3RU3A

Crystal structure of tm0922, a fusion of a domain of unknown function and adp/atp-dependent nad(p)h-hydrate dehydratase from thermotoga maritima soaked with nadph and atp.
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
489
structure length
489
Chain Sequence
MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRLIPEAIRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of unknown protein function using metabolite cocktail screening.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Lyase
molecule keywords Putative uncharacterized protein
total genus 179
structure length 489
sequence length 489
ec nomenclature ec 4.2.1.136: ADP-dependent NAD(P)H-hydrate dehydratase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01256 Carb_kinase Carbohydrate kinase
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 3ru3A01
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3ru3A02
3NC9A 3RM5A 1GQTA 3NL3A 2ABQA 3LJSA 3N1CA 1TZ3A 3IBQA 4K93A 1RFTA 4XCKA 1KYHA 2DDWA 3RO7A 3DRWA 3B1NA 3NM3A 5TQIA 4EN4A 3B1PA 4KAHA 3D3KA 1LIJA 3RTGA 2R3EA 4LCAA 4K9IA 4S1IB 2PKKA 2C4EA 2JGVA 3BF5A 3ZS7A 4GM6A 2C49A 3KZHA 1V1BA 2AJPA 1YGKA 1VK4A 5COJA 3NBVA 2AFBA 3IE7A 3VAQA 2DCNA 2HW1A 2V78A 3IQ0A 4YWRA 4DC3A 3GBUA 4LC4A 1YHJA 2AJRA 3HPDA 4E3AA 4E8WA 3UMPA 5EYNA 3RQHA 3Q92A 2AA0A 3RREA 3RQQA 3W4SA 5BYDA 1LIOA 3HICA 1WYEA 2XTBA 3RTAA 3QAIA 4S1IA 4LBGA 3RQ8A 4EOHA 1BX4A 3B1QA 4N08A 3KEUA 3RQ5A 1JXHA 3KTNA 2A9ZA 3RO4A 3KD6A 1ESJA 4DU5A 3RSQA 5C41A 2O8NA 2QCVA 3IH0A 2RBCA 3RS8A 3LKIA 4E69A 4C5JA 1GC5A 3PZSA 2F7KA 3RTEA 3NC2A 3B1OA 3NL6A 4B8RA 2I6AA 2ABSA 4K8PA 5B6AA 4UBEA 4K8TA 4KANA 5C3ZA 3LOOA 1UA4A 3DZVA 1VI9A 4E8ZA 5CGEA 1RKDA 1V1AA 4K8CA 4XDAA 3QA2A 3RU3A 3BGKA 4PVVA 3MBJA 3UQ6A 3D3JA 3IN1A 4B8SA 4C5NA 4E84A 3Q1YA 3ROEA 1JXIA 5F0ZA 4EBUA 1TYYA 2VARA 5BYFA 5CM5A 4C5MA 2HQQA 4N09A 4EUMA 4JJPA 1V1SA 3RT9A 1EKKA 4O1GA 3RSSA 1LIKA 3H49A 3NL5A 5CGAA 2PKNA 3NM1A 4WJMA 3OTXA 2A9YA 3RTBA 4KALA 3MBHA 3RPHA 5BYEA 2I5BA 1JZTA 3B1RA 1VM7A 2HLZA 2PKMA 1TZ6A 2YXTA 1LHPA 2YXUA 3UMOA 3H74A 4K8KA 2AB8A 1RFVA 1RKSA 3RSFA 4U7XA 4JKSA 4KADA 2FV7A 4O1LA 4E8YA 3RY7A 5BYCA 2F02A 3UQEA 2I6BA 1RKAA 3ROXA 1U2XA 3HYOA 1EKQA 3B3LA 3K9EA 1YGJA 3IKHA 3RQXA 2DDMA 3ROZA 2Q5RA 4X8FA 1ESQA 5TRWA 3RTDA 3RNOA 3EWMA 3K5WA 4K9CA 3RSGA 5F11A 3RQ2A 3FHYA 3I3YA 3RQ6A 4XF7A 4C5KA 1TD2A 3JULA 3NCAA 3RRFA 4XF6A 3UBOA 1LIIA 3LHXA 3RTCA 3RT7A 2R3BA 3CQDA 4KBEA 3NL2A 4C5LA 2QHPA 3VASA 2NWHA 5C40A 1LHRA 2JG5A 2DDOA 3GO7A 1V19A 4LBXA 1C3QA 1DGMA 4S1MA 5EY7A 3GO6A 2AX3A 3RRBA 2JG1A 3ROGA 4YL5A 3RU2A 1UB0A 3NBWA 4S1HA 3RPZA 2AWDA 3RS9A 3PL2A 5C3YA 1RFUA 3RRJA 1L2LA 3FHXA 3UQDA 2DG2A 1RK2A 2PKFA 4JKUA 3UQ9A
chains in the Genus database with same CATH superfamily
3F47A 2EJUA 3SMQA 2CVHA 5CXQA 2GKGA 2FRDC 2NU7A 1OA1A 3I9V6 1ZN2A 3N1CA 2HMTA 4R7TA 4WJKB 1YASA 3DOIA 2M9MA 3MAJA 4X1OA 1KXZA 1XP5A 2FETA 1ZMOA 3GRYA 2HA5A 3WK5A 2FW8A 3L93A 4DLLA 5D6NA 1UZUA 4PS0A 3R8XA 1U1IA 3HCRA 3TXXA 2O2XA 3RD5A 1Q3TA 4ZVSA 2WJAA 1XHLA 5DTIA 2P0YA 2OZLA 5TPWA 1XB2A 5C7OO 1J49A 3K0BA 4TMFA 1BFKA 2J31A 3E8SA 3WFIA 3RYHB 1FFHA 4BAZA 4DABA 2E5LB 5A02A 2WM8A 1Q6YA 4EPWA 1NRIA 3CO0S 3HA3A 1E1NA 4HPXB 5F1OA 1YSCA 2RK4A 4D4HA 1X9IA 4QECA 4RPIA 5FNVB 4NZMA 4EG0A 4QODA 5ENZA 1V25A 3HSKA 5EP4A 3ZXUB 4RORA 2RGXA 2RGAA 3QKRB 1KKUA 1G17A 2RDMA 1FQKA 1Z4JA 5C18A 2QW8A 2VYCA 3OTQA 3OCYA 5EHZA 3IAM6 1D0VA 1DOHA 2IOFA 4ETNA 1KHHA 5AYVA 2XHZA 4PLVA 1VLQA 3PYLA 4ZC1A 1Z17A 2GFIA 4OHBA 2V0NA 1C81A 2ANBA 1Z82A 2D4HA 2F1OA 2XE4A 3DAHA 3G2PA 4NECA 4PLWA 4TRMA 2AI2A 4TPKA 2GYWA 4UC0A 4XWGA 3VKWA 3ENKA 4P53A 5CGEA 1SOAA 3IAXA 4Q7KA 4KRGA 4BVGA 5K0FA 3UYLA 1KP2A 4RZIA 2X6RA 2O7SA 2DWCA 2AG0A 2OAEA 1DV1A 2W2TA 1AN9A 3PXCX 1N33B 2A3NA 1RWQA 2ECOA 2RH5A 2FW9A 1O94D 2Y05A 2QTRA 3UQYS 3VC1A 1U2ZA 1YOVB 4YWJA 3HO1A 3NL5A 1W5BA 5I7EA 1EG7A 1HT3A 4XQGA 3P2JA 4YUWA 5ALSA 2C5BA 3FTPA 4PLYA 5E4JA 4LX8A 3LBNA 4RPJA 2I2WA 3I9MA 3JZMA 3ZC3A 1XOIA 2KM1A 1RZ3A 4H3HB 1ZLXA 3WLEA 2NTYC 3G8CA 4Y0NA 5CLIA 2BRUC 3S5UA 4TVKA 4HH1A 3VU3A 4GOXA 4DA7A 3O8RA 1CCWA 3F1KA 1OTXA 3QKSA 4WY5A 3R8FA 3RC7A 1MLDA 1K89A 1RC1A 3ZLTA 4DLSA 3PWTA 2I3DA 5M7EA 5DHUA 4RVSA 4GS5A 3PJGA 2HLDA 4FI3F 2R44A 4K87A 1B93A 3OF2A 4JQYA 4CDGA 3URKA 3I3YA 5AW9A 1J0XO 1UP7A 4LRSB 4Q4JB 4WUVA 5KU7A 2JH9A 3CX3A 3IKMB 1USKA 5E2AA 5KKNB 4FYWA 4Q05A 5JMOA 2HWUA 4DIKA 4AX8A 2M98A 2UZAA 1AF4A 4Z4QA 2ZR8A 5BV1A 1K8ZB 1Y7TA 4IZHA 3AM4A 1M83A 1M2FA 3DTYA 2P41A 1RM3A 3C5EA 3H2YA 3P9ZA 1DEKA 1RQPA 1KBQA 5A5EA 1HK7A 4KLAA 1QAMA 3IP7A 4I14A 3OFNA 4NOKA 3WICA 1A9OA 3U17A 2CJFA 1KY5A 4RZUA 4WL0A 1EVLA 4M53A 1JHMA 1ZVMA 5ESXA 1BZYA 4JI2B 3R0XA 4X62B 3NHUA 3TIFA 4WBSA 1D2RA 1M73E 1OX6A 1T0UA 1AKNA 3C3WA 4UM9B 3QEBZ 1WB6A 2XRZA 4I8IA 1GKLA 5KJCA 3VHRA 3C1UA 4OQFA 3GT3A 1BS1A 1YGYA 2CL7X 3KOYA 3FDXA 3VR5D 1RBQA 3M82A 4P93A 4Q4LA 4YRZA 1EHYA 1JDZA 3LOUA 3AM1A 4CKEA 1II8A 4TYWA 4CQLA 4EJSB 1KJIA 2B9EA 5DDIP 1NVFA 7ADHA 4L15A 2VJBA 1W6RA 2HR1A 3PC8A 1Z16A 1RYBA 2GCEA 1JSXA 2H59A 2FK8A 4UMVA 1TAHA 2GERA 2LGJA 3UH1A 5L3VA 2ZSIA 2AJLI 4FCWA 1W30A 3D64A 1FX1A 4LJSA 5GWXA 3RSOA 4WRRA 4ZEMA 1QU2A 1RI5A 1F4VA 1E2FA 1EM8B 3TRFA 5T64A 5B4VA 3QSYA 3D6HA 4DV6B 3V7NA 4QO7A 2OLJA 1LGYA 2ZYRA 4R2LA 2QD4A 4B87A 5K0TA 3ZHYA 1FFGA 2BVNA 4MUGA 4QDXA 4XQ0A 5H80A 4EJ6A 1JYFA 4BFCA 2VOEA 2Q5HA 4K0KB 4UNIA 4HLCA 1NNLA 5B53A 1C9MA 2GLUA 3BWBA 3NL6A 5BMVA 1I13A 2HPAA 1T5TA 2VCHA 5H70A 2B36A 2Q5OA 4R16A 2NV2B 5LWHA 1EDBA 2GXUA 1VLHA 2QP4A 1E2NA 2X23A 3DMTC 3EJWA 4FXOA 5CLFA 2F48A 3A2NA 2C84A 1PVVA 2WILA 3KHSA 5FBZA 4E5NA 2DU8A 1ZZGA 2VTBA 3N39C 3AUYA 3H9UA 4RD3A 4WXMA 1XTRA 3OZAA 3SF0A 4EAAA 3BHJA 4EYGA 3H4MA 4D41A 1S02A 2ZPUA 1XTTA 1LPBB 2Z58A 3AI7A 4IJMA 1SU8A 1GN8A 4LOAA 5IVDA 3GEEA 1L4KA 1N2SA 1RLIA 2EKDA 4QX6A 3U61B 1SRQA 5AKZA 2HLZA 3ANMA 4QGHA 1XTQA 1YT5A 2I5BA 1CIPA 1RQLA 5TS2A 3ZJ4A 3ICEA 1VDZA 1HDXA 3CSDA 1N32B 1OH8A 5JPDA 2WSLA 4LXYA 5I9MA 3W06A 1ZH4A 4BMNA 1T3LA 2VYVA 2QL6A 3VU0A 3ZLBA 1J9ZA 1FJ2A 2EG5A 3NGXA 4IQ0A 2HN9A 5LZ8A 3UG6A 4C20A 4ZIRB 1PK9A 5AVSA 1VSTA 1JKIA 2WJ3A 4JLPA 1G63A 4I50F 3FCCA 4XDYA 5HRUA 2I2XB 4KZKA 5EJ4A 3O3NB 4FEGA 1CEQA 2TRSB 4RO0A 5CH8A 4S1OA 3WMRA 5IC4A 5KMGB 4KPFC 3HABA 2B6HA 5DTMA 5ED4A 2HMYB 3H5RA 1TGVA 3DYBA 3HP7A 2L42A 2WUVA 1O3YA 1RRMA 3EIEA 3GCGA 1ULSA 1V1RB 4LRUA 4OXQA 4B35A 3QBJA 1LHRA 2ZU6A 1W93A 1XQ1A 1N8SA 4MRMA 5LL6P 1YFJA 4PSKA 2NO4A 2XZPA 1JAHA 3OECA 4Q4HB 4RYLA 5AXAA 3VYRB 2XYHA 5IS2A 2ZS9A 4J0DA 3ESXA 2ZI9A 3ENZA 4JJ8A 5E8RA 2XJ9A 1W9MA 4ND5A 2PH5A 1TJ4A 4TLDA 3QKUA 2D0IA 1E1KA 5K99A 5CH3A 1ZVJA 4QHTA 4B6PA 4W9NC 3G68A 5JY6A 2FW6A 2IFTA 4I4TA 3GMDA 5CUQA 5FPQA 3TK1A 4OUDA 2OGZA 4L78A 2IV3A 4GKJB 3GGSA 1I9CA 1JR2A 1YCFA 1JR4A 2YZ2A 4DUZB 1ZRSA 1EYZA 3IAUA 4KO8A 1UMCB 3BWDD 2G5GX 4LV6A 2NO6A 3TGLA 3TL3A 5I9BA 2FZEA 3QTBA 4WCDA 4CL2A 4A16A 2PS9A 5JTTA 4AY6A 4AAYA 1R8JA 4DV2B 1K2WA 2XR1A 3CBGA 3H7AA 3VR4H 3LT0A 2VYND 4LGVA 1Z35A 3VR1A 4D9HA 1QHEA 3L0IB 1QDEA 3MTEA 4EP1A 1WIWA 2NVUA 3NEYA 1M6VA 4F1WA 3RVRA 5JXHA 2DLCX 1V6AA 5AMXA 1PR3A 1E4VA 1ZK3A 2QN9A 1R18A 2WNSA 1E63A 1KFKB 2VNSA 3JQ9C 3BC1A 1ZOSA 4JI5B 1AKYA 2HU8A 3K2IA 3UENA 2QRNA 3AUFA 4L6AA 3ZVMA 4G5YA 4N03A 1UJMA 1ZAKA 4AQYB 1MFZA 2QRHA 1WWKA 1G4HA 1U0OC 3DPUA 4G86A 4ZKDA 1IBKB 1JAZA 3UOWA 1ORDA 1CJBA 1PZNA 3BL6A 4H18A 1O58A 1H3NA 1Z4OA 2HRQA 3M9LA 4KCGA 1RZUA 3OI7A 1R9MA 4ILKA 4QASA 1L5NA 4URHA 5GIPE 3KEFA 4MQ5A 4X7RA 1AB6A 1T2NA 3JXEA 4Y6SA 3KL2A 5U4XA 3W79A 3WQQA 2PLFA 1D07A 2PUFA 1D8AA 4OX9Y 1TL7C 5ER9A 2C5AA 3P5BA 1KVRA 1LRKA 2BEWA 1NONA 2GVZC 2P9EA 4BRUA 5B57C 1NI4A 2PCLA 3H9BA 1GPAA 4AUEA 1G55A 4KKVA 1JHRA 4R9RA 1H2RS 1DIHA 3GV0A 3FSGD 5FJJA 4BDSA 1DVRA 6AT1A 1Q15A 5FH9A 3KZCA 2B1QA 5JCPA 2IV2X 3C8HA 1L8QA 2HW8A 4UVEA 1IN7A 2YXTA 1GPLA 1KJQA 1SIOA 5HR5A 3D8TA 4YLEA 4EITA 1UC5B 1QQAA 4JCOA 1ZJ4A 1DV2A 2BDTA 2HCFA 5CVDA 3PK0A 5TQJA 2PUBA 4YMHA 2H18A 2Z8YM 5D5HA 1TM7E 4MITA 4XIIA 1KMQA 2DPMA 1E7RA 1PW5A 1FW6A 2WQ7A 2IHBA 4M98A 4RM3A 2EBWA 5CLQA 3IP3A 1MCZA 1K5PA 1WAMA 2C4MA 1O0SA 2JFVA 4C07A 4DA6A 5AUPB 5KTRA 3IKHA 3CKYA 4DM7A 4Z4GA 2KB0A 4RD4A 1GY8A 1BQ3A 1NN1A 1LDNA 1S2MA 4FHCA 4REQB 4DCMA 1W88A 5JCZA 2HZBA 4X64B 1Q21A 1Z06A 2WD7A 2YICA 3EQ2A 3E0XA 4MW9A 3MWDA 2EFEB 4K6HA 1XYGA 4ZDWA 2VHWA 2AW5A 3O4HA 5DZSA 5BV7A 3NCAA 1MJHA 1V4VA 3F4BA 4RD1A 1A3CA 1K8RA 2P9BA 3N7TA 3B6KA 4XFKA 3VASA 2YWFA 3UBMA 1BDIA 2H2HA 1GRNA 2E4AA 1COWA 3STYA 4YUYA 5B30A 1BX0A 4CMHA 1F6BA 3L0SA 3W3AA 4NENB 4AVYA 3G0HA 3RPZA 1HWYA 4FE4A 1BGWA 1T0JB 3KEQA 4Y1RB 1OYOA 4ENWA 2QTZA 5KVCA 1M5UA 1MAHA 3SX2A 2IHNA 3FPEA 2C5EA 3HEMA 3MMXA 3UC5A 5KJFA 2PMFA 2QDXA 4C0XA 1TRHA 1SU4A 4WZBB 4C01A 1RKUA 3FGPA 1S7CA 2BEUA 2FW0A 5HFNA 4YJ3A 2GJKA 4IO0A 4RVCA 3QLUA 2VDVE 2UYGA 3PE6A 4RGVA 3EZXA 1BEUB 4GG1A 3QNWA 1Z45A 3UG7A 4KQGA 4ADSG 4UTVA 4LOJA 2QRLA 1M6VB 1L5YA 3CLTC 1AXRA 1XRRA 1TT5A 3PGKA 3R0ZA 4FDMA 7MDHA 3GLHA 4Q82A 1GXSA 3LDUA 5ISMA 5GAJA 4AU1A 3TYXA 4WN3A 4KAFA 4N8DA 2OB2A 3H5WA 2PL9A 1LBHA 1PQ4A 4MCAA 4MQUA 3IQ0A 3FOAA 3TDKA 1GZHB 4CMEC 4L4RA 1QZTA 3E7WA 1O9GA 3NBMA 3RANA 3PVSA 2L18A 3M89A 3PFGA 2BHSA 1HQKA 1P1BA 3V1LA 3TI9A 3FCYA 4B4WA 3VTKA 3K05A 1VKJA 3BS4A 4KI7A 4MINA 5DGIA 2OXIA 4MR9B 1JXHA 3DCIA 1XRQA 4CFYA 2GZHA 3QI7A 4FUTA 4M8SA 3AF2A 4RMIA 4XA8A 1J21A 1OBFO 2IPOA 4LHYA 2H4WA 3OQPA 4EGJA 2CHGA 3FGNA 2GAAA 5DBOA 3AZPA 4CPDA 2WLTA 5B3JA 2YQZA 2D06A 5AI0A 4BX9A 3AHJA 1FMLA 1EB8A 1UBLS 4JJ4A 4MAAA 3U3XA 3UAVA 2J4DA 3KTAB 3PNVA 1CFJA 2CDBA 4ESVA 4Z7JA 5AVVA 2VHEA 4P84A 3D3NA 3ZU6A 3VR6D 5CFLA 2FMXA 1QO7A 3HUDA 1SCIA 1KEVA 2PKWA 2VOJA 5KDDA 1GUDA 4ZRDA 1ZK0A 2AM2A 4EHFA 3SEZA 4P3KA 1BMFD 1YZUA 1AV7A 1KK3A 1UBRS 2JEYA 5HQTA 2A57A 3O0TA 3OOHA 2F4NA 5E6UB 4MUAA 4Q3KA 2QZ9A 3RPHA 1RIFA 5BYEA 3V46A 1VHTA 5DM4A 1U2DA 1PG0A 2W2LA 1P7YA 5ELLA 4DSTA 5EJ2A 2C7PA 2MIIA 4CLHA 1JFSA 1S8NA 3RVBA 5KEIA 5JJIA 1UXHA 2I1VB 2WD7B 3X1YA 4GXTA 3QZUA 4NS1A 4ZDJA 2P2SA 1V8DA 2R2GA 3IPAA 1PEAA 3BX1A 5JMWA 3SHOA 1QCYA 1JN0A 3KLPX 3UMRA 1O95D 4HDKB 4ENTA 1B73A 1ILEA 3CTPA 2XVYA 2XUDA 2UUOA 1E9BA 2BZSA 1JA9A 2VNAA 1WCIB 2BSXA 5JAUA 1Z6XA 2C77A 2OV4A 4JB2A 1O95C 3OMWA 5JU6A 3I45A 2DSTA 3PQCA 5BNIA 4CUKA 4XCVA 3VISA 3OLVA 2B82A 4NK5A 5ERYA 1WW8A 3QU2A 5JS8A 1ZM3A 1ILWA 2YJZA 1YZLA 1JU9A 5CLLA 1WUHS 1TIPA 2D1TA 4HJRA 4KMMA 4Z7NB 2CLCX 2QP9X 2GCPA 2BE9A 2C3YA 3JQFA 1J99A 3CURA 4ZMSA 5E9QA 4HKTA 5AVZA 5M04A 4KR3A 3SQXA 1ATIA 1DADA 4A8TA 4LIPD 4OHMA 3ZEIA 2B3TA 4QU0A 1U90A 3IV6A 4XE5A 4D9KA 3HKCA 1T3HA 2OO5C 4W7HA 1G21B 1QJ4A 3ST7A 1P4HA 3FCOA 1Q50A 2P2YA 4PLTA 4BQSA 3EZ9A 1XDUA 1G2PA 1XRNA 3IJPA 5BN5B 4DDUA 4V1CB 4PX9A 4U6NA 3T0FA 1TDJA 3QKRA 1SXJB 3ND5A 5CA1A 2GCGA 1T8YA 1QONA 1YV9A 2IYXA 2ZXFA 1EJ0A 1F51E 2VZ8A 5C1IA 3W4JA 1HYQA 1NA5A 5FOXA 2XB9A 4KTVE 1CIVA 1OWLA 2FJ0A 4ILEA 5L3RA 3RAFC 3MGBA 1DTEA 2B8JA 4X0EA 1RXYA 4BMDA 3EWSA 3UHPA 4BEBA 1TZCA 1P5JA 1NPYA 1F8YA 3FBGA 3WP1B 1ZWKA 1DARA 3F5FA 4BYGA 3K35A 1SUAA 4U7JA 1WR8A 3I04A 2ZRLA 2MSLA 3L43A 2Y1CA 2Q0XA 2VAMA 3EN0A 1E1RA 2ON6A 3G02A 2L69A 4RACA 5T57A 3WB2A 1SXJC 3L05A 1KTVA 3GHHA 4YYEA 2P1RA 1AQNA 1NI5A 5F7XA 1CUCA 4NHOA 5FUWA 1DQRA 4EGAA 1B43A 2EHJA 5EPEA 3U7FB 1QKJA 1J8YF 1W0KA 1XQYA 1A50B 2CW5A 3RC9A 4IXDA 3GL9A 3TLMA 3W5UA 2IP4A 3I73A 1YOVA 2V58A 1Q1EA 3PUZA 4JHLA 4NYMR 1JIXA 1PGNA 1OX5A 3RS8A 3NPAA 3E82A 3RWMB 2YY7A 4CQNA 1SELA 3EZ7A 2XODA 1ORHA 5EIXA 1RQXA 3B12A 1RQRA 2O6LA 3LSYA 1G20B 3P27A 3S68A 3SWWA 1AXEA 2C4VA 4DIOA 2X5JO 1L5OA 3NHMA 3WB1A 2DT5A 1Y3FE 2YL2A 5H68A 4H17A 4QPJC 4CM8A 2P9CA 3B9RA 1E99A 4FWBA 4MV7A 4OFBA 1VHLA 3U7GA 4LYYA 5CM8B 3OTIA 3K09A 4UAGA 3R4VA 4ZZ2A 1VDMA 5ECGC 4CU2A 3RK4A 1LXCA 2ERCA 2H7YA 3H8WA 3S5JA 4HUTA 2R66A 1E77A 3KQTA 1JMYA 1YDGA 3AEQB 2Q5EA 4D57A 1MR3F 1CY4A 3ELWA 4GOKA 1FDUA 2I71A 1Q7CA 1DMSA 1UT8A 3D5EA 4YROA 1AKMA 3DKIA 4BVFA 3RUPA 3Q15C 1QQBA 1PT5A 3ZWOA 2RE8A 1KDVA 4O6VA 3FNBA 2JJYA 4LQCA 2CL0X 4D9BA 5CG2A 1T35A 1M2JA 3QITA 3AEXA 2VF4X 5KYXB 3WAGA 2J5XA 2V7UA 4HWPA 4DQUA 5TDHA 5EFZA 1BXGA 2AYZA 1AK9A 3QPDA 4NE7A 3F78A 5H3HA 4EEKA 2G3YA 3B3LA 3KQPA 4AECA 1MN6A 1XD8A 3K71B 4A0GA 1Y6FA 1SKYB 2BF7A 2W6ID 3OU6A 1TMYA 3OT5A 2DQKA 1XF9A 4QWWA 4UUMA 3CG0A 5DNAA 3C1OA 4J16A 3AI1A 1QE0A 1G21A 1JG2A 2EZ8A 4M49A 2XCTB 5BV0A 3WGUA 4G26A 1NVUQ 3EOAI 2GASA 4MV4A 2P3SA 4BO0A 1G3QA 4UU7A 4WA8A 1Q1NA 2P2DA 1J00A 3GT7A 3TOZA 1LW7A 2I6TA 4KRYA 1YZYA 1MEOA 4KO2S 2EDCA 3OJLA 4PLGA 4PM4A 3I6ZA 3UMCA 4IYJA 3FOFC 3K30A 4F91B 3RROA 3ZUPA 2ZVQX 2FP3A 3CLHA 3HE3A 4MGZR 3T3NA 4MYSA 1C8KA 4OK3A 5CNKA 3K15A 3ZKAA 1FYDA 4LFBB 3E6AA 3KSMA 2VZ9A 4BPBA 5H7XA 2P5UA 2XV1A 2XWSA 3ESRA 4UAUA 2VDRB 4BMPB 1ZIOA 4G1MB 4NJMB 5DHRA 5IUJC 4CM3A 1JDBB 5F64A 3ORHA 1ORRA 4KWEA 1ABBA 1Z0DA 4QM6A 1MTOA 3CXUA 2FWRA 1U5CA 4UU0A 1LIJA 1X70A 3FWKA 2HV8A 2XKKA 4MUBA 4X6XA 4R2IA 3DR5A 13PKA 5D5PA 4AS3A 1VSQA 1P9LA 4R8VA 2AMLA 4A0RA 5B2FA 3TPCA 4TN1A 2PFGA 1T3TA 3K1ZA 3THYB 1SIWA 1NW9B 5A5DA 3U62A 1CNEA 1NQVA 2VDUE 3U3OA 4XM0A 3B13B 3JR3A 1QDUA 4M1OA 3IJEB 4Q6BA 1NR1A 4HTFB 2Z1NA 3IVXA 2B21A 4U9UA 3RTAA 3UGTA 3ZVLA 1KVUA 3H6HA 2XJ4A 3WLKX 4UHEA 2HXGA 2FAXA 2DQZA 1ZGCA 1K3UB 3K53A 2WF6A 4QSMA 3JQFC 3FNQA 2Z2YA 4QOSA 4ZAZA 1GQOA 1H3FA 2E21A 4BO3A 4MPDA 1WKCA 3HN6A 3DP7A 2FK7A 1XEXB 4PTZA 5JVDA 2WWIA 1QHYA 3DYVA 2BZ1A 2I9KA 2ZVJA 3OZRA 3ZHXA 3BD8A 2HYIC 5HUQA 1RD4A 3H18A 3COWA 2X9NA 3DLAA 4KUEA 1IN4A 4GNKA 2FPIB 3PNKA 4ZIRA 2P77A 2ZTUA 4M4SA 3ZQ6A 1YFLA 1R6VA 3CKKA 2DWQA 3FHCB 3W6NA 3QOWA 2PZMA 3LH5A 3RSLA 2G4VA 3ZCXA 2CSUA 1P9WA 4ZYYA 4E88A 5L51A 3OZIA 3JASB 2DJ5A 1I0LA 1MO5A 3J7TA 4IL5A 5AKYA 2H9AA 2V7VA 1GILA 2WQZA 3RBXA 1Q20A 3WZMA 1YA8A 1GGKA 2WYOA 2IF2A 1YCHA 4ZO9A 2XEDA 2FWJA 4QYWA 3ZGVA 2PTHA 2J6HA 5FHQA 1RTKA 2GK7A 2CJWB 3D4PA 3GJ3A 1RHMA 3H6GA 5IK2D 5KYWA 4EN4A 4ZALA 3QCZA 3P32A 1GAQA 5ENDA 4MV6A 1U2EA 1XA3A 5B2EA 5CYGA 2YXPX 1NM5A 4Y2TA 4EY5A 3KK0A 4RULA 2YXBA 1KFBB 1G3RA 3W8DA 4FDUA 2IUUA 2H57A 3H13A 4ZXFA 1T34A 5BQOA 1NX9A 3CFYA 3SX4A 5TRTA 4X8FA 1XZLA 4W5JA 4XARA 4BS9A 3R7WB 4QBGB 2EU8A 5K0EA 1NDUA 4L7QA 1FFDA 1WKVA 2UAGA 4JU8A 1BS9A 2COUA 2ALJA 2NUAA 2PH3A 5AW7A 4D9JA 4J7UA 4O4IB 3SC3A 1DIAA 4NJMA 1Q95A 3KB6A 4BBAA 1P2VA 3LFUA 4MAFA 4WDQA 3THXA 1UBJS 4D2IA 3OZFA 4D7AA 5LJIA 1Z63A 1R88A 3THSA 1BJKA 4MGIR 3QPVA 4EA8A 4EHIA 3DWIA 3C3XA 4HL6A 4N5LA 5C5CA 4L8GA 4EA9A 4QZVA 1R00A 2Q3LA 3PCTA 2FEXA 2BEVA 5HFJA 1F2TB 3TINA 5G3YA 1ENOA 1H65A 3Q41A 1YR6A 4GKVA 1F9EA 3DOOA 1QOQB 2OV8A 3THYA 5JH7F 3VVBA 3USCS 2ZEJA 3TRJA 4DC1A 2VJLA 4HT3B 2X7JA 3IYLW 1Q3KA 4XFDA 4YRJA 1CEXA 2N0SA 4OD0A 4H60A 3DL7A 1KAOA 1TNDA 2WINI 4FC7A 2QRJA 4TXHA 3W7VA 2ATVA 5KYUA 4F5EA 1WUJS 2VWGA 4ERNA 2FPGB 4M0KA 3S2GA 1VB5A 4ZT4A 4BNIA 2JLZA 4TLMB 2IBSA 4HH4A 3L8ZA 5IWCA 3CGGA 1XCLA 1Z8HA 3EFHA 3VSCA 3EZNA 2VBIA 4IR7A 1RABA 4PTYA 3BJRA 2ZUFA 2H2AA 1UWCA 2Y6UA 4IXWA 3SJAA 4DB4A 2A88A 2FFBA 1PD0A 3C43A 2FY8A 1KFJB 3L8HA 2E48A 5BSTA 4DG8A 1EINA 2IBTA 4PX5A 2XT6A 1YAHA 2O3SA 4E5UA 1I94B 2E7ZA 3DNPA 3LZ6A 2D1QA 3B8EA 4CHGA 4PINA 1A4RA 5JI2E 3Q85A 1JEJA 2GRJA 1BA2A 1TGYA 5EE1A 5EKSA 2AOXA 1PLJA 1K4YA 2P9YA 4O4JB 1AHHA 5HBGA 4B8RA 1N5MA 1RYDA 1U3WA 3R09A 3RVMA 5FJIA 3U81A 2C31A 4MPTA 2GCBA 4B3GA 3SBXA 1JJ7A 1FRFS 1U81A 5DLQC 1SG9A 2E5FA 3INRA 1CQJB 2ACEA 1ZCAA 3ZI7A 3WHIA 4R7ZA 2I80A 3JYHA 4GOLD 1RWVA 2Q1YA 3CSSA 4BTVA 1ECFA 4ENSA 5H4GA 421PA 4FUQA 5LOVF 2GILA 3Q8MA 1V5IA 5KJEA 1OB5A 3FOEC 3L4BC 4JLMA 2RARA 4J3FA 5DWVA 4LX0A 3D1VA 4C0JA 1NC3A 1DWQA 1JVSA 1H8HD 3LUHA 1DDIA 2FQQA 1U9IA 4L5IA 5TVKA 3O8QA 2HO4A 3SXJA 3MWDB 3F7OA 3V4FA 3NATA 3TB6A 1WZ2A 3OCCA 4AP9A 2I2AA 3NM6B 3MBHA 4RUKA 1VHWA 3GBVA 1MP0A 4HEA6 1GPUA 4BLUA 2UVPB 3FG9A 4D0RA 3V00A 4LS3A 4NI5A 4WBNB 1AKVA 2QR3A 3PG5A 4G1FA 4C6TA 3AR8A 2NZXA 4EF6A 2C3UA 2FV7A 1E0SA 1KH2A 4FBGA 1SD2A 1PZHA 5CVCA 2X5NA 2LCIA 2PD3A 3EMDA 1W34A 3QFFA 1I4OA 1RZRA 4LDJA 3PEEA 4HYEA 4OHRA 5B36A 2IX3A 1P17A 2WC1A 4KGXA 4D3XA 1S2DA 2KW5A 4Q12A 1PYDA 4YJ3B 3AHEA 3FOWA 4AIRA 3OFVA 2J3QA 3I37X 4OVKA 2FWIA 4KQKA 4PONA 5CNMA 3T7IA 1ZUNA 4JKOA 5BUQA 5AW0A 3W1VA 4F85A 4OGFA 4B0OA 2CD7A 3EK2A 4RCZA 1MD9A 2DWPA 6YASA 4PC1A 1RYHA 2DHRA 2VQ6A 4AXXA 1SXJE 3J81A 2R6GA 3WYAA 3WOVA 1M6HA 1U9JA 2I55A 1Q6ZA 3QE2A 4H7FA 3F6EX 5E6SB 2O2DA 4A27A 1HUQA 3UHJA 5FBLB 3VO1A 1C0LA 2Q4OA 1LJUA 2FPLA 3WQRA 4TYQA 4CF6A 5A62A 4IJKA 4YT4A 5F5XA 3AIMA 3C5VA 1EDEA 3R77A 1OZFA 3AR9A 3U1BA 3E3OA 5J2TA 2H5IA 1DFIA 2OM2A 1Q2UA 2ZCVA 3DZDA 3H65A 4YRQA 1KU6A 4IX9A 3NWPA 4YDQA 1ZD4A 5EMMA 3E8MA 4DLVA 4RDIA 2PX8A 4W1QA 3PUKA 4M9CA 3TLXA 1JWAB 5CB0A 2Q6KA 1U0EA 4J1SA 2G17A 1A5ZA 3KR2A 4NPAA 1KI8A 4B6QA 1ZA2A 1Z33A 2LPMA 3N07A 4BTLA 4J2OA 3ZBQA 2V1UA 5FOSA 1U0TA 3ZNOA 1VLVA 3SM3A 3F8TA 3EGIA 1QQ6A 2BN4A 1A9YA 4J1NA 2I1WA 5AKLA 4M9SA 1N5KA 4G0OA 1E1YA 4G0VA 1P7ZA 4BIMA 4Z9FA 4OH7A 1FU7A 1W2HA 4MKZA 4YIKA 4BP1A 3O74A 1JEYA 3AEUB 4TWJA 2C1ZA 2ZWIA 2HTFA 1D5CA 2MMCA 4HQ0A 4WFJA 3EGCA 5LLSA 3JQ6A 1J22A 2A58A 4WI1A 1DPFA 4BFVA 1YB2A 1DZ3A 2V6MA 3RWBA 2QHXA 1NWCA 4RMJA 3GVCA 1R27A 1KF0A 2D2EA 3D2AA 2Q3FA 1PJSA 2P35A 5JNSA 1B2LA 2JH3A 3ASVA 3B1YA 5EZ5A 3MXTA 1V1AA 1ICIA 2WLSA 3ZS8A 1EX1A 3MNFA 4BFSA 1SG6A 1TZBA 2C2MA 3A3KA 3KKKA 4HDMB 3CIFA 4RK1A 4JI7B 4ZWNA 1DMRA 3LIIA 4C13A 1ZOOA 2AKYA 4WBNA 2IKQA 3A6LA 2ST1A 1PS9A 2C8JA 3G79A 1R2QA 4RIFA 5B1DA 4N09A 1CJMA 1QP0A 4BKRA 3DLPX 2ADOA 2WG2A 3G0OA 5K5EA 5E9JA 5DB4A 3BSFA 1WXXA 1YF3A 4X6LA 3PEUA 2VJMB 4MKXA 2CB9A 2ECQA 2I0FA 2VJYA 4XRGA 2HT1A 1VKZA 2BR5A 4XGKA 1XCMA 4Q3LA 3CEMA 2ZIAA 5K0GA 4ZVVA 2O9JA 3LKDA 3JW8A 4RLSA 4U2DA 1VRWA 2DBZA 2GN8A 5ALTA 2YCBA 1ZRHA 2ZRGA 4R8SA 1XVIA 1GSOA 4G5XA 2YWHA 1KY4A 3BD7A 3PFHA 4MB6A 4MB0A 5JO9A 4YR7A 1VJGA 2HXYA 1ZRMA 3VPGA 2X6QA 1XXHA 4EO4A 3OZGA 4AJ2A 4RA6A 3QY0A 4FOSA 2EKQA 2GFHA 4RY8A 1P4RA 1IQUA 3G88A 3TNLA 2PGOA 3R6GA 4NP6A 4MQ4A 3DVSX 2CHVA 2WPNA 3AI3A 2OV6A 4ZKEA 5FOQA 2FTKE 3H1PA 3HMQA 2W6CX 5IEJA 3C6KA 3ILHA 1DRJA 2BLLA 4EOGA 3LHXA 3FZYA 1G7TA 3OFSA 4RC9A 4DM3A 2F3UA 5IH3A 3RU9A 4IPTA 3DXYA 1MG0A 1C1XB 3KKZA 4J6FA 3RVKA 2FSSA 2WU0A 1ONBA 2DT8A 2XD4A 3E22B 4MO9A 4P31A 2D5IA 5EE5B 4Q9KA 4RSHA 3WA7A 3GVIA 1TE2A 4CIVA 5CA1F 1W88B 1TA0A 1ODLA 3DAFA 3NC1C 3GDGA 3CB4A 1GIAA 3HGMA 1S2GA 3I23A 1CF4A 1Q17A 2QAJA 2Y92A 1G8JA 3A2LA 3GCZA 4GECA 2O2JA 2V0CA 2QRVA 1EMDA 3DUWA 4M36A 3QLJA 1PK7A 4EGSA 3WK8A 3CVYA 1TF2A 4J16C 1H5UA 1GL6A 3CPSA 5EQFA 3DL2A 3T52A 3UK1A 1NF2A 1SUWA 2GBFA 3DAGA 4LBZA 5BOVA 3UV3A 1DBRA 4UFPA 1FYWA 1V5FA 3KP1A 1MMFB 5I7SA 4H3KB 3MJ4A 1KSJA 2B1IA 4JYZA 5K51A 2ZKLA 3M3HA 3AOEA 1HX7A 4D9EA 2GN1A 3UJDA 1IB0A 1P91A 3Q8WA 3ZV3A 1GPH1 5HHTA 5JAPA 4ZT3A 1FJGB 4XASA 1QB8A 1GSHA 4U7PB 1GCIA 3KQYA 4G4IA 3SOPA 3QW2A 4NBLA 1DO0A 1PSWA 1VFPA 2I78A 2AEJA 4G56A 2ZXEA 5AKJA 3M9XA 3NR2A 4IUBS 1HDOA 2WK1A 5AHKA 4TV9A 2GZSA 3PC8C 3TF5A 1T4CB 1XDBA 2OBYA 3DVRX 1UMDB 2J5RA 2QTNA 3QVKA 2XQJA 1WW2A 1W29A 4ZT2A 3W9BA 3FUTA 3RRMA 2Q1UA 5EJGA 3RVQA 3A9RA 3U40A 2VAWA 4JBLA 1OBVA 4ZO7A 8AT1A 5EA2A 2YYZA 1N7IA 2A1IA 2OXEA 3JD0A 1XTIA 4HH3C 2J07A 3I9V1 4JLKA 3E9CA 1VCNA 1NLFA 4A0FA 1WV0A 1NURA 4M1MA 3IALA 2EXXA 2VNJA 2H00A 2JIMA 1VL2A 3IBGA 2CYBA 3O8DA 4NCIA 2GETA 1GL3A 2KYRA 2WVAA 1UPXA 2YIMA 1NR7A 2ZYIA 4FYYA 4M60A 4FQ7A 4XVCA 3UMMA 2Z08A 3OWHA 2XNJA 3D6AA 1VA5A 5JJLA 1SVMA 1ZK4A 1KQNA 3GLIB 5KOJA 5JJCA 1V1SA 2QPLA 2ZVPX 1ISMA 2IP2A 1ECGA 4GWKA 1X1AA 1PGQA 1HZJA 1D09A 1KJWA 3RDPA 2P1DA 2JGFA 3EGDA 1EDZA 2GD1O 3V9PA 1E79A 5K8TA 5MGNA 1VIMA 3RIHA 2XVZA 2Z04A 1XAJA 2JFYA 3CZCA 4Y7DA 4EYSA 5IJ9A 4HQKA 1T8RA 4UATA 3TTUA 3WAJA 1ESEA 4YRKA 1E6KA 3RKRA 5E9AA 2H2DA 3N2LA 3SDZA 3TB4A 5BSKA 3CA8A 3PENA 2Q9AA 3FLAA 2BRUA 1QPZA 1TEXA 3I8XA 4D44A 2BEKA 4FYPA 1ZG3A 4NXMB 4M89A 4IRMA 4U0KA 3LP8A 5ALOA 1E8NA 3TVDA 3NWJA 3TQFA 1O54A 1YDMA 2VZ0A 2WZQA 3DFIA 1IRIA 1EX7A 3DM5A 1VMEA 3L7AA 3QKTA 4LDRA 4RDCA 5PNTA 4JI6B 5A1TA 5CGZA 1XNHA 5C7LO 1K6JA 2OY0A 4KRFA 3RF7A 1MHTA 1UBHS 1LUAA 2P6OA 4NU8X 3SIWA 1C9JA 1L7PA 3MPOA 5E3JA 3QBTA 4QQKA 4Z53A 4ZVKA 2BI7A 2G6BA 2G04A 4J0CA 3V1UA 4CV1A 4ER7A 1B15A 2A0YA 2QRQA 3T3IA 4ARZA 4KHPB 3O3CA 1LC3A 3B7WA 2GYVA 5DOVA 4R0VA 4BFTA 3DZGA 4J7CA 2AQKA 1E32A 2ORWA 4E5DA 1XXLA 3CRVA 2VDNB 2XZDA 2PEZA 1O94C 4R8MA 5BQ5A 1K4MA 1PBTA 3HKEB 2F67A 4ISCA 1UXOA 4BB0A 2X4DA 2I8CA 3FYDA 4R41A 4M83A 4BWFB 3EPJA 1XK6A 4RADA 2Q2VA 4P36A 4L5JA 4M99A 4FMCB 4MLZA 5FO1A 5BNFA 1L5WA 4L57A 1FXSA 4KR2A 2VHUA 3C3KA 3PUVA 4XX0A 3TOXA 1DEOA 2JCXA 1GLGA 4DPMA 4L5YA 2PKKA 1KAHA 1RAFA 1Z5NA 3OT1A 3V5NA 4GM6A 3CRQA 3E2PA 1XMIA 3PC6A 3KZHA 4EX6A 2EG9A 3GA0A 2G5CA 1JE0A 2E5WA 1WXQA 1W5SA 2IEYA 1JDPA 1IEQA 1O77A 2Q1SA 2WU1A 1C5KA 1NFQA 2H7VA 3LQ2A 3PL5A 5H1YA 5HOQA 3HJFA 1JBWA 1EVEA 4FFDA 2OWEA 4R83A 1RS0A 2PWBA 2Y2VA 1F2UA 2XOEA 3A4YA 2FX3A 4BKOA 1F3OA 1B76A 1GPDG 1I1HA 2ZRMA 3DE3X 5LYJF 4IS2A 3KTNA 1J9GA 1VRCA 4RHCA 4MUHA 5KNBH 1KKMA 3TECE 5A06A 4D4IA 4AM8A 4NJEA 3JQGB 3ITDA 1FMCA 1I8TA 3W3AH 4AF7A 4JELA 2DR2A 3LKIA 3TSCA 3MIZA 4DZZA 1JPNA 5C8VA 4OK6A 5FI1B 1TAUA 4YJ2A 3T9DA 3PQFA 1YRAA 1VL0A 4NX2A 3ILSA 3BMOB 2IZ5A 1H4SA 4H7JA 1WXWA 1RJEA 1DEAA 3CBQA 5KQSA 4YUXA 4F2DA 3NOOA 2J0UB 4I55F 2CMDA 2EJTA 4Q16A 2ZPAA 3Q1LA 3BE5A 1KQFA 1SNYA 1N4AA 4A8PA 3K1YA 4I3HA 1L4LA 3KKQA 3A0UA 1N2OA 1W78A 1TM2A 3PWZA 4AMYA 2HH9A 5JAQA 1JXMA 4BMZA 4YCCA 4PXAA 3AVXA 1LQ2A 5JIBA 2R48A 2YS6A 4TYPA 1C7FA 3SDSA 5DNUA 4R01A 3OD1A 1NBME 4YR9A 1NYRA 3LKVA 3ECAA 1GA1A 3CUVA 6REQA 3I5UA 1SXQA 2JLWA 2N42A 2OFWA 1X1CA 2YUIA 3FGOA 2XNDD 4MKRA 3IQGX 3RKUA 5LIRA 1QYWA 3BERA 4ZQFA 1VGQA 1JG3A 2Z9BA 4RKFA 5K2MA 4NCJA 3JQDA 3SQOA 5IZCA 2Q5CA 4ZIYA 2FP4A 4F93B 2V3CC 3MT7A 1HQCA 2XMQA 1QUEA 4GHWA 1RP7A 3AW8A 3A3NA 5K8UA 2RH4A 4BNFA 5I5EA 4RZXA 2X40A 5L40A 2Q5LA 3CNBA 1DIOB 2ZSDA 1SCJA 1WTAA 2YTZA 1ZEJA 2QX9A 3A28A 2Y77A 3Q5DA 3SN6A 5J1SB 2Y6VA 4ZQHA 2JJQA 2AOVA 4Y2HA 3VDQA 2XCIA 4G24A 4B9EA 4C3UA 3GN1A 1PZGA 5HIMA 3TMAA 1U7HA 3KSUA 4UW9A 2NPIA 1YE8A 3QVOA 3P9SA 3R0QA 4LDQA 4LBXA 5C40A 1L5GB 4ECEA 3RAGA 1J24A 3H17A 2GCOA 2WSSD 4RFSB 4EW2A 5KYUB 2FUNB 5ALHA 3U7HB 2H1HA 1PX0A 4IHQA 4KODA 5G4KB 4OAPA 1G2OA 3V4RA 2J1LA 2PGJA 4XJSA 3JAWA 2YFHA 2ZAOA 3WIBA 3OPVA 4F3KA 3WTBA 1H2YA 4IGEA 1GZ7A 2WKSA 2XNHA 2XYQA 5L7YA 4ARBA 3MOGA 3M6IA 1SHUX 3PDWA 2GAJA 3AVYA 1EPUA 1V7QA 2JDID 3HHEA 3I52A 4KQ2A 1SBHA 4FINA 1CUJA 4WLOA 4C5KA 4ZI5A 2ZUTA 2NXJA 3CB2A 1NW5A 3N76A 1DINA 2EOAA 8ATCA 2PUDA 1TIBA 1JT2A 3EASA 2CZQA 3H1TA 1EE2A 3MWGA 3O4JA 4QTUB 2WQ6A 3U4DA 4G1VA 4OXXA 1OGYA 3HB7A 1K88A 4AMZA 2DBQA 4X00A 3IVRA 3B3GA 2FYTA 4DXHA 1CP3A 4RK4A 1JQKA 1F17A 3KB8A 1M8PA 1NUHA 1CY7A 4TWIA 3BFXA 5F1YA 2VPTA 5IBPA 2CKMA 4D8XA 2RJNA 1Z0ZA 3QXSA 4WKNA 2Z8ZA 4H7HA 5CT8A 5C80A 1QVRA 1P8AA 4XSHA 4UPVA 2NXCA 1RAGA 1Z5UA 4DN6A 5DTRA 4MDYA 4CIBA 5KSOA 3QV2A 5LP6F 4QGSA 3UKOA 2E1PA 5JATA 3NFRA 1W19A 3HUTA 4GU5A 3UKDA 1Y3IA 5DHQA 1XNGA 2IDZA 5DK4A 3L6CA 1CZOA 4IEEA 3GLQA 3T7AA 4CLOB 1FRNA 4BLWA 2BCGY 1PWYE 3GFBA 1B8NA 3TBHA 2BGMA 1FBNA 1EXVA 2XYPA 4LBVA 3KKLA 5JDIC 4U8HA 5FLEX 1XYYA 4BN5A 4PAGA 4AJJA 4Z0TA 1ACJA 5IEBA 1O87A 1XD9A 4N12A 3VNAA 1NY5A 2FUEA 2H8KA 2VHZA 2VS1A 2G9QA 3FVTA 4KDRA 4MRRA 1ISRA 4B2PA 1Z47A 2GPWA 5JI3E 3ZWNA 3DAOA 5A1JA 2HLNA 3KEGA 1LWNA 5AVJA 2QJWA 5SYNA 4MA0A 3LC7O 4L74A 4D97A 1FQJA 3OUUA 2PKNA 2Z3VA 2I6FA 3KO8A 4NABA 2YW2A 4HOYA 3DBIA 1A9TA 4CKZA 5I7FA 1R3DA 5I8WA 4BO1A 1PFUA 3F6BX 3CRMA 3ITNA 5KTOA 1JG4A 2CHFA 3MMNA 2YIDA 3HY3A 3FD8A 4E31A 2IBMA 2I4OA 3RSFA 1U0HC 2XCUA 3VZSA 3OY7A 4KIWA 1G6HA 4X3PA 4PHTA 4BCBA 5A9SA 4KSYA 4Q21A 3GLSA 3D6MA 4URWR 1NRWA 5IULC 2Y66A 2ZDHA 1ZOIA 3A25A 1SK9A 3WLFA 2G09A 2NPFA 2HBYA 3WLAA 4LXHA 3MW8A 2ZSHA 2EYUA 3A4LA 3GUUA 3E9MA 2AJDA 3TD2A 3B1FA 3RNOA 2GX6A 3L6UA 1T8WA 3CF4A 1F7UA 3QFTA 1PJQA 4ZCSA 1VBFA 4F5YA 4XSGA 1ZSVA 1Z5VA 2HA2A 4X1KB 5G1OA 3PUJA 2JI6A 1EZ1A 3KT3A 3DFKA 3IOBA 2Q46A 4FFMA 4BV9A 4JSYA 5EQTA 3P20A 4RV9A 2JHGA 2P3LA 3IT3A 3LVQE 3P2YA 1O6CA 4MXDA 4EF5A 5J43A 4GC5A 1HEYA 3CISA 1L7QA 1VJ0A 4JI0B 1Y37A 2VQDA 1K0UA 5AKKA 4K6CA 4Q9NA 5CYOA 2Q3MA 2H1CA 3PDIA 2EF1A 3RAJA 2IHTA 1K9VF 3AW9A 3BMCB 1E61A 4LOLA 5CTAA 1XX6A 5ENVA 4ZCQA 3U7QA 3CVWA 1T8TA 2AR7A 2FPPB 2PXXA 4KSBA 4B4UA 5BRJA 1SVOA 2WWHA 4B8WA 3HU1A 4M7OA 4ZRNA 3WLTA 1Y5MA 4UDOA 3NU1A 2G36A 1CF9A 1U9CA 3D5QA 1NVKA 1DAGA 4BBPA 1Z6TA 5FUMA 4I2NA 3V8RA 2BEVB 1GQSA 3G5AA 4CF3A 3QM1A 3TSOA 2X8JB 2XQVA 1LS1A 4CQMB 1MABB 1N2XA 4V0LA 3SX0A 2IEDA 4C6SA 3OKFA 4IH1A 3KPWA 3EJ6A 3WY9A 1SY7A 1KOLA 1HBJA 4EY3A 1YHJA 4ZEWA 2ZRJA 2BGNA 4V0MA 4WERA 4WKBA 4LY0A 1LPMA 4XDHA 3SLGA 4DNPA 4EM6A 4BE4A 5ULLA 1KA9H 1T2FA 1FRVA 2WUGA 4XJTA 2XTBA 2ODBA 3GLFA 3EG5A 3M1LA 4RL6A 5JY1A 1FBTA 1DB3A 5LMZA 4TV8A 3M5DA 3SS9X 5BNTA 2RGRA 4CTJA 2Z4TA 2JJ2A 4F56A 1OYWA 1J5XA 2PY6A 2RHDA 3PNMA 5F33A 1D4AA 2PUJA 1JQDA 3ISJA 1R0XA 4HR7A 4BCCA 4FLMA 4O3FA 1DJLA 3OPMA 1RXVA 3G3EA 3VR4D 5HJ5A 4EL5A 2Q7XA 1ZNQO 3NT4A 1ONSA 3M33A 1D3AA 4R5HA 1T26A 2KBEA 2DQSA 2OHJA 1J0DA 2YC4C 2Z83A 5BMOA 1VG8A 3FWNA 4KANA 2Z2JA 3WNBA 2Y0BA 4PVCA 2LDBA 3WRVA 2Z6UA 2XBUA 1U0FA 4HZUB 5FWYB 3Q8KA 3E9YA 4LJRA 1JS1X 4P0TA 1WMBA 1UK7A 1ODFA 4ETMA 4RGQA 1V2GA 4RA6B 1NJFA 3NB0A 3HZZA 2FDRA 5HF5A 3HNRA 2YYSA 3H3JA 5B7GA 4L0DA 3HVJA 3IMEA 3KKMA 1KDRA 4RGBA 3TBFA 1YKSA 1OI2A 4JB3A 3RGGA 4BNXA 3GUYA 3AUXA 4ZAFA 1AD2A 2WYWA 1KEPA 5B1YA 2X4GA 3ON5A 3WIDA 5EZQA 5ADUS 2O0JA 2BV3A 2ZJ2A 1X7GA 3DS8A 2CYAA 1GQ2A 2ZJAA 4DCGA 4E32A 2H4XA 3BYZA 5ECWA 1AQIA 2NVBA 3BWYA 4MWBA 2V8BA 3CX7A 5CDUA 3AL0C 2OYSA 2YJ4A 1PL6A 3D81A 3KJXA 4QVKA 1N1DA 2HMWA 2OGSA 2Q7DA 3V2UA 4DMMA 4Z2AA 3L18A 5LQDA 1N2IA 3B2QA 3REQA 4URFA 5A5VA 3PXEA 5CDFE 1NULA 1A2BA 2QD3A 1GV1A 5U9CA 3FCXA 1UJCA 3GUVA 5AM2A 1MOQA 2BKXA 3VNVA 4C78A 3WKDA 2OD7A 2IIQA 2KQUA 3OG9A 5JSFA 4CJXA 3LLCA 4ZGWA 1EFRD 1V7ZA 1IIBA 3AFIA 2QTVB 3GAAA 4YECA 1IPEA 8GPBA 1P0FA 4YXWA 5LBIA 4MJLA 4ND6A 1X2BA 1KSHA 4G84A 3GPCA 2XTAA 4P54A 1U11A 4U2FA 3V1KA 2G28A 4MK4A 1K7EB 3MBKA 1NT2A 3SHFA 4EARA 4W5OA 2Y0PA 1FVXA 5JASA 4KE7A 2ECFA 1G59A 2K7ZA 4TRNA 4YH1A 5K0BA 1A8PA 1WO8A 4ZJPA 4B73A 2NGRA 2L0XA 3ESCA 5G2OA 2PE5A 2IKSA 4OMFG 1OLOA 2FF5A 1LFAA 1KR5A 2ONJA 1NJ8A 3M8KA 3UA3A 2IGTA 3V7UA 4II2A 4PZLA 1TLTA 1UC4B 3JARA 3MINB 1H6CA 4RDHA 2DHEA 5IDVA 5A3SA 3DBVO 4PZEA 3EHDA 5A0TA 2WWFA 2JGAA 1NXVA 2XQKA 4BFLA 4EHLA 1P0QA 4Y6QA 2RHTA 2C7OA 2AEEA 3BREA 2H1RA 4EQ6B 3WYCA 2WJ6A 3C4VA 1JQ3A 3TZEA 3GDWA 1DBQA 1JBVA 3NOVA 1WDLA 4IIXA 5CNIA 3WKAA 4HGOA 2UZ0A 1SULA 5JFGA 2PV0A 2VQFB 1Z2OX 3N70A 3DTTA 4FZ5A 2PBRA 3JYPA 1RXEA 4EGQA 3ZDXB 4FX5A 1M2WA 1ENZA 1SUPA 1XZKA 4PZAA 1QVAA 3BDVA 3IIIA 3BKXA 4U7TB 1O5ZA 3SKYA 3AF6A 2O2HA 2EFCB 2VRBA 1DCKA 4GXRA 4RKWA 2O23A 4S24A 5CURA 3DOUA 2OTCA 3P8ZA 1Z73A 5GONB 3G2HA 5A6SB 4YPVA 4MQEB 1MRSA 3UJAA 1EB9A 1NMSA 2GGSA 4EKIA 4F6LA 1RXSA 2D1RA 1QZXA 1Z4KA 3MQ2A 5DM70 5L53A 1QYRA 1VLMA 4IHJB 4FYHA 4P3OA 5FYDA 4IM7A 3EEIA 3JRNA 4IH9A 4B5LA 2UZ3A 1KOFA 2B1GA 3L92A 2ACVA 4JR0A 4UFOA 4URUR 1WCWA 1LLQA 2DCUA 3ZR4B 4HWTA 3EQ6A 3JAKB 3LJKA 4FI3C 4LWZA 4R2KA 3FPAA 3DHVA 4ZVQA 3KXPA 4GVPA 1IONA 4WXRA 3PI6A 4JBXA 3QRWA 2NSDA 2W37A 3QYFA 3RYCB 4BB6A 2GXQA 3ZNNA 2C4UA 2WP0A 4GL2A 1DQNA 2YWGA 1RRFA 1ZUWA 4E33A 2OFFA 3SZOA 2UZ1B 2J87A 3A05A 4L72A 2A7XA 4H1UA 4JEUA 1Z62A 2NU9B 1E9DA 1WUIS 3OP1A 1AS0A 3FMIA 3HGQA 1DKRA 4HGPA 4D0NA 1C9NA 4JYAB 4JP1A 2NV0A 4OMCA 3SY8A 2O0HA 5KDOA 2I6BA 1T5LA 1U2XA 5TB5A 2QL9A 2BBWA 2C00A 2V59A 3LTNC 1A82A 1O6FA 2GUWA 3A4MA 3BRSA 2BBSA 4FGZA 3DV2A 1XZCA 3QGMA 3TSWA 1M1YE 1YJ8A 2F3RA 4LK3A 4AN1A 1CW2B 1N2CB 3HRIA 1EGVB 3FBWA 4KDFA 4LNAA 3ZXXA 2C7BA 1E2KA 2AFIB 4HDSB 1G5QA 1SG0A 4WX2B 3CJRA 2XB2A 2F90A 3LBHA 3R6DA 2BM0A 3F6CA 4O4HA 1HNZB 4XVUA 3PX3A 2PR2A 1CULC 2RAUA 4FGUA 1V5EA 2FOXA 1CY8A 4X1YB 2HDNB 4NE9A 4LHWA 2H4FA 3PYMA 4XEUA 3T9EA 2H2WA 4B4DA 2HA4A 3TQSA 5J9FA 4D4KA 4ESEA 5JOQA 3TEMA 2EJVA 1W5EA 2WBLC 3SLRA 3X2FA 3OE5A 4C4OA 2VP9A 4RNCA 5T4BA 1SWVA 4X84A 3RB8A 3WR5A 3GAZA 3GGCA 4A0SA 6Q21A 1TLFA 4TKUA 2GSWA 4J7AA 4CETA 4RJJA 4R9UC 3DE2X 2DX7A 5EZYB 2UUBB 3GP5A 2EWMA 2PMDA 1DAPA 1KZ7B 1PQYA 2OLKA 4K86A 4WUTA 5AM5A 4UM8B 5JQGB 4HDNB 1QYXA 3VNQA 3PEWA 3RHFA 5BQXA 1X1EA 5ALPA 3S2SA 3H2ZA 4BMCA 2GNPA 2WFLA 2I65A 5KNCD 3I64A 4IGKA 2FZCA 3TQTA 5KMGA 5F4BA 3K7EA 3SIRA 5D87A 5IXYA 1C7EA 5IJ0B 1WOMA 1R6TA 3EDMA 4OQNA 2LRHA 2PWPA 4R2WA 3NT5A 3PA8A 3TLGB 3JVIA 1MJNA 3DBHA 3OIGA 1B4DA 2ZTLA 4NQRA 4MHOA 3TW0A 1D1QA 2RJ3A 2QA5A 1KI4A 2HBRA 5CB6A 1DHTA 4RV5A 2PMEA 1EVZA 2OHGA 5JBNA 1AKWA 1ZISA 2Z8XA 3D8HA 4LJKA 3ADDA 1X94A 3BXXA 3MQFA 1LNSA 6REQB 2BGGA 4KVZA 4G5HA 3H6KA 4W6QA 4AJOA 4K0RA 3BJIC 4AJEA 4KE8A 2M6KA 4B33A 4B6RA 2Y1FA 2VXYA 3VPXA 1CJKC 4HFJA 4HMOA 4EHAA 3GJ6A 4KQ6A 1BC5A 3BQ9A 2ZAIA 3QJ5A 3QMPA 4OBWA 3PHIA 4BNDB 1KAEA 4EEZA 1NM5C 1AGRA 3QEOA 4L9AA 3D3JA 1IEWA 2QXTA 5K2OA 1AC5A 2HIMA 2ODEA 4R9NA 4YALA 1M8JA 5D01A 3T1QA 4DDTA 4PSCA 1KMMA 4Y1GA 1G5HA 2WE7A 1G20E 2RI6A 3LAWA 5GJWC 2X0RA 3CCBA 3INYA 3GLUA 3OWXA 4WJMA 4BNYA 1HEIA 2IX9A 1PFGA 2XGMA 5CCXA 3L82B 2ATXA 4YAIA 2OCBA 1N8NA 1IPFA 2I3AA 1KJYA 1QSGA 4RX1A 3UGKA 3UMVA 3WLLA 5L3QA 4D3YA 5EUQB 5JCJD 1KRXA 4PQEA 3HJTA 2CXSA 3NDIA 4DARA 1K5GA 5J4KA 4GLOA 1OMOA 2Q4TA 3AOGA 1OIVA 1JXOA 1N2CA 1UM8A 4ATNA 3V32A 4DIDA 2OMKA 5KOHA 3K9LA 5DASA 2OO7A 4GZLA 3U3DA 3NONA 1RQGA 3KOWA 3HYOA 1W4RA 2XWPA 4IUCS 3TKLA 1EXDA 3NRJA 4UAVA 1VKRA 1OU4A 4LTDA 1ESDA 4MGKR 5KCZA 1U80A 2A8YA 1XMJA 1LVHA 1WQ3A 1WZIA 3E18A 3IIEA 1M1YA 4D56A 1E4EB 1J0BA 1Y1PA 2IEAA 4JBGA 2EJBA 4PNZA 2P6UA 2PV7A 4XCXA 4QTXA 4A82A 3RRFA 4D25A 2A5DA 2J9ZB 3CCFA 3VTFA 1DTWA 2QPAA 3RT7A 2NWHA 3GH3A 2DY1A 5LVAA 2RIRA 4RMGA 1JLLB 2GN9A 2NAPA 4GMXA 1IDN1 3I1YA 4BWVA 4WLVA 3T4PA 1Y9EA 1GPMA 2NSHA 2WJIA 5FUVA 1L2TA 2HAEA 4B3TB 3VZPA 5LQNA 4I5GA 4TRRA 3HQ4O 1ZLYA 1J2UA 1XDZA 1KI6B 3G0DA 3PDJA 2I2FA 1HG0A 1WABA 1NVTA 3WWZA 4UQPA 4NG5A 3UFBA 2X19A 3CZ4A 3ZDEA 1JQJC 2BFAA 1WMSA 1RQNA 1AHIA 1WOYA 3OIVA 3KJZA 4G89A 3WO1A 2JJ1D 1OFVA 5A3QA 2IH4A 3IMKA 4K2HA 3BXHA 1ZCBA 1YULA 4KWCA 4K9KA 2N9UA 3HJAA 2QSJA 5B7PA 4GBGA 1U6KA 2X76A 4ENPA 4WGFA 1KI2A 1ZIXA 2IV7A 1G20A 5HVNA 5BXQC 1LVGA 3ELDA 4L6IA 4XTRA 5TC4A 1UJ2A 1KYTA 4Q9JA 4WSOA 5HF8A 3H9GA 3GVHA 1GGHA 4NHEA 4OU5A 4ZV4A 3QE9Y 1PL7A 2AZXA 2GZ3A 3VPHA 3C7DB 3ZCSA 3A1EA 1RSZA 1UAYA 2GXSA 4C7MA 3ICQB 1IHDA 5IK2A 3VAAA 2Y27A 1IQPA 1YR9A 1XDDA 1FP7A 3OQVA 1EFCA 4NSNA 4XX1A 3Q7SA 1FUKA 4PGHA 1V43A 2JGIA 3R3ZA 4LDPA 3FPLA 1DOAA 2GTIA 3BBLA 4YC7A 1K66A 4W8OA 4WZAE 1MQ9A 2P8SA 5ICSA 1I3KA 3VYSB 4NBVA 3R5FA 2C2BA 2Z95A 4UBEA 4GI7A 4UJ5A 1CG6A 3NTXA 2AI3A 4K03A 4E1BA 3E9ZA 6ADHA 1E2MA 4CEJB 2A1UB 7ABPA 4B09A 5SY6A 2ZULA 4X20A 4U1RA 1GZ5A 4XVQA 5L6LB 2HSEA 1QH0A 1NKSA 1RWWA 3D1LA 4JYBA 5TS3A 4EX7A 2HMUA 4UPEA 2E37A 4XDGA 1OAOA 4OQDA 4DUPA 4G0PA 4LOIA 1GNPA 4L76A 1RMYA 3NBWA 4CN9A 3A27A 2EKZA 1MAWA 2X1HA 2ZYHA 3LY9A 1CZUA 5A04A 1WPXA 4XWKA 3G89A 2Y1OA 2H92A 1GG4A 3AV3A 3PXAA 1CQZA 1TM5E 3OLQA 3GRFA 4QG3A 4ZVMA 3IBSA 4QEZA 2I76A 2G72A 2WHRA 1YL7A 1WPGA 1MBZA 4R84A 4I5DA 1ZRNA 5ER6A 1F7VA 2HA7A 1ZOLA 1GKIA 1HYEA 4RCVA 1W6UA 3KRTA 4JYMA 4OLHA 4YRNA 2XCSB 3QUAA 1MORA 4JLDA 2XH8A 3MCWA 5TGDA 2AOUA 2V7PA 2Z2IA 1TYAE 3HDYA 5FB3A 3SZMA 4ZHQB 2V03A 3F9RA 3WDSA 3FWPA 4DVJA 2QJFA 2ONYA 2VRCA 1LIIA 4HD8A 2XMBA 3QOXA 1M1XB 4FFBA 4K6GA 4EJ0A 3BKWA 3KD2A 4DV1B 4OHUA 4FDVA 5FI5A 4D3SA 2QK4A 4AKHA 2AFIE 4FU0A 3PV0A 3RRBA 4BNNA 1P9NA 3ZEAA 2R7AA 1LLDA 1RMTA 2O8CB 3M5PA 3P0HA 3DEAA 3QA3E 1UKBA 3R0JA 4M9UA 4ND8B 4XIJA 4YP5A 4ZO6A 5EG5A 1VG9B 2RBKA 3UJ8A 4A03A 2OXFA 4XOIA 4YP0A 4D02A 3FDZB 2ZE8A 2ISQA 3G23A 4ID3A 3EC7A 2QN3A 3AHCA 1YACA 2ZSJA 4OHVA 1GPNA 1LS6A 3BHNA 2AXNA 1UQTA 4AXBA 2WZCA 1KO1A 2IEIA 5CLHA 1W4LA 2D8AA 4W7SA 5DFAA 1P9OA 1D5WA 4AF6A 4C05A 2FR8A 1I2CA 3VGPA 2VSNA 3F6YA 4V0KA 3TQHA 1E7YA 1MIOB 2ZSFA 1BN7A 3DCNA 3FUVA 4DQLA 1V3TA 2AKAB 4IFBA 4B3DA 3NXSA 4QDKA 2B0JA 4UXJA 4YCNA 3MFYA 5SY9A 2BYTA 2IDJA 2WSIA 3NRSA 2RC5A 4J3NA 2P5TB 1DIBA 1QLHA 4DHWA 2V6GA 3GJTA 4AO6A 4JB8A 3OOWA 3QVUA 5K45A 2QB5A 2WUDA 2CDNA 3DBRA 3F46A 1O4VA 2A4MA 4L4XA 1F0NA 4MV9A 1AK1A 4QDUA 5K0JA 2A6PA 4B43A 1F4PA 2VN8A 2W71A 2P9QA 1MZVA 4K9MA 4JL6A 4K1LA 2G25A 2ZT8A 4ENRA 3B2EA 3M4JA 3ZXSA 3L6BA 3UBTA 5A0VA 4GMDA 2A1UA 4XM2A 3MS4A 2QAGC 1FW8A 4YV0A 1WZCA 2KLHA 4O2BF 3RODA 5DSZA 4MJ7A 3ZZNA 4ND4A 5KHLB 1XPUA 2NTVA 2PU7A 2W6JA 2CBGA 1AUVA 5EKTA 3NUZA 2FV8A 4G5OA 2WIGA 3I32A 4IIVA 4UUNA 1MB0A 1CUFA 3PE3A 1W8IA 1KWGA 3BA1A 2RCNA 3QI2A 4DV5B 1VGRA 2BJWA 1KP9A 2J3LA 2P9FA 3NI2A 4KJXA 1KEKA 2FN4A 3M6UA 3Q5EA 1DAFA 5AVOA 3IN1A 2WSYB 4Y1EA 3FSGA 1PF7E 4IOKA 4LCEA 4NH4A 1IBCA 1VHDA 2C94A 1GPWB 2ZJ8A 4UXIA 4D9FA 3U5ZB 3OIFA 2JVIA 5J2TF 3H9CA 4RDXA 5SYMA 3QVGB 3B51X 5HQ3B 2A5FA 5COBA 2IYVA 5LZ7A 4WXHA 1Q5PA 3UMOA 3H2GA 4COKA 4M2LA 1KJNA 4NZ9A 5EHNA 1ZNYA 3C3JA 4AJNA 5BNWA 4URXR 3ZDAA 3IE1A 3P9CA 1JJBA 4Y3UA 5BYCA 4BYMA 4RABA 1FSSA 1RKAA 4X66B 2XJAA 2LVBA 1PVOA 3OKPA 1DBWA 3DT9A 4OKSA 4HB4A 4UBJA 4I9FA 5KNBA 5FOVA 3DMDA 1L4UA 1TM3E 2OBNA 2OAP1 4KG7A 4KQJA 4PE5B 4OIFA 2ZBPA 3ZCPA 4DWVA 5F11A 1D6MA 5CYFA 1L5VA 5ARDA 4A9AA 4F97A 1XZDA 5JW6A 1XR3A 2PG3A 3M6MD 5FR2A 1YDFA 3V1MA 4JJFA 1E3WB 4D98A 4F8YA 3KYDB 5LKAA 5C0OE 5EE9A 5EYPA 4Q9LA 5TY0A 3F98A 1PR6A 3U1TA 1GGVA 2RGYA 2C98A 4Y2XA 2YJGA 3L5KA 1ZINA 4EZEA 2JGDA 4YJGB 4NV0A 1INLA 5CPBA 4KPYA 3KQVA 3I05A 4EZIA 4KNYA 1EWQA 1JZQA 4FKMA 1M8GA 1Y34E 1H1LB 3CY6A 3N2KA 4XPZA 1QX4A 2ECKA 3B7GA 3HCWA 3ND8A 4Y6GB 4UUAA 1QIDA 4IV5A 2HOQA 4IV0A 4WBNF 3BTVA 3DTNA 3FPKA 1J7KA 1XAIA 2CLIB 4OQLA 2Y0EA 3MELA 4QBIA 3IQHX 2WTBA 4C06A 1VSVA 3QTLA 4LJ5A 5LUBA 4DJTA 2R3EA 4EB6B 4XQ9A 3EE6A 3MJRA 3IHLA 4B3BA 3EBPA 4MP3A 3HA5A 4PLPA 2BF4A 4GUDA 5JALA 5L4SA 3SU8A 2AJPA 2IYEA 3E1KA 4YJ3F 5T4HA 2QTLA 4TMXA 1T1EA 3EG9B 4M1KA 3OLCX 4V3CA 2I7XA 2NO9A 1XTSA 3EZLA 4FGSA 4DPKA 3M6XA 3JYNA 2Q1WA 2AFHB 4FB5A 2QW0X 1UZMA 1X7ZA 1QCZA 1CDOA 2NACA 4O2AB 5EI5A 2GJ9A 2A94A 2E9SA 4YRSA 3DO8A 2H8GA 4XM1A 4UBNA 2C78A 3HZOA 3JAKA 3KVNA 1XBTA 4YMIA 4CR7A 3AY3A 4FSDA 4QFBA 1ZU5A 3QWBA 2H1VA 2QTAA 5KAMA 3IHTA 3V4VB 2QZJA 4OGWA 2EV9A 1GKKA 3FWYA 5DRTA 3RTEA 5FLXA 1ZN9A 2AJBA 4X93A 1AE1A 2JGLA 4CKBA 4G0YA 4IILA 3KKPA 1Z7GA 1A9QA 5FFMA 4U6QA 3MMPA 4H7EA 5T4FA 1FVHA 5BN4A 4HAIA 3U7IA 2C3PA 2O8VA 5DCUA 3B85A 4C5NA 2BFDB 2CMHA 3NLLA 3RFFA 2X22A 3GMTA 3BDIA 1TTQB 1S3GA 1FFAA 1ZFNA 2E4WA 3K31A 2CXTA 1RWPA 4Q1AA 4ZO4A 5ETJA 1W2GA 2PS0A 3ELBA 1VL6A 2VZLA 4NEHB 1NRXA 4GDMA 1SZDA 3MTGA 3TAHA 2FRXA 2WA2A 1P1FA 2ZIFA 3C6QA 2BFEA 3I2FA 1EGQA 1IHYA 1PNVA 1QHSA 3JQPA 1E92A 2GK6A 4G5SA 4PYRA 4EVIA 4BUJA 4Q3DA 3LA8A 1UFVA 4QA9A 1U8TA 3U13A 4EL0A 3BZWA 3HI6A 4KXYA 3O93A 1I5EA 4HB0A 4LKOA 1XC7A 5F1PA 1AZTA 1T2UA 1SBIA 3PF8A 2HNBA 2OGWA 1NUSA 3HYCA 3BE6A 4N49A 3Q1KA 4LN1A 2AM1A 3KYDA 1XPRA 2VKQA 3FW1A 1RZVA 3CC8A 1UWLA 4GPD1 4JJEA 1I2ZA 4TLEA 4LQ4A 4E2WA 2OAQ1 5EFOA 5HPYB 3C70A 3A4VA 1GYRA 2OHHA 4ARIA 3AVUA 3WJ1A 1TZKA 3GC6A 3IDFA 3L06A 2OP0A 3EGOA 4HXEB 2JBWA 4C4RA 5BR7A 5F98A 1FFCA 3EOZA 1XJ5A 2VPWA 3EWNA 3KVRA 4MEJA 5FD8A 4INJA 5ICEA 1DC3A 4YHHB 4F4IA 4EHDA 1SBNE 1L5LA 5CDTA 2QIPA 4K9RA 1AVTA 2VAVA 2X0DA 2CK3A 3S2IA 1LH0A 2D2FA 2PH1A 1HA3A 1ZGAA 2XW6A 3RRXA 1W87A 2DG2A 4BJ3A 1Y1TA 1RK2A 1V1MB 1M2NA 3DWFA 5IJ0A 4F4CA 4DAOA 4L8LA 1I32A 1MPXA 3SOZA 4BMVA 1CQIB 2P67A 2BSQA 1WX1A 3DV0B 2VG8A 2WAAA 3LC1O 1U6JA 2DKOA 2GJAA 2YHIA 3CNEA 5AK5A 3RVLA 4M0UA 2F3QA 1JMKC 4HQLA 5GOTA 3VPDA 1FDVA 2BKUA 4UM9D 5A2GA 3AEYA 3E7XA 2IYAA 4R3WA 2GK3A 3VM6A 1HKHA 2GAOA 3NIDB 3IT0A 1BMQA 1KPGA 4QG7A 1Z0JA 5TQ2A 2NO1A 4REMA 1CB7A 1GDDA 1DJNA 1POWA 4OUDB 4Y67A 5G1NA 3G8BA 3DOHA 3MUEA 3IJ5A 4TLCA 2IOYA 1AGYA 3FVWA 4DEXA 2ZG6A 5HUJA 3SD7A 1Z26A 2VHVA 3REGA 1HZZC 1Y3CE 2ZDGA 3CPHA 4PZPA 3SIPA 3FPHA 4BQNA 1Q11A 1A88A 3LT4A 3LUBA 3DB1A 5FTKA 2VSOA 5UKDA 1D4ZA 5EKUA 5F7OA 1KFCB 3ESAA 2PJRA 2QZSA 1JR6A 2G07A 3VU9A 3GJSA 3NBZC 4XR9A 2RHJA 2H7XA 1E6LA 2CEKA 221PA 2GHIA 3SSAA 4D9CA 1BE8A 1R5JA 2D4AA 4FFOA 5DM2A 4ZREA 3BXGA 4XTCS 3EIHA 2FPMA 2IYWA 4ID9A 1WY7A 5K0NA 2HJRA 1A9RA 8LDHA 5L7WA 3GOHA 1ISPA 2OHXA 1U7ZA 3VR2D 4IKPA 4KWTA 2QY6A 4INAA 4DC9A 1VI9A 4MAMA 4GLFA 2WDZA 1AQJA 4E5MA 1HSZA 1PFKA 2GI4A 3R7DA 4EDHA 1U28C 5CJJA 5C4IA 2FUG1 4AZ3B 1E1LA 2R6DA 1JR3A 1J0CA 2FB9A 5C52B 1UPCA 2P9JA 4Y2PA 2Q3HA 3MRVA 3VZQA 2FDCA 1X7YB 2X6TA 1OLSA 1ZGZA 1LEHA 1JH8A 2W2KA 2GR9A 5CGAA 1ADBA 5D8DA 3NM1A 4N5NA 4RMHA 1UQUA 4EBBA 5L6MB 3SS8A 3OTOB 1NY6A 4IIHA 4KLZA 4IG9A 1TZ6A 1JSRA 3STVA 3E9EA 5AW2A 1O1YA 4NAVA 4ZVLA 4JXXA 1NLMA 3COYA 3LUPA 4WIAA 2AUTA 1V3VA 1LD3A 3QUQA 1SBZA 4H59A 4RY0A 1PV2A 1NBOA 4L9SA 1P1IA 3LGSA 3OCXA 3Q0EA 1Z39A 3P4YA 1HOTA 3BDAA 4V39A 3TDNA 3O4GA 2I67A 1EVIA 1JLHA 1LK5A 4IFEA 2C59A 3JQRA 1L3IA 4X3OA 2OECA 3EWMA 4BV3A 3PZBA 2X86A 4KXWA 5CXSA 4N48A 2VDKB 1P18A 3RQ6A 4N1AA 4XF7A 1HM5A 4H0NA 3ROMA 3MUFA 5KTKA 3GGDA 4XF6A 4H08A 1UOEA 1IRXA 1M0WA 3HLTA 1VXRA 3S2EA 4ME6A 5F1KA 2ID9A 2DWOA 2WU3A 4JA2A 3P9XA 5IDXA 1QHNA 4JL8A 5C5EA 2HF9A 1JX6A 4OSOA 3EAQA 3EQZA 5DN9A 1DRWA 4B4KA 3HB1A 4CUZA 5BP7A 2O20A 5DCWA 2MSDB 4D46A 1R9GA 3NEJA 4DWWA 1YU9A 2AFHE 4KYTA 1R3UA 1UKZA 3N8GA 3DAYA 4R9VA 3MPUA 4CYMA 2J3HA 3FOZA 3NC9A 3AP3A 3GI1A 1E5VA 1NBAA 2LV8A 2VF5X 5KC8A 3D8UA 4BJ1A 2I4LA 2IYZA 4LGMA 1GNLA 1K8YB 1VPLA 1ZMTA 3G0GA 2E4VA 4MIKA 1FJXA 3W8RA 1EP3B 5ALUA 5MHTA 3RIXA 3HA2A 4KR0A 2WW8A 4C30A 5KX5B 4WMLA 5FKJA 4B7UA 4BO7A 3CRRA 4PSVA 3UUWA 4BLTA 1HXHA 1U4OA 4OH1A 2YV2A 3DEFA 1FXWA 3OIYA 3PL1A 4RH0A 2A9JA 1AKUA 4IJ6A 2WPDD 5D1HA 3FKJA 3L0BA 3OVMA 4JS0A 4BN0A 1KSFX 4INPA 3RAEC 3I6QA 5L7TA 3HNOA 4UPDA 2BT4A 4OM7A 3V55A 3MVEA 1PGPA 4BBJA 3IQZA 3M6LA 2C88A 1Z3IX 2EQ5A 1XE3A 1X19A 5KI6A 5JZSA 4LBGA 1U1FA 1T9HA 5CYPA 621PA 4QGBA 4F2WA 5IT9A 1QHGA 2WG0A 2OR3A 3D02A 4KVGA 1Z0KA 4O08A 1A95A 4EFMA 1O5TA 3O2SB 2O59A 3C6YA 3QYAA 3CLUC 3O4VA 5D7BA 1JA0A 3ZHBA 3QBEA 1C41A 3DO6A 2FMTA 5TT1A 3SQDA 4L8YA 4PIPA 3ZPXA 3UCEA 2Q0HA 5TMPA 3Q9LA 1D2HA 2BMVA 1TPYA 1L5RA 3JQAB 4UARA 1AQ6A 2D1FA 3IJRA 3PNBA 1JQ5A 1QO0A 4JD5A 4ZAXA 1D6NA 3LQ4A 3RLFA 3WGHA 4CLRA 2C7VA 1ULUA 3EXFB 1NQTA 4WZBE 2QE7D 3FPCA 2J9GA 5SICE 3WMXA 3AERB 4GLBA 3QTTA 2D5CA 2H9YA 5CK5A 5AJHA 5BYFA 3WNVA 4IDAA 5LXTF 2HHAA 4LRYA 5HUHA 2QAGB 1YXMA 2HBQA 3KHKA 3GAFA 3VV2A 3ZXYA 3CVOA 3I5YA 3T1YB 1JJAA 3VJMA 2RKWA 4AMUA 4BKPA 4ZYLA 4DA4A 1ZK1A 4PFSA 3FVQA 1W46A 1C4OA 4P7JA 1OJLA 1H4VB 1JZTA 2CF6A 3K5HA 4UUOA 2ZS7A 2BY4A 5DGHA 3T7EA 3OIUA 4TZ0A 5T8KA 4DZTA 3IHWA 3OQBA 3SYLA 3Q3EA 1U8UA 1U7XA 4G9EA 3GQBB 4TX1A 5D51S 5I7AA 4C0KA 1CZRA 2GDJA 1T2CA 3IO5A 4QXQA 5CFOA 2ZJ0A 4PF1A 5MN6A 3B6JA 3C41J 4GOND 3U44B 1NPDA 2CLOB 2W8BB 2P40A 3LDFA 5C31A 2FPKA 1OROA 3GT4A 1SRRA 3RS2A 1EAYA 1TQHA 4JBYA 2XZOA 4QQ8A 3LU1A 3BWXA 3G2JA 1PP4A 1MQ8B 2R86A 2AOTB 5SYAA 3PJEA 3O03A 1PO7A 4N7BA 3VH1A 3TXAA 4LSGA 4CVLA 3FDIA 4FT2A 3QPCA 4BNGA 2BH9A 5IG2A 3QVWA 4TROA 1L7BA 2HF2A 3W7AA 2YINC 3U5TA 2Q2WA 1SC6A 1P2GA 2BGRA 2L17A 4LCBA 3EIQA 1OGJA 4URYR 3G9QA 5K09A 1OH7A 1KU0A 1A69A 3FM9A 4P7BA 2Q49A 5MF6A 4WH0A 2FSFA 2V97A 2P2LA 3IIJA 3BZBA 4NFLA 3OAAD 3QMVA 1GG2A 1C30A 5IWAB 1Y5IA 1W35A 2C2ZA 1IJKA 1PIWA 3HJBA 1XD2B 4XDZA 3X1WA 1C1XA 3X2EA 4FMDF 4YAJA 3VO9A 1QYIA 1JHPA 3KOMA 2RHMA 1E96A 2Z1MA 1KO4A 4MV1A 4MRPA 1MFPA 2PUVA 1X8KA 4N5DA 5FLKA 2JAPA 2Q41A 2ZJZA 2J7KA 4CMJA 3K3PA 4DIUA 4K88A 4Z1OA 4TWRA 3F5DA 2XT0A 1IXRC 3O94A 5HXAA 2JAXA 3KX2A 3RS5A 3DAPA 1C3OA 5ALDA 1BGXT 5ALIA 2UUCB 4TLLB 2YIJA 4NNPA 1Y48E 1XCBA 3ZZ1A 5LYJA 2QUBA 3LVFO 2H63A 4YAFA 4DJFC 1VYVA 2ZBQA 1BN6A 1CUSA 4O59O 3T99A 4OIMA 5CH5A 3B6MA 4WY2A 5JEDA 3IRVA 1DC5A 4G25A 1YTLA 5ARBA 3CZ9A 4P80A 3A6HA 4RK6A 3D7SA 2O3QA 4WOCA 1LQUA 2CNOA 4KW7A 4MWGA 2DMRA 1SEVA 1K06A 2HA0A 2PRJA 4M0LA 5M34A 1NAHA 5TEWA 8ADHA 3NXKA 4LF4B 1JEQA 1V35A 3P71T 1VL5A 2CNKA 1YONA 1HOXA 3ZJ5A 2PGAA 3R0IA 1V4BA 1WZNA 3KUDA 4I08A 4KLRA 4S1VA 5A0FA 1L4NA 2ZIWB 4KPUA 3OMLA 1MC8A 2W6OA 3TWOA 2P30A 3NBUA 4KE9A 2X42A 1SVUA 1CUDA 3OM1A 1GNSA 5CBPB 3E1SA 4GQIA 3VMMA 3O4IA 1N1GA 3NHFA 4HX5A 3F8WA 1ODKA 1XMVA 4LMPA 4GPIB 5IBRA 1PUXA 3BG5A 4B3IA 3ZV5A 1K92A 3GP8A 4FN4A 1JUDA 2W48A 1BE0A 2AG5A 2R68A 3P5SA 2ERXA 1LDEA 3QVVA 3F90A 3KYJB 1AS2A 2FWMX 4FMBB 4YRLA 1JECA 2CXUA 1THMA 4TTVA 4EELA 1SXHA 3NQ41 2FPRA 2JFHA 4UBIA 4XIYA 2XZLA 2Z5LA 1DAKA 5BVHB 4B3RB 5FO0A 2XCQA 2PD4A 4MR7B 1XZFA 3B2NA 1G3UA 3KVVA 2C5SA 2WD8A 3B6EA 3MWLA 3PDCA 2W6QA 1E7MA 4FFLA 5AJUA 2FPUA 1R4MB 2YOHA 2JGDB 4J0FA 3LHFA 4YJGA 3BAFA 4A8JC 5ADWA 4AKGA 1J07A 1UJ4A 1G3MA 2VPXA 4LXGA 4W5WA 3ZOZA 1X7XA 4A73A 4OLAA 1FFBA 3VH3A 4CR6A 3RYIA 3RBVA 1RPJA 3V3TA 1XZEA 3RTDA 4H7KA 3A1FA 5B6PA 3KVYA 3OU2A 4RESA 3VNBA 2I91A 4G8BA 3USZA 3GELA 4W1SA 2PZKA 1H8ED 4LKRA 1FP2A 1HNXB 2ZFUA 1OHHA 1PHPA 3BTUA 3GPDG 1SUFA 2J33A 1JIQA 2OCYC 5FWDA 3JQCA 1X92A 2VUUA 4LXIA 1PDVA 4BV2A 4F4DA 2RG7A 4P4LA 1CSEE 5BR4A 1I4EB 5J2UA 3AZOA 2W11A 3GZNA 5JD3A 1S8AA 1Y9AA 1DSSG 3G0IA 4FFRA 3T54A 5FWXB 2H0RA 4HZGA 1XTKA 4S12A 4ERXA 4F6CA 4YRMA 4LBYA 1PG5A 2QN2A 5KYYB 5M2QA 2QX4A 4RZSA 3TR0A 3VKUA 4RSMA 5LDDC 1XXHE 2B2NA 1Z6AA 3Q2IA 3GT0A 3EVNA 5DCYA 1TM1E 3V1NA 4GX1A 1QS0A 1ZI8A 4KQMA 4HH0A 3NM4A 3MM4A 2OG2A 5I48A 1GPJA 2RBGA 4PLCA 4DA0A 2O05A 2VSQA 3N2ZB 3V4PB 3VSEA 4YLYA 2XDQA 4CCSA 3ZK9A 2GRUA 4XPIA 4JC5A 3HYRA 3NWEA 1K8XB 3U56A 5BPFA 3GWZA 3HCBA 1L5MA 3JWEA 3R6TA 4FKBA 2XITA 4X95A 5C53B 4RPGA 2XUHA 1M2EA 3C3AA 2ZSEA 3HXLA 5BW8A 2BGIA 3CLSD 4RPHA 3SF8B 3BT7A 4IDNA 2O2GA 5I7OA 3DUFB 4MPRA 4MI3A 5HMMA 2CUZA 3N7UA 4YRAA 3DLBA 2IZ7A