 4MV9A 5TX7A 1AY0A 4LZZA 1CQIB 1HQCA 4HH4A 4BFVA 3K1YA 3P9XA 5TVGA 4IAOA 4UREA 1XZQA 1HI9A 2QY6A 1DRUA 4L3OA 1IIBA 5G0UA 4W7SA 1CYEA 3IP7A 3STYA 1JIXA 1Z8HA 4UDOA 4M60A 2YY5A 5FPQA 3HBAA 5A3VA 5ETJA 4RVNA 2VKTA 3H05A 3I6ZA 1BDJA 3HJNA 1P80A 2H4XA 2Z8ZA 5A3QA 3ISTA 2QENA 1E1QA 2WSSD 1SOUA 3BXXA 3B6JA 1W0JD 3PFWO 2QE6A 5DWQA 1NN5A 1Q0LA 3RO7A 4GLBA 2P41A 3PDIA 3IBQA 3BKXA 3I9KA 3ZI0A 3B6KA 3CRNA 2I6GA 3GUVA 1RAFA 2GFIA 3HJAA 3NDPA 3PEWA 1N4AA 2EF1A 4BLQA 1QDEA 2FWIA 4L4YA 1JQEA 1ODCA 4HDSA 1QRRA 4OSOA 1OJLA 2C3YA 3AT1A 1DBQA 1JG3A 1NBME 4HKTA 4IIBA 4ND2A 3S1AA 1S2OA 4C5BA 4RCZA 4CQJA 5GONB 2BCGY 3PUJA 2RH5A 3PRKE 2WF9A 2ZTVA 4N5MA 3C3WA 3LE8A 5D7BA 1QZ3A 1MEEA 1K9VF 4BFLA 2EX0A 1SCKA 3F1KA 5EUQB 1K86A 2OP1A 4NZMA 3WOVA 1YBAA 1PUXA 2HSGA 1NW3A 2DY1A 2BC9A 3KZKA 2HAEA 5J5CA 3DL0A 2C97A 3H8JA 1UWVA 3FCOA 3K53A 2G67A 4PIPA 4S1PA 5T6MA 1P45A 3RUAA 1ONNA 1YTUA 4IX1A 1XD8A 2OBLA 5AOVA 3NYQA 3B51X 4AYWA 3QE2A 3HCWA 4MZXA 3OEWA 2Q3JA 1YRAA 1UDRA 1UDAA 4F2DA 2NYAA 1EK0A 3WFZA 1VGVA 3HMQA 3G0BA 1PCXA 5BYKA 1NQWA 3CUVA 2D1RA 4P4GA 2WINI 1W25A 2MYPA 3IULA 3V8NA 2AM2A 4MS4B 1DRJA 4ESHA 2PRYA 1EVJA 3ONDA 4RZQA 3UZUA 3JPWA 3AIMA 2ZS8A 4D9JA 3WGZA 5IAEA 4KE7A 1QQ7A 2RONA 3BMOA 3RGGA 5K5EA 4OGWA 2HN9A 2HCTA 4EX6A 3FUWA 4HDMA 4WKNA 1XNRB 2GM4A 1A96A 3N3AC 3OZFA 1P9NA 2E5FA 1FX0B 3B20A 1IIRA 1PJBA 1E7YA 1Z0ZA 3DPUA 3G2HA 4JBHA 4XFJA 2MINB 3RTDA 4EPYA 2V7BA 1AKUA 1NR5A 5EJ8A 4MWDA 2WLTA 2WUDA 5CM2Z 2X9NA 2HT1A 1P5ZB 2VXOA 1PJSA 4H27A 3U0BA 2QVBA 3R7WB 4H59A 4KR9A 4DC9A 4I55F 5PNTA 3ZGOA 4EELA 3S1SA 4J75A 2WJAA 4GBMA 4ETNA 5JIBA 2VP0A 4IG4A 2ZAYA 2O1SA 3WO1A 3HC7A 2O2GA 4DNFA 4EPRA 2WTMA 3OETA 1JFTA 5HQ3B 4R1MA 3KJZA 4R2IA 4OG2A 1QO0D 1CFJA 3TTXA 4KDEA 1ZDMA 2Y1EA 4D9GA 2F00A 1FFXB 1PHRA 2F4NA 1YB5A 3CGWA 3G2LA 3KXPA 4BWGA 1GDDA 1L7MA 4MA0A 4WZBB 1Y8QB 2ZUWA 1ULHA 2ZRFA 4IQGA 5KYVA 1ZCJA 3WRWA 4MQ6A 1LBTA 2DQKA 2D0IA 5BYDA 2PM8A 2VH2A 2NO7A 3PZRA 4FLMA 5IUKC 2JCBA 2EXXA 3W04A 1I9GA 5ER6A 1E6CA 1KJQA 4CKCB 1QIMA 2IZ0A 3C5VA 4BJHB 2W6IA 5HOQA 1OIWA 4ARZA 4AN1A 1U9IA 3VOSA 4EKGA 4ZXPA 2HI0A 3H0EA 1WMBA 3I9V1 5AVTA 3TSCA 3NEYA 5E9QA 4C9BA 2L18A 2TMGA 4L4RA 4IDHA 1Z56C 2RHHA 4WBSA 3EQ7A 1CD5A 1II0A 2V0GA 4Z3DA 3LNCA 4F93B 1HTTA 4LY3A 1RXWA 4Y1GA 3K6KA 3HU2A 3JYOA 4JFAA 1X2EA 1N9KA 2W8ZA 4X65B 3FXAA 5H3HA 4R1OA 4NU0A 1AKYA 2HMWA 2PFSA 1VL2A 5F1KA 5FOVA 2UZ0A 4KO3S 1XRRA 2RHLA 1I9CA 4UUMA 1KVQA 2RH9B 1T8RA 5GINE 2FW6A 3HA5A 3HXKA 3FW1A 3NC1C 3U16A 1TM1E 5L4LA 3VXKA 2QP9X 4WJMA 3VH2A 4RL4A 1J22A 2J08A 4LOIA 4QG7A 4B3JA 5K09A 1KAOA 4KH1A 5BWMA 5LU9A 1W88B 3R0IA 4YJ3A 1J70A 5A4KA 2BRUA 2RK4A 3JQ8A 4IMPA 4Q7EA 1T6XA 5E2IA 4GVLA 5B4UA 1X7GA 1IY1A 1U1DA 1H2YA 3ZH9B 5BSVA 4LFBB 3YASA 1ZOOA 2AFVA 1JIQA 3RVRA 3WI7A 3AF2A 5HPYB 2F2TA 2PMKA 2HRBA 1IQ0A 3H4IA 1Q14A 5CX1A 1P5RA 3ZDCA 3B1FA 2GAIA 4FOOA 3DOFA 1NHWA 4C87A 4WXEA 3K9NA 1BDMA 3M2TA 3SEAA 1G5RA 3E81A 3T5PA 1A8QA 4PVVA 3HO8A 4N39A 3OTXA 2VQ6A 3F49S 1AS3A 1YFZA 4IH9A 4JSYA 4CEHA 1HORA 3W2HA 3KZVA 4FFLA 1UBRS 3PNOA 1QF6A 2OZPA 5C40A 1R6TA 5HYVA 1K8QA 4E5YA 5I4BA 1RM0A 3PQ3A 4S1MA 2C2XA 4MUAA 4UTPA 4BMSA 1PV4A 4ZYLA 2AEEA 4ZEWA 3GGDA 1S1CA 1R15A 3OCCA 1C1HA 3C7KA 3I01A 4OOEA 4RF3A 2YJ6A 3AIIA 2G82A 1RYBA 1HDZA 1JEOA 1R37A 1A1SA 2EFDB 2WIGA 2C5SA 1FQJA 4QU5A 2G17A 1R6AA 4PG5A 4Z9FA 2FP4A 3KJEA 1GKYA 5BWBA 1KYHA 1AF4A 1E6MA 1S02A 2WU8A 3OQPA 3T5BA 1NXPA 1GT91 4WBNB 5B36A 2XUQA 5DYTA 4RVOA 3ZJ4A 1FDIA 1SWVA 1OX5A 3OPXA 2R25B 1DV2A 3N9IA 5CNMA 1L7QA 4NNPA 2FN7A 1RFGE 4B7AA 1JFSA 1OAAA 5IFKA 1TD1A 4M1TA 2IGTA 4FBMA 1JWBB 1KP2A 3UJDA 1Z6TA 4QOGA 4DEXA 4I5GA 2ZSHA 2C0QA 2QAIA 4G3XA 2JK0A 5B57C 3DCJA 5KBYA 3QLTA 4RK6A 2OCLA 5KHAA 3TGWA 3ZJYA 5KVVA 4MGYR 4GEGA 1AQJA 1NRXA 4WZAE 3RVLA 4E2YA 3EPKA 1PJCA 1PTKA 4KIUA 1WPXA 3SOZA 1P81A 4CT4B 1RXIA 3MAAC 4OQFA 4TKVB 4PX9A 4MVWA 2WWXA 4MCAA 2AZMA 1HE5A 1QBKC 1D2CA 1W73A 3LAWA 4IIEA 1SJ9A 4WN9A 3S55A 5EESA 3K70D 3WWYA 3S2EA 2PLFA 3JQDA 1VP3A 3IAFA 3ZHSA 1CY8A 1PEAA 3A1EA 4C22A 4LF8B 3PJFA 5DXFA 4BNNA 5INTA 3CH7A 3TZBA 1N2IA 4YIKA 4O0LA 5TJHA 3VYTB 2IYEA 3ZBTA 5IULC 1XWIA 3GJYA 3AIOA 1L4BA 4IEFB 4AO6A 1FW8A 2OFXA 2JGKA 1RE0A 3DZIA 5E3IA 3ZHQA 1HZZC 4DMUB 4EUFA 5LMUB 3W6NA 2QD1A 3K0SA 3IV9A 3O8QB 2CLFB 5KZMB 1F0YA 3HKCB 3VHLB 4EYSA 5CA1A 3J80A 2QMEA 2JIRA 1U5AA 1M6EX 1WU8A 2V8OA 4K9DA 3JARA 4OJMX 5H9WA 4K8TA 4G1BA 4AWBA 1UWLA 4KAHA 4BU1A 1DBRA 1XDSA 1XEXB 3QK7A 3IXMA 2W2XA 5JSFA 4OHUA 4Z7OB 1A9SA 1EVEA 3RSLA 2J0UB 2ZUDA 4PICA 3WNVA 1DWQA 5D3QA 4DNOA 5LB4A 2XWQA 3JZFA 4XX0B 3WDKA 4JU8A 3D5EA 2CLLB 2GUWA 3HKBA 2X9QA 5TSDA 2KM1A 5GVRA 3R74A 4Q24A 2BHNA 2JAUA 2I76A 2FX3A 3QX3A 1DJMA 1EINA 3G89A 4OQNA 5KJFA 1H2WA 1UK6A 1WY7A 4IKEA 3GGPA 1AKWA 4U1RA 3ZJUA 4GLLA 4D0NA 5BYFA 4E32A 5JSUA 3MJSA 1JU4A 3GLGB 2UZ3A 2XQFA 3PWSA 3RG8A 1TB4A 1HFKA 1G4AE 1JVSA 2E1PA 4B0PA 4ABYA 1L8AA 5KAPA 4YJ2A 3GLFB 2HA0A 2YCBA 3NS7A 2A1TR 2ATCA 2IF2A 3EPPA 3VTZA 3V80A 4HYEA 1UKZA 2NO1A 3D43A 1PDOA 4HAWA 4GQBA 3PHJA 3Q6MA 2VDJA 5DBFA 3V4FA 4L9WA 4YRZA 5CG2A 5G3ZA 2PBZA 2Y8EA 1HDXA 1CRQA 1T4CA 4K88A 3RHZA 2Q4OA 1YS4A 2VFAA 2BMFA 1I36A 2GC6A 4MMYB 3DGEC 5E6UB 2I71A 5K8CA 1OV6A 3E9ZA 2GSDA 3D64A 1AS2A 2AKEA 1J90A 1VCHA 2LE0A 2BFBB 2WT9A 3UC9A 2AOUB 1SUAA 2B8NA 1ZFNA 3DNFA 4LXQA 3P2KA 4OBWA 2HBRA 2VPIA 3W8DA 4YDQA 3BTSA 3VZBA 5A6SA 4NCBA 2FF5A 2B69A 3OWHA 1EAYA 5A5GA 1KO1A 3GZ4A 1M1UA 4ROTA 4IVPA 2O3UA 2Q1TA 3ICPA 4QGSA 1MA0A 2HIHA 3BXHA 4CM3A 4TKVA 1QF9A 1SXHA 3FI9A 2WUGA 3HCOA 5AI4A 1X2BA 2GF9A 1QAOA 2X5KO 2CLDX 4BNVA 3E27A 4OHCA 1ISGA 4IRXA 1KTVA 2VG8A 3OUZA 3LWNA 4RV5A 1GT6A 1NMZA 1KNXA 2AXPA 1MW9X 2UVDA 4EX7A 1H4QA 3LRPA 5CGZA 2SKEA 4OKIA 1XZJA 1KU6A 2D00A 3CG4A 2D5AA 2XA9A 5IN5A 3K6JA 5BN4B 2Z83A 3D0QA 2DULA 3UGQA 2RGCA 1KVSA 2AFIA 3BJMA 4JWKA 1NXSA 4BX2A 4YXFA 1D5CA 2IYWA 2VJYA 1LQUA 2ZPUA 3AJDA 5EPOA 1BDBA 2O2EA 2WJIA 5EWMA 1TRHA 1O97C 3GMDA 3R3WA 2GN1A 1TL7C 4MB2A 4O08A 2YR0A 1QP4A 2R6R1 1K2WA 4GGPA 1E0JA 1ODFA 2ID9A 3L4BA 2B92A 1Y98A 1GZHB 2XNSA 1JDUA 5H1YA 3JRXA 1RC1A 1IBKB 2YV1A 3GYGA 1ZD2P 1RTKA 3ZLTA 5HG0A 1W30A 1YR9A 3ZCSA 2QBYB 1RCTE 4QOIA 1SOMA 3B8EA 4C2UA 1D04A 4NZOA 1F8UA 1ZA2A 1HDEA 4UCFA 2CXTA 4IWXA 4I1RA 4WLEA 3W6PA 1NVVQ 3VZQA 4YHHB 1HWYA 1C1YA 8MHTA 2GB4A 4GNKA 4JU9A 3KD3A 1SUWA 3JD3A 1XTQA 3NUQA 2NUTB 3SHTA 3DZGA 4DR3B 1ECBA 1E1CB 2MSEB 1X7WA 4O4HA 4RHEA 1RP1A 4HV4A 1ZH2A 4EI2A 3RS4A 3FJYA 5KCZA 5DI9A 1YJXA 1ZNXA 4L0DA 4Y2RA 5LBIA 3O4RA 5HA5A 4B45A 2NSHA 1TVCA 4KQCA 1ESEA 2DC1A 4FMDF 3HU1A 1ORHA 3TX6A 2O8CB 5HXAA 4KQFA 3BXOA 2OK8A 3G5LA 3DTVA 4ZCSA 4BZWA 1U8ZA 3R5KA 5CT5A 5CYFA 2CLCX 2ZSBA 1R4MB 3EGIA 2C5FA 3QVUA 5L8VA 1EE9A 1U8XX 3UXYA 4ZJUA 3IEUA 3PC7A 2OENG 1DQNA 3SX0A 3LVRE 3SC3A 4AVYA 4XRGA 3RQ6A 4H35A 3CONA 5DI3A 3A8TA 1DBPA 4GP6A 4YJDA 4OJTA 1T1RA 1CG6A 2G28A 2VT7A 5JD6A 4JELA 2FZWA 3PFIA 4GYKA 4CDGA 2CJWA 3SHWA 2ECOA 4DGQA 4L0CA 5K0FA 3O4VA 2OPHA 2QIOA 4ER5A 5IVPA 1PSZA 2BIFA 3DOOA 4FYHA 2YWHA 3ZWBA 3WSVA 4V0SA 2XW6A 3F98A 1F2TB 1Q7CA 1H05A 2UKDA 1NSTA 3PPVA 4J16A 5L7TA 4P0PB 3LQKA 5JYDA 3KQQA 2QQGA 4O1IA 1XAIA 2BGLA 2JK1A 3L7LA 3T7TA 2D2IA 2FMTA 2PBFA 1E1RA 5IF3A 5BQFA 1CY4A 1RKSA 2WYUA 2GEUA 1SFRA 1B1AA 3B1KA 4BLUA 2NP6A 2FMKA 5LMZA 4JUFA 4UBMA 2VP9A 1VOTA 2EP8A 2ZRNA 1Y9ZA 4KCGA 1Y4ZA 1EQAA 4INAA 1GNRA 4LI3X 2XUDA 1V11A 2SKDA 2XCLA 5EJGA 3NORA 5TR9A 2X7JA 4UD2A 2D0OB 1DUIA 2DHEA 4CW7A 4DHWA 1ZOIA 3C8HA 1R4NA 4ZU6X 2YS6A 3CSDA 4TL8A 1UODA 3A6FA 3OOEA 3AUSA 5G4KA 1HE2A 5M04A 3G13A 3NVAA 3UMFA 3ZXSA 1ECCA 2POCA 3H16A 3F5DA 3N5KA 4EM6A 5ES4B 2BI8A 4BQIA 3GJ0A 5JE8A 4DTCA 1KGSA 1U3WA 2PH7A 4PPNA 4I8IA 1E8NA 2X6RA 4H1VA 5EXXA 2JFPA 3V7FA 1Q0ZA 5CGEA 1KJYA 2VTVA 5CH3A 4ICIA 3OQJA 4HAUA 4C6RA 3ZE8A 3IUSA 2FE1A 4NL4H 1ELOA 1T1SA 5L7YA 4IYRA 2A1UA 3PEEA 3SNHA 3AEUA 2H8GA 3KPYA 4FGSA 4GZ5A 5C35A 1OY1A 5B55A 2ZJ5A 4JJPA 2NTEA 4YASA 2XMRA 3K32A 1IJKA 1N5IA 2A5DA 3W9SA 4BFTA 4CIXA 5HQTA 1HNNA 4MI3A 4LISA 4KVGA 3C1TA 4QGHA 4TRMA 1BAPA 1UMDA 1XN4A 4E1BA 4V38A 1T3GA 3IUYA 3NX4A 4GG1A 4RTJA 4O6VA 4JJAA 1UPFA 1V3TA 4C21A 1JFFA 3U3ZA 4F21A 4EW6A 3RCBA 2V55B 4JI4B 1G1AA 2V58A 4J90A 2R1TB 4QAJA 4FGZA 1WW8A 1YKSA 2BGNA 2P0AA 3EGXA 1RPJA 4IIHA 3SIXA 4C6TB 3D2AA 3AEZA 4K6OA 4D8TA 4JLVA 2ZYVX 2B37A 2I66A 4BJ1A 3O84A 1Y1LA 3UFXB 5CXXA 1MX1A 1H2FA 1Z2PX 4G9EA 1PJTA 5HRUA 1E1NA 2JBAA 2WWWA 4DV1B 1WMSA 3K1JA 4S1HA 1U6IA 3PE4A 3EXIA 4LRTB 2GEVA 2XMZA 1NYRA 2R8XA 4GVXA 5THKA 2WKRA 5F76A 5BSMA 4CMJA 4F6RA 2JJ8A 4RSRA 4LXHA 1JG7A 4NHOA 5HVNA 1FRQA 3LPLA 2AN1A 4Q9DA 4DTIA 1PZXA 2IPOA 3SKVA 3E0QA 4G41A 3KELA 3E03A 1K7CA 3DONA 5FOSA 1BOFA 3RBZA 4Z54A 4NMXB 1N8TA 2W37A 1KAHA 2IZZA 3GP3A 3KEFA 4FINA 5IKMA 2CT8A 1XELA 2ZJ2A 5KS2A 1QCCA 1D4FA 4QE3A 1XZKA 4XYEA 1WA5A 1CYDA 2IEBA 2I03A 4OUDB 5DSTA 3CEPB 3RB8A 4BATA 3MRVA 5THXA 5EP2A 2VOSA 2W6NA 5CGAA 3L77A 4BNFA 3AR8A 4MKGA 1BROA 1ZNYA 3DHVA 3FTCA 1WUKS 3AR9A 3DW1X 3PXUA 3RIHA 4E5KA 2QTFA 3VA7A 1SA0B 2XQJA 1Y9JA 3H5NA 4GPZA 3FSJX 4DZTA 3OX1A 1KZGB 1NF8A 3A4VA 1BNCA 1G55A 5G4KB 4M36A 1BVRA 2R8BA 1JU9A 4MARA 3KLBA 5DIFA 1KEZA 3A1WA 5ARCA 3CTPA 1K3UB 3D8SA 4YHBA 5FWDA 4DXHA 2ASVA 1KMMA 2LTAA 2YV3A 1II8B 1M8KA 3DE7X 4BRSA 1P29A 5DGXA 5DM0A 3SJCA 4Q00A 5EEHA 4HWRA 3EWMA 4GS5A 3LKBA 2F8SA 1UBEA 3H4TA 3W8EA 5KOJB 1TF7A 1G3IA 3W7VA 3WAKA 1IBRA 2ABWA 5ADUS 1Z6ZA 2DAPA 3GXBA 1UEJA 2FZGA 3OZBA 3RTEA 4C01A 2J3DA 5BY2A 5KMGB 1RJFA 2V98A 1SVMA 3BMCB 1E1RD 3AJ9A 3OIDA 4N6GA 2Z6UA 1QXSA 1KS2A 1YJAA 2C2GA 3IC5A 4XWOA 1YOBA 1NATA 1SBHA 4B6RA 3JULA 2HL6A 3FFAA 4DG5A 3W5BA 4U6SA 3R0VA 1U3TA 5EY5B 4L15A 1BU8A 2FPGA 4HBGA 2A2ZA 2BM9A 3ZYCA 3IKVA 2HCRA 2VZEA 2VDQB 1SHZA 2GJ8A 3CW8X 4C5LA 1PFGA 2J9RA 4LDRA 5AMXA 1JBKA 5D7NA 5FUBA 4M86A 4AWAA 2QP3A 1VDZA 2YFHA 2ZIWB 4MUKA 4WKCA 4BECA 4EVRA 1Y3DE 3Q72A 4Q82A 1YRYE 2YASA 3UJCA 1DC6A 1Z5UA 1WLSA 3NKFA 1U94A 3MB5A 1JSLA 1MENA 1O8CA 5HFJA 3QNWA 3KALA 4REQA 3U44B 4RGBA 1J6UA 3C5HA 1J8FA 3T1TA 1FPQA 4UHEA 4X6XA 4F6RB 2JFQA 4ZYYA 2ZJ4A 1N3YA 1O7JA 1A9XA 4I7EA 3GH1A 3I0MA 4D6PA 2BUCA 3OFND 2Q3LA 3HXPA 5B64A 3KOUA 4HGPA 1R8YA 1XXLA 3CXRA 3K8YA 4RAQA 5AHRA 4QDTA 4BNWA 5BMVB 2XZTA 4B40A 2RAFA 1D6MA 3TQSA 1NRJB 5DTEA 3KQMA 4CKEB 5LQRA 1X8JA 5GP1A 3N2IA 4U7GA 4UHBA 4KO2S 3PE6A 2WSBA 4LBVA 3LGAA 3E3AA 3OZWA 4G65A 4N01A 3UV6A 3W2GA 3WAJA 3R9WA 3GLUA 1R64A 2AG8A 2ORED 3JVIA 2YICA 1CV2A 2HWKA 5KVAA 1PVOA 5DLDA 2J41A 3CWZA 2X4GA 3LUPA 2XCUA 3ZVRA 4ZHSA 1TYZA 4KTVE 1KKLA 1V95A 1NZJA 4X7PA 1F1JA 2HJRA 3VQTA 4XIYA 2YVKA 3WLEA 3ZD8A 1A5ZA 2DCUA 2ZI6A 4BFZA 4Z51A 1YS7A 1NPDA 4JY7A 4V0QA 4EO9A 1AUVA 2BKLA 3TQRA 5LD2C 4TV8A 4XEUA 1BH2A 1W581 4KI7A 4CU5A 3RE1A 5G1PA 3H7AA 3RSSA 1H3NA 3AHFA 3BWCA 4PIVA 2IEDA 4OVKA 2GJSA 4MVJF 4NBNA 1XV5A 1F6WA 1Z5OA 2P9YA 3MILA 5DSXA 3WKAA 4BASA 4D0GA 4F45A 1U6KA 1PN3A 2VP2A 4GUDA 5DTRA 5A02A 3BRWD 13PKA 3CZAA 2DFTA 4BMVA 1QC5A 4DZRA 2Y68A 5IBCA 4HXGA 3MD0A 2I6QA 2G70A 3ESQA 5JPIA 4CETA 3BWEA 5EXEA 2H1HA 4Q3CA 3KAPA 1H2HA 5K0GA 1GSIA 2C5AA 3FHTA 3RS5A 1YDWA 2FPGB 3DVLA 2DP4E 4AJPA 3ABRB 3GLRA 1Z47A 3EDYA 3IDOA 1Y8RB 2HHAA 1EVIA 3AVQA 4I14A 4S1TA 3HGQA 2QQFA 2F6RA 5EIEA 4FFSA 4MWTA 5B1YA 4KXWA 4B79A 3RLFA 3O47A 2NSDA 3HHPA 7MDHA 4B8ZA 3OE1A 5F1OA 2IUUA 1HXHA 4C0HA 4MYHA 1SUBA 1KJ9A 3K0FB 2IIQA 4H7EA 1YR3A 5IDYA 1P1KA 2YN4A 3LLUA 3WE7A 1FSZA 3WGVA 2SBTA 3SXUA 4B0OA 3U61B 2WZQA 2C1ZA 3CF2A 4MKFA 1CT9A 2HBQA 1DWOA 1PKEA 4RLSA 2A5FA 1IJBA 1CNFA 2DLCX 1OD6A 5BV8A 1P0IA 3EVZA 2ZB2A 3HNOA 3K0KA 3QRWA 4LJLA 1JBQA 3Q40A 3EAGA 3ICCA 4PXYA 4WOCA 5EP4A 3VYSB 3HO1A 4DN6A 4KWTA 4YROA 3MHTA 2IQIA 4LTDA 5KJ1A 2ZT8A 3HYLA 4B3XA 5JMWA 1EUYA 3A2KA 2NGRA