3RU7A

Specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
341
structure length
336
Chain Sequence
YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WbgU
publication title Specific recognition of N-acetylated substrates and domain flexibility in WbgU: a UDP-GalNAc 4-epimerase
rcsb
source organism Plesiomonas shigelloides
molecule tags Isomerase
total genus 117
structure length 336
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ru7A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3ru7A02
1I3MA 3UGKA 3CMMA 1P1RA 3GEDA 5KVSA 2ET6A 3TNLA 5T67A 4C4OA 4DBZA 3Q9UA 2NTJA 1GR0A 3K9QO 4CM9D 2YQ4A 2NACA 4CLHA 4FJ2A 3AI1A 1OC4A 2NWQA 4HFMA 4IS3A 1H9BA 3LF2A 1ZSVA 3JYOA 1E0DA 5L40A 2P9GA 3L77A 3WXBA 3TDKA 4YACA 5DCWA 1NHGA 3EYWA 3X2FA 5GZ3A 2D5AA 4WLUA 3GRKA 4AJ2A 1W8DA 4MJLA 5TIIA 1FDTA 4B7XA 4XJTA 3ST7A 3RBVA 4JCOA 4YT4A 4R1TA 3Q0EA 1I8TA 3HFGA 4NK4A 3F3SA 4Y6RA 2PD6A 4J6FA 2X9VA 5A06A 3GNTA 4W82A 3D1LA 3FF4A 4WCFC 4II3A 4JIGA 2GZ1A 3PWZA 5CP8A 4E5KA 3D64A 3DZBA 2J6IA 4OYRA 3GDOA 4BGUA 2PTGA 1U2GA 1XIVA 1MV8A 1ADCA 2VHWA 3HUDA 4CJXA 2OGUA 3EZLA 3I9KA 2OUIA 1Z75A 2EGHA 2PR2A 4Z0TA 2O2YA 5ENVA 4HP8A 3V2GA 1DDOA 3JQDA 4AJLA 4LMRA 3UN1A 4EUEA 4BMVA 1TT5A 4PZDA 2VYVD 1LDYA 4K1LA 3V8BA 4CLXA 4IDGA 1GEGA 4PIVA 3GHHA 4PG6A 4BKPA 1LC0A 2NVWA 4D0SA 3PVZA 1FK8A 3FPLA 4YQYA 1FDWA 5DT9A 2GD1O 3RI3A 1XQ6A 4FPXA 4U6QA 5ILOA 1RM4A 1XLTA 2C59A 1NPYA 4YJGA 3AU8A 5JFOA 1MFPA 3HN7A 1NWHA 1Q0LA 3KYCA 3UF0A 2Y0DA 3SJUA 1HDOA 3RUEA 1I3NA 3I1JA 1TVEA 1DFGA 3MJTA 1BHSA 2EXXA 2ILTA 3DHNA 5COAA 3WIDA 3TQHA 4WEQA 1CDOA 1U5AA 3ETDA 5I9MA 4DWVA 2PGJA 5JY1A 2BI7A 3H5AA 4YAKA 1IZ0A 5ICSA 4B4WA 1YDEA 1ZK2A 3GAZA 4W7IA 4AG3A 4OHUA 3TWOA 2X1HA 2IXBA 1JKJA 1UH5A 2HK9A 3O8QA 4FJ0A 4IINA 1M76A 1V35A 4Z0HO 1XEAA 3P2YA 1NFRA 2WE7A 1I33A 2UVDA 3INRA 4UAGA 1Z7EA 2ZK7A 5ILGA 3KLMX 4LSMA 4ONEA 1U3WA 1YVEI 3U4IA 1SNYA 3A4VA 4FS3A 4UUOA 3MWEB 1E3JA 1R4MA 5TT1A 2I6TA 2D2IA 3E48A 4L0QA 3L6DA 3CZMA 1GY8A 1VL6A 2Z95A 5JAIA 4IUYA 5FF9A 5CFZA 5KVVA 5K6AA 1NNUA 5A9TA 1XQ1A 3DZKA 3QW2A 1E6UA 3GNQA 4RDIA 1NPDA 2NSDA 1HYGA 2ZB3A 1YL7A 4S3MA 3UICA 1PGQA 3RC1A 1SO8A 3D5QA 2GN4A 4G81A 3OP4A 1I01A 1XHLA 5G4LA 2HQ1A 4WUVA 3VZRA 4RPHA 3PFFA 1MG5A 1ZKMA 1GYRA 4B3HA 1LU9A 1UP6A 3H7AA 4TVBA 3B70A 4L8VA 3P5SA 1IYZA 1EZ4A 3ZH2A 1F12A 4CR6A 1HKUA 3U0BA 1JVBA 1M2WA 3RIHA 5L9AA 3W6ZA 3JD4A 4CM4B 4BNJA 1WMBA 2HSDA 1Z45A 5I7VA 3BMCA 5FWNA 3I5MA 3ROMA 2I3GA 3PGJA 3P7MA 1PWZA 2X58A 4DMLA 4E4YA 2HMUA 2VUUA 1QYDA 3B1KA 5A1TA 1IE3A 4FFOA 4LW8A 2DKNA 5IF3A 1UDBA 5JO9A 1T2CA 3M2PA 4W4TA 3QWHA 4KUGA 5JE8A 3TZKA 4MVJF 4G65A 4IDBA 4IMRA 5CPBA 3BTOA 4CMEA 3FR8A 4KUHA 1XSEA 2JHFA 1BVUA 2RH8A 3M6IA 3VH2A 2P91A 4IQ8A 3ANLA 4LSWA 1E7QA 3L4BA 2IXAA 3E03A 1KEPA 1E5LA 4PGFA 4Q39A 3K2EA 4ALLA 2YFHA 2AE1A 1SB9A 4ZQHA 4CM8B 3P19A 4ZD6A 4J0FA 2HU2A 4O63O 3PYMA 5IJZA 2P4HX 4E13A 1Z6ZA 3TPCA 1NYTA 5EERA 1WDMA 4YRBA 1G0NA 2PV7A 1NQTA 1N7HA 4NZ9A 1VI2A 2FZWA 2BKAA 2DTXA 4ZJUA 2PGDA 5DN9A 4CLEA 2VNAA 3E9NA 4GX0A 5H81A 4XQEA 1MC4A 3O4RA 1JA9A 1X13A 3PZRA 1U4SA 2PGLA 3ASUA 1PJ3A 1O95A 2FY8A 5A9RA 1E3WB 1R4NA 1OAAA 1SOWA 2O4CA 3U9LA 4CR8A 3JQFC 1A4IA 1SCUA 3MJVA 1LDNA 2X9NA 1Z74A 4MIOA 3ZWYA 2PY6A 1BGVA 4DC0A 5JXWA 5U1PA 3N7UA 2NQ8A 4H3VA 4AJKA 4B7CA 2Y1FA 4DRYA 4F6CA 1E92A 3GDFA 1EEHA 3QIVA 1G6KA 4WLVA 3HDYA 4CL3A 1ADBA 1DIHA 3DZIA 3GVHA 2IZ1A 4M89A 4U8GA 3VVCA 4XZ3A 2HO5A 4K26A 4RVFA 2QZZA 2E37A 3RCBA 1QLHA 3GNSA 3I9OA 3M1AA 4Z6KA 2O2SA 1DB3A 4QX6A 4M87A 3V2HA 1EE2A 5GY7A 5CDGA 3PQEA 1AXGA 3MWDB 3OEWA 4CMCA 4BKRA 3VH3A 2DVMA 2EJVA 1PZHA 4GMFA 3E9QA 5TNXA 4OKNA 2FRDA 2RH4A 2B4TO 1Q7BA 4CUKA 4I1IA 4P8RA 1A9ZA 1U8FO 4EEZA 3MEQA 1Q0QA 1P9LA 3T4XA 3UCXA 5EPOA 1P1IA 3ETGA 2V65A 3AOEA 3GRPA 1U9JA 2HK8A 3VZSA 1NQOA 1D1TA 1KEUA 1Y8QA 4J7UA 5L4LA 1JW9B 2PLAA 1EFKA 4CMIB 4CLRA 3DMYA 5JDIC 2Q2WA 4I08A 3D0OA 4BNXA 1GCUA 2Q1UA 4AJOA 2SCUA 4D44A 2AQHA 2E4AA 1B8VA 2CF6A 5LCXA 5BNFA 1LX6A 4RVDA 2ZTLA 4Z3KA 2VZ9A 4W9NC 4CQMA 5KJEA 3JQ7B 1DIAA 4QECA 3DAGA 1FDSA 2QG4A 2YZ7A 4QSMA 5GZ6A 4IDFA 4DYVA 1FJHA 1YOVB 3RFXA 1NTOA 2C29D 4Z9XA 5A3JA 1DEHA 3LYLA 3JD0A 3OF2A 4LN1A 2Y67A 1T2EA 3WGGA 3WNQA 3RASA 1T1RA 4KTTE 3FI9A 1O0SA 5KKCA 1ZXBA 1E7MA 4J49A 2A94A 2AA3A 4DIOA 4YB8A 2D3TA 1GZ3A 2DBRA 2DBZA 3QWIA 1J4AA 5JDCC 3N58A 1PX0A 3KLPX 1H2BA 2A92A 4AJNA 3ENNA 4MKXA 4CQLA 1HT0A 2XF8A 3EVNA 2RAFA 1ZUD1 5IAAA 5IN4A 3AY3A 4RZIA 1M67A 1W73A 1PJLA 2EF1A 3FBTA 4UEOA 1QLJA 1VSUA 4IZIA 2OL4A 1NFQA 2CD9A 2EWMA 5KJ6A 4TRNA 3H3FA 1XDWA 3MOIA 1CETA 2JL1A 1DLIA 1Y81A 4TRRA 3QVTA 1BXGB 4I9UA 2GRAA 1ZJYA 1PGOA 2X0NA 1CQJA 5EMHA 3H65A 3T7CA 3VPSA 4C7JA 1GFSA 2EGGA 4EYEA 3UAGA 1ISJA 4GGOA 1B7GO 2Y1CA 1E1LA 3GUCA 1HEUA 3JTMA 1ADGA 1LNQA 2HRBA 3DMTA 5A9SB 1IL0A 4EUFA 4E5YA 3NGXA 2Q46A 3I4CA 4GI2A 3W8FA 2BFOA 5IZCC 1GZ4A 3PRJA 2BHLA 2WSBA 3NTRA 4R3WA 4X54A 1LLCA 3DTTA 5DDIP 3QRWA 2X23A 5CEJA 4CQMD 2D5CA 1DRWA 3D4OA 3RU9A 4IXTA 3GZNB 3ZNQA 4RPKA 2EJWA 5ICMA 4PLYA 1LSUA 4YQZA 1IHYA 3BZUA 4B4VA 3A9WA 1U3VA 4UVGA 1LJ8A 8LDHA 1TXGA 4EDFA 3ZNPA 1N7GA 1H94A 3NEPX 1ONOA 4XQGA 2VTEA 4R5MA 4ILKA 4J91A 3QA9A 4ZQGA 4HFRA 3VTZA 2F00A 2RCYA 3DOJA 2X4GA 5JMWA 1E1NA 1HDYA 4AVYA 4Q3DA 4NBRA 5CG1A 3H9QA 4FOSA 1HL3A 5KTKA 3GOHA 2HAEA 1WAMA 2UYYA 1O5IA 3E6AA 4BGEA 2NU7A 5JAQA 1UAYA 2Q1TA 4J1TA 3ZWVA 1PL8A 3ICCA 4IIVA 3AM4A 4WJZA 4JJGA 1EBUA 3OA2A 4XIJA 3K31A 1XGKA 3ICPA 3PDUA 4RVHA 2J3HA 3HSKA 1GQYA 3ZWAA 4BO1A 1KERA 1KY5A 1LDEA 3EAGA 1M6WA 3RVDA 1ISMA 4ND5A 2GR9A 2PKQP 3VVBA 3B6ZA 5L7YA 4E32A 1DBVO 4YAJA 1CIVA 2GCGA 2ZJ1A 2XXJA 2VYNA 4BNNA 4JGBA 1A27A 1WNTA 3IL2A 2Q1WA 3IP1A 3PWSA 4UUNA 3TZQA 4DPKA 2Q2QA 4BO6A 4G5HA 1QP8A 5TGDA 1C0IA 2A9FA 4MINA 4MVJE 1KIFA 2OOSA 4RCVA 5JO0A 3NT4A 4Z9FA 3KSDO 4E5MA 4N54A 4BNVA 5JAZA 5I9LA 3CXRA 5DCYA 3PQDA 4L74A 4DVJA 4FDAA 2AG5A 1LA2A 2HUNA 4OO3A 3DXFA 1NVGA 4FIZA 3PJFA 2NVUB 3QHAA 4LVUA 2C5AA 3PXXA 3G0OA 3HN2A 1WPQA 4GVLA 3DBHB 1XA0A 1R16A 1HZJA 1P3DA 1ML3A 3RFTA 1KEWA 3ENKA 3VHRA 2FPGA 2C7VA 5IDQA 4K6CA 2EKQA 3DQPA 2P9CA 4RLSA 3GFGA 3HWRA 4CM8A 3LDHA 3RQSA 4A03A 4YT2A 4NFHA 4AICA 2VZ0A 4NMHA 1DIBA 2GYYA 1BVRA 1N8KA 4DQXA 3C7DB 5CEFA 2ZKLA 5BSGA 4PG7A 5IXYA 3WDSA 3FCOA 2X86A 4IM7A 2I3AA 1PGNA 4HKTA 3MJEA 2DPHA 3KO8A 3WYCA 4PLVA 1O6ZA 3JQAB 4J9VA 1LBEA 4BNKA 1ENOA 4XYLA 4IQ0A 3LK7A 2AEJA 3HDHA 5I8ZA 3V1UA 1I32A 2X9GA 5K6AC 2IODA 4UULA 2VYND 2VZ8A 3WBFA 4M1QA 2LDXA 2QZ9A 5IDXA 4J2OA 3NRCA 5ITVA 1N9GB 1KVTA 1I30A 1Z7BA 4P4GA 4F46A 5AYVA 3N74A 2B69A 2O7SA 1DPGA 3F5SA 1I2BA 1GU7A 4OSOA 4DREA 4B8ZA 1E3SA 4PN3A 1D8AA 5C5IA 1YJQA 1WW8A 2VRBA 3VZQA 1P31A 4J7XA 1J6UA 4JBIA 4ZVVA 5H82A 2BGLA 2I76A 3TZ6A 3S8MA 5BSEA 3K92A 5ITWA 4B4UA 1PR3A 1JKIA 1B8PA 1UJMA 2HJSA 2RIRA 3KXDA 3O26A 1A5ZA 3S2IA 3MOGA 4XYGA 5TLSA 1DIRA 4FB5A 5CDSA 5IZ4A 5L4NA 1YO6A 1D3AA 3DFUA 2IEDA 1H93A 4PLGA 3DBLA 1PJQA 1NAHA 2ZYAA 2QQ5A 1UXKA 4BMSA 3ZCXA 1M66A 2QX7A 2X0JA 3ORFA 2GN9A 1YWGO 2I9PA 5F1KA 4AFNA 3AUTA 5KNLA 2DFDA 4U7WA 4CMEC 3HDJA 2I5PO 4FD3A 3DR3A 2JCVA 3RUAA 2C07A 4U6SA 1U4OA 4K6FA 3AI3A 2GZ3A 4D45A 1P0CA 1H6DA 3BTUA 4NG5A 2UV8A 3I52A 4R9RA 4O5OA 4CMIA 1PJ2A 4NJMB 3L4BC 2FHSA 2IYPA 1EMDA 5AOVA 4WGGA 3A28A 3PJEA 2V6GA 1Q2XA 3QWFA 3E1KA 4II2A 5AXDA 4BV8A 3FBGA 3QJ5A 3GZ4A 1H6CA 3CSDA 5KKAA 3RD5A 2ZB7A 1FXSA 2EEZA 1ONNA 1EVIA 3JQ7A 1BMDA 1N1EA 4BIIA 3LC1O 4NQZA 3ZHYA 4PLHA 5CAEA 4KP7A 2PZMA 4P4LA 5FI5A 1GADO 3T7EA 3CKYA 4DPMA 1BG6A 4FBGA 4QT0A 1X1TA 3ZWOA 4UVEA 1UR5A 2P2SA 4N5LA 3EK2A 4GPD1 4WEOA 5JAMA 5U4QA 1B16A 3I6IA 4Y67A 1M75A 1Q1NA 5I7FA 1N2SA 2R2GA 2Y93A 2ZIZA 1HSOA 4KUEA 1EDOA 1R6DA 2WWRA 3E82A 2HMSA 3PHGA 2DFVA 3DBVO 2AQIA 1B3BA 3QV1A 1C0KA 3HB4X 3ONDA 1KS9A 4EITA 1R0LA 2NLOA 4JROA 2Y0CA 2OZPA 3OQ1A 2C5EA 2IE0A 4J4HA 1AXEA 2W2LA 3RUIA 3BHIA 3K73O 4J0EA 5B4UA 5KVCA 2FP4A 2AQ8A 4PG4A 3U4HA 4CLOB 1BTOA 4CMBA 1W4ZA 3D4PA 4YAEA 2IYOA 4QO7A 1C1DB 1DLJA 2E6UX 4DUPA 1PTJA 5FI3A 4OSPA 2WD7A 2O3QA 4PLZA 3ITDA 3OQBA 1YBVA 4R01A 2FZEA 3ZV3A 3KTDA 3RAJA 3BMOB 2C82A 4IQGA 4EJ0A 1PEDA 3ADOA 3RUCA 5CDYA 4CUJA 3RJ5A 3VDQA 2PD3A 3R3SA 3VC7A 1U7TA 1E1MA 1SZJG 3LT1A 1T1SA 4KZPA 1NR7A 2YV1A 3NGLA 2WE8A 3AOEC 5JYEA 4FOOA 4R68A 4WCDA 3SX2A 2BFAA 1I5RA 3JYPA 2GNAA 3AFNA 3VPHA 3PGXA 4BO5A 4Y98A 1ZXLA 3ZHXA 3AOGA 1L7EA 1HF3A 2Q4BA 3OIGA 1C3VA 3COSA 5BR7A 1NHWA 1RM0A 3GZNA 5THKA 1C14A 5MGBA 1YL5A 2GN8A 3WBBA 1XU7A 1XU9A 1KVUA 1P77A 4BGVA 3E9MA 1AHIA 3JD3A 4FN4A 2DM6A 2OP1A 5ES3A 4J90A 2ZQZA 1ULSA 3DBRB 2CDBA 3UOGA 2WM3A 1ZK3A 2GSDA 1X1EA 4EJMA 2G76A 4XB1A 4ZICA 4S1VA 3I6QA 1J0XO 4RF2A 4NDNE 1Y8RB 4HNGA 3VH1A 4KTVE 3STHA 1G1AA 2IZ0A 4B3JA 2V6FA 3KYDB 4RORA 3Q1LA 2FR8A 5DF1A 3DTYA 4EGFA 4AJIA 1SC6A 2W2LD 1YQGA 5TRTA 3QVXA 3WGQA 4BO2A 3NUGA 4QUKA 4A7PA 3WMWA 2P9EA 3OBBA 4CM6A 2BGKA 3AW9A 2Y0EA 3F4LA 2ZATA 3DHYA 4UVDA 4PCVA 4BL5A 2YHIA 4E3ZA 5A5FA 2Q49A 1MLDA 4JP2A 1HLPA 4ZA2A 1IOLA 4HXYA 5F5LA 2PD4A 5IXSA 1TT7A 4FFLA 4XB2A 3EVTA 1YB5A 2C0CA 3ITKA 4MVJG 4PZEA 1NVMB 4LCJA 4Y6PA 5FFFA 2J5KA 1VSVA 4NHEA 3RUHA 3ZZNA 4D7AA 1LSSA 2DLDA 3JQGB 3GH3A 3AY6A 3HNPA 2NU8A 2V6MA 4E2YA 2X8LA 1HETA 2AE2A 4I5EA 4BNZA 3VZPA 4IBOA 4BO9A 3QWBA 3F46A 3OM9A 4CMGA 3RWBA 4TZKA 2B36A 2X5OA 3UFXA 1V0JA 5L4SA 1BXZA 1DO8A 2FOIA 2LDBA 3HZZA 3PHLA 4BNTA 2IRWA 1DSSG 9LDBA 4CM3A 3ZU2A 2TMGA 4RLHA 4I8XA 3GG2A 1BRMA 1ARZA 1PZFA 2O50A 1QORA 4ZQBA 3ZHZA 5IN5A 4MKRA 1DIGA 3LT4A 5L51A 4WNIA 5DULA 1R0SA 1S6YA 3PIIA 4GBJA 1X14A 1F06A 4CR7A 1GUFA 2JFHA 3WQRA 3F1KA 3A06A 3ZW8A 4XDYA 4ND2A 3ANNA 4YJHB 1YL6A 4J1QA 2R6JA 1M6HA 1KC1A 1KBZA 2V7PA 4WLFA 2VRCA 1TEHA 3SC6A 4EI2A 5C3MA 3UHAA 1LLUA 3ZWBA 2VUTA 2FWMX 3EGOA 1ZJZA 1JQBA 1PR9A 3ABIA 1U8XX 5F1OA 1KY4A 3PYXA 4AJJA 3KSUA 1GCOA 4Y8VA 2YJZA 3NT2A 3U3XA 2CF5A 4HADA 4RVGA 3WGTA 5CDUA 4KWHA 2VUSA 1DAOA 4ITUA 4RPGA 9LDTA 5JS6A 3QY9A 1FDUA 3C7CB 4FC6A 3H9EO 3TL2A 5EIOA 4Y9DA 1PJBA 1NWCA 1OMOA 1DFIA 4XWYA 1Y5MA 5LC1A 2XOXA 4RPLA 1VJ1A 1K89A 3TSCA 5JNLA 5F5NA 2B35A 5TF4A 4BB6A 1N9GA 4WOKA 4O59O 3W4IA 1K0UA 4BKUA 2Y1EA 1PJCA 1S7CA 1UXGA 2NVBA 3VH4A 2PZLA 4HFNA 2EV9A 3TJRA 3R6DA 3GVXA 1MC5A 3NT5A 3GVIA 5COQA 4ALIA 1SB8A 5A05A 2YDYA 4XRGA 4GVXA 3G1UA 2BF7A 3AM5A 3ONFA 3KSZO 3M1LA 1R0KA 2GPTA 2O7QA 1LLQA 4OJNA 1T2DA 4BO3A 2BFMA 1AUPA 4DXHA 4RQTA 5FEUA 5G0UA 2EG9A 4FFRA 5L7TA 3I9LA 2E49A 1QYWA 1UZNA 5G4KA 3GGOA 2GUGA 1IHXA 4TVOA 3GDGA 2WYWA 4UVHA 1E5QA 3QQPA 3WLFA 5F3RA 1U2DA 3F47A 1B26A 3JQ8B 4A73A 3PDJA 1UXJA 1QRRA 2VRCD 3S1LA 1QV6A 4IJVA 2Y1DA 4ZRMA 2AEMA 1CERA 1IUKA 3CPSA 4M86A 2OFPA 3BAZA 3K96A 2I99A 2X0IA 4QXMA 1DJQA 3GMSA 1RKXA 1UZMA 2VT3A 3WX0A 4FCCA 5U9CA 4JJIA 1XG5A 4L4XA 4NJMA 4D43A 1Z82A 2QRJA 1J49A 2YYYA 3WSVA 1DHRA 1EDZA 1FF9A 4D0RA 1SAYA 4ND3A 1B8UA 1U3UA 1H9AA 3KB6A 3DAPA 4TRJA 1KVQA 3MTGA 4XGIA 4WECA 4KOAA 2GF2A 3RBXA 4EJ6A 2Y99A 5K0ZA 6LDHA 2JHGA 4U5QA 2VCYA 3D3WA 3GK3A 2Q3EA 5T8KA 3OH8A 1F14A 4GWKA 3JD1A 4CODB 3WJ7A 2CNBA 3V2UA 1HE3A 1RJWA 2FPPA 3E18A 3H2ZA 3OETA 4U0JA 1NPTO 4D3DA 4BO7A 3I9JA 3FPCA 1YJ8A 3R1IA 4OAQA 5AXAA 4Q3BA 1OOEA 1R37A 3DONA 2QRKA 2GASA 3GA0A 4D46A 4D42A 4P38A 3OIDA 2Q4EA 2PH3A 3BTVA 4MVJH 4IDCA 2XAAA 4QFCA 5KOIA 2VT2A 1CF2O 2G82A 1MXHA 3GN2A 1V6AA 1NR1A 3ZDFA 4A26A 1PQPA 4R9SA 4XQCA 4NBTA 3PHJA 5L53A 4ID9A 2WYVA 2QYTA 4CLOA 1F8GA 3HQ4O 5G0WA 4GX1A 2DT5A 2UAGA 3FR7A 3IUSA 1B15A 4H16A 4WLNA 1I3KA 4AJEA 3KEOA 4XX0A 3V5NA 1ZK0A 3S2FA 4BO0A 4BGIA 1DAPA 3AUAA 2YV3A 2ZCUA 1QG6A 3DFZA 4GX2A 4ZQEA 1ENPA 4YBZA 3KVOA 4BMNA 1T25A 5ER6A 1VM6A 1V3UA 5CEEA 3GEGA 4DLLA 3ZWPA 3AJRA 3FNHA 4J16A 1QKIA 4OOFA 2HDHA 2Q45A 3WJAA 4BNMA 2P68A 1KETA 3NTOA 3U09A 1ISFA 2YFQA 1ZIDA 3IAHA 2HMVA 3GT0A 1YB4A 4BNUA 3KOUA 5FYDA 1G0OA 1PGPA 4NJOA 3GPDG 3MCVA 2NTVA 5DZSA 4DMMA 1P44A 1SEVA 5BNIA 2GO1A 5DP1A 4NH4A 3H6KA 4XEHA 4JBHA 1U5CA 3IP3A 4BNIA 4RDHA 3DBRA 4YA6A 2R00A 3BMNB 1A9YA 4L9RA 4MDHA 4Q9NA 4O1MA 3AWDA 1EBFA 2O3SA 1H2HA 4ALMA 4TROA 1WZIA 2V6BA 4E33A 3VKVA 1H0KA 1CQIA 2PFGA 1V8BA 3VPGA 3QWAA 2E48A 4I9HA 1HYEA 4HV4A 3OJEA 2VOEA 3LSYA 5BSFA 1TT5B 1YRLA 4YJDA 4A27A 4MIYA 3ZW9A 2D8AA 4F45A 1SMKA 1Y9EA 4H7PA 3CH6A 4QFDA 3WMXA 4E21A 1A4UA 4GKBA 2X0RA 4B8WA 1GTMA 1H5QA 4B3IA 1T4BA 3I23A 2I67A 5AXCA 1BWSA 1UAGA 2GZ2A 2UDPA 2OP0A 4TZTA 2AHRA 3ROPA 4NU6A 4PZCA 5C37A 5KCZA 1ISGA 3D5TA 4J3FA 5EN4A 3QVSA 4M8SA 1WLYA 3GQVA 4HFJA 4D79A 3P2OA 1CEQA 1WXDA 2VWQA 4L73A 4ND1A 2DTDA 5HBRA 1UP4A 3FNGA 4MVJA 5TC4A 4MKZA 3GGPA 4IPTA 2VQ3A 5H83A 3K2BA 3OICA 3A1NA 2CSUA 1E6WA 2QHXA 1E6EA 4GGPA 4BOYA 4K28A 4HBGA 1K2WA 3W4JA 4B7UA 3LC7O 1ZEJA 3F6YA 3WTCA 2D1YA 3KEQA 2ZJ0A 2JAPA 4GLOA 4OQYA 1QYVA 4RV9A 5G0TA 3U62A 3JQBA 3LT0A 3ADPA 2O4UX 1X0VA 1U28A 3K8ZA 4D3FA 4QEDA 2FR0A 3DZFA 4BV9A 2PZJA 2WTBA 1DXYA 1EVYA 3DC2A 3C1TA 4YRAA 1DRUA 1N92A 2GN6A 3GC6A 4J9UE 4MP8A 1L1FA 5CG2A 3BIOA 2Z1MA 1GAEO 1LSOA 4ALJA 1LQUA 1OBFO 4ZHSA 2HK7A 2QW8A 4NBVA 1UZLA 4CM4A 3CZRA 4BNFA 2EIHA 2YV2A 5KJFA 2VWPA 1I2CA 3G1TA 3LF1A 1VE9A 4OXKA 3SBOA 4GQAA 2X6TA 3VPFA 1LLDA 3PHHA 2BFPA 4OIMA 1GZ6A 3RBZA 2GLXA 4LISA 3RSHA 4YJHA 1GDHA 1YE3A 5T6BA 3R0IA 1IZ9A 2NNLD 5K9ZA 1PS9A 1HYHA 1NM5A 1EQ2A 1W6UA 2O48X 5ADHA 5DBIA 1ULUA 4Z9YA 3FHLA 4TKMA 4ALNA 4YYZA 1X7GA 4D41A 5IDYA 1JU9A 3CEAA 1YS4A 1LC3A 5KWEA 2DC1A 3TL3A 2Y68A 3IKTA 3EDMA 4DTIA 5B4VA 2QRLA 4IZHA 4LK3A 2VOJA 4CV1A 1HE4A 4CMAA 4OKIA 2NV6A 2IEBA 3ZWWA 1UXHA 2ZB8A 3HG7A 2D0IA 3BMCB 4NBWA 4EZBA 5A02A 1DJNA 1P45A 1LI4A 5AXBA 5HRUA 1WWKA 3RC7A 4ZGWA 3OFSA 3VKUA 1GYPA 4FJ1A 8ADHA 3PLNA 1PL6A 5LDHA 4MVJI 4BS9A 3AM3A 3WFJA 1V3VA 5BNTA 3Q2KA 4J4TA 2JAHA 3ZGYA 1E7SA 1UUFA 4FFMA 3W6UA 2VNSA 1ZMOA 5EINA 1GPJA 2HKIA 3L07A 4A0SA 2CDAA 1LRKA 2H5LA 3TFOA 3BMQB 1GUZA 1E3WA 3Q11A 4MP3A 3SC4A 5TQVA 5HA5A 1A7KA 4R5HA 1V3TA 1H6BA 2A4KA 1F0YA 1P1HA 2ZB4A 1PS0A 2GERA 3E8XA 1NQ5A 1GQ2A 4LGVA 4WK6A 5GMOA 5A5EA 5DBFA 4MVJP 3U4DA 1B2LA 3C24A 3TZCA 4RVUA 2AXQA 3FN4A 2PNFA 3RC2A 4M55A 5B1YA 1PWXA 1LEHA 3C7AA 3JQ9A 3PK0A 4GSKA 4KQXA 3AFMA 3TN7A 1Q0HA 4JQCA 3JCZA 4JJFA 4YXFA 4U0KA 1EUDA 1O94A 2CVQA 4UREA 4KQWA 3JQ8A 1SEPA 3DDNA 3TF5A 4YRDA 4UUPA 3WIEA 3AUSA 4WLOA 3AUUA 4GX5A 1EFLA 2YY7A 1I36A 1PZGA 1DC5A 4XA8A 1R4NB 1ZO8A 3D3EA 1WP4A 3R3JA 1VC2A 4CL8A 5AVOA 1DFHA 3ON5A 3CINA 4WOJA 1HXHA 5EJ2A 2UUPA 3ZNNA 1CYDA 1Z73A 4IXWA 3HHPA 4JLWA 4UEKA 2FSSA 4L76A 3BHMA 2DU8A 3CTMA 4DLBA 1EK5A 2VWHA 1YQXA 2EW8A 3H3JA 4GH5A 2HLPA 2IDZA 3VOSA 3PP8A 2BLLA 4E6PA 5IFLA 4JX8A 4NPCA 4WCFB 4IIUA 4BVAA 2ZCVA 4W99A 5BQFA 2OBYA 4NNJA 4NFYA 5KJ1A 1ZVMA 4QTZA 4YTEA 1MFZA 3G49A 2B4RO 1ENZA 4ZQFA 1OC2A 1GUYA 3WGIA 2JCXA 3DAFA 4G2NA 1E7WA 1EQUA 1RM5A 1YBMA 3GHYA 4XQ9A 1I10A 2ZYGA 2PKQO 4LCEA 2PWZA 1YOVA 4RPJA 4PLCA 4E12A 1P0FA 2J5QA 1OZAA 3OIFA 1NXQA 1P33A 5I7SA 2OHXA 2JJYA 3ZU5A 4J7CA 2JFFA 4DQUA 1JTVA 3EMKA 3DB2A 4FGWA 4J4BA 3KRTA 2X22A 4CM1A 1A71A 4JNKA 3PI7A 4Q3EA 5DOZA 2TMDA 4WASA 1P1JA 3JV7A 4W6ZA 5LDGA 1GEEA 2DUUA 3ZU3A 5MDHA 1YBAA 5TX7A 1SOVA 4IDDA 2DPGA 2FR1A 4DBVO 4RZHA 4CMJA 5G0SA 5F21A 4PVDA 4CM5A 4RJTA 5JW6A 4PG8A 3NTQA 1E3EA 4XRRA 2BGMA 2CVZA 4TSKA 2CVOA 5JY6A 4CQMB 1UDCA 2XPCA 1Y1PA 3SLKA 3L0DA 3I9MA 1BXGA 3Q2IA 2UUOA 1XKQA 2JFGA 3OA0A 2O3JA 2ZTVA 2IZZA 4KWIA 3TOXA 4GL4A 1QV7A 5JMPA 4YCAA 3MJ4A 3BA1A 2W8ZA 3RU7A 3WFIA 1WDKA 3C8MA 4ZU3A 5A9SA 4CQLB 5DCUA 4J1NA 2AG8A 4IJUA 4RO0A 4L75A 7ADHA 1F8FA 3WSWA 5I7EA 1ZBQA 3CIFA 4OGWA 2EHDA 1JN0A 4BKOA 4EW6A 1XR3A 1UDAA 3TRIA 1LUAA 3JYNA 4RVSA 3IS3A 1TA4A 4CPDA 1JAYA 2CMDA 3KUXA 3GF4A 4KMSA 5JBIA 2BI8A 3BMNA 1PS8A 3NDJA 3WQSB 4CLDA 3HB5X 1ZFNA 5T8KC 5T5QA 3UXYA 5B12A 1IPEA 3VPXA 4JXKA 4XIYA 1VKNA 1UXIA 2P5UA 5EQFA 3NJ8A 3NJ4A 2W98A 3OEYA 4ROSA 3WGZA 2CUKA 5L45A 1CJCA 1JLLA 2GGSA 5I9NA 4J2HA 1PJSA 5JC1A 1IB6A 4AJPA 3OJFA 4OXYA 1NX6A 1JDJA 2I66A 4INAA 2J8ZA 5KVQA 3IUPA 3IJRA 1NASA 3PHIA 2HJRA 3FWZA 3LLSA 4BQRA 2ZYDA 3INTA 3DWFA 4BQPA 1GQQA 1VRWA 4BO8A 4O6VA 4BNGA 1LDMA 1GV1A 1U3TA 2VHZA 1DHTA 4OM8A 4IJWA 2GDZA 2BELA 1E3IA 2D4AA 3GVPA 2NU6A 5HS6A 3D7LA 1K6JA 1HDZA 3RKRA 1P74A 1PJ4A 2CZCA 3ROKA 1YB1A 2CDCA 1OFGA 4R1NA 5B37A 2OO5A 1MA0A 3ZWXA 2PZKA 1C0LA 3PWKA 1ADFA 4F6LA 4B79A 1T24A 3IKVA 3F1LA 3A14A 1QYCA 1NAIA 1WMAA 3QVWA 3SLGA 3PPIA 3E5RA 3I9NA 5EL0A 4GWGA 3W1VA 5L3ZA 1ZH8A 3UCEA 4YR9A 3ZN2A 1GL3A 3DMTC 2EP5A 3L9WA 4DA9A 4PLFA 3WGHA 1LTHR 5AQ1A 1PL7A 3PZBA 3RFVA 5JC8A 4A10A 3H9UA 4BUCA 3GUYA 3DZGA 2OXIA 4OH1A 4YJFB 5TT0A 3VTFA 3BTSA 1HDCA 3PLRA 1N5DA 4OXNA 2G17A 2O3TA 3OQ6A 3S2GA 2R00C 3L6EA 7MDHA 4F3YA 1GYQA 2HMTA 1UP7A 2YUTA 3MZ0A 2NVUA 4TMFA 3S55A 2H6EA 3QP9A 3I3OA 4OMUA 2YDXA 2O23A 3T4EA 3O38A 4BNYA 1KVRA 4IS2A 3OJ0A 2NM0A 3DBHA 4B4OA 3W8EA 4P4NA 1E3LA 1T4DA 4YT5A 4XJSA 3UKOA 3AK4A 1ZEMA 5EESA 1HZZA 1NVTA 3IIEA 1VL0A 2Y05A 1PZEA 3KZVA 2JD0A 4DIFA 2DQ4A 4PLWA 1EVZA 1LRLA 1CRWG 2Y66A 4ZN6A 1IY8A 1PQWA 3FRJA 4FFPA 2VWGA 4E0BA 3WICA 1T2AA 3GLQA 2Q99A 2E82A 4UUMA 3NAQA 2JD2A 3W4KA 4I5DA 3DOOA 4W7HA 1Y9AA 1X7HA 3JQCA 2EW2A 3JQAA 1E1KA 1HTBA 4JBGA 4KDEA 3HADA 1MG0A 1W0CA 2NTNA 2ZTUA 3EZYA 1D7OA 3BMQA 4E2ZA 4YVFA 4XYBA 1BXKA 2CY0A 3M2TA 2AW5A 3WYEA 4M49A 1JAXA 2PKRA 1KYQA 3K5PA 3JQBC 4CV3A 2WYUA 3MJCA 1ZMTA 4RF3A 3B1FA 1K6IA 3F4BA 1HDRA 1JVSA 3JYQA 1AHHA 1XCBA 3L9XA 4DGSA 5DBGA 2AEFA 4FR5A 4IY1A 4R54A 4DIBA 3DZHA 6ADHA 2X5JO 3ZWCA 3OSUA 4ZRNA 4QO8A 4MP6A 5A4DA 5DNAA 5EQDA 2FPIA 3WGYA 4GMGA 5TS3A 2HMWA 1Y7TA 3FNFA 2H9IA 3FTPA 1Y5RA 4R1SA 2B0JA 1GV0A 1P1KA 3HDQA 3INGA 3ROQA 1KVSA 3SEFA 1DC6A 4FFNA 3TZHA 4R4JA 2JCYA 1BSVA 1Q7CA 3NDIA 3ZV6A 3UVEA 4Z3DA 1XYGA 3MTJA 4BB5A 3KM0A 4I5FA 2HCTA 4DYDA 2OORA 2QYSA 1AE1A 3U5TA 3KBOA 3WR5A 1X0XA 2C2YA 2J3KA 1T2FA 2J3JA 1P1FA 4HNHA 1CWUA 1ZK4A 4PLTA 1DOHA 1PSDA 1YXMA 2BMAA 3DO5A 5C7IO 5JSFA 4E2XA 1K6XA 1BW9B 2YQ5A 4WCFA 4MVJM 1HDXA 4EEXA 4R41A 1DC3A 4BNWA 3JQAD 4AJHA 3GPIA 3TFQA 3OECA 3WNVA 1C1XB 3O03A 3C1OA 2W2KB 4FW8A 1SBYA 2B4QA 2I65A 3ZWMA 1QR6A 4IDEA 4XR4A 1MX3A 4CM7A 3DBLB 4XGNA 4WLEA 5A03A 1I2ZA 4TQGA 3IQDB 2VHYA 1RWBA 4NIMA 1K5HA 3LU1A 5IG2A 3DEYX 3B20A 4ESOA 3F5QA 1D4FA 3QVOA 4DQVA 3WWZA 4E5NA 3UH1A 3H5RA 3GVCA 3FSRA 4WNCA 3BXXA 4TKLA 1LXCA 1QSGA 1QYXA 4CMKA 3GFBA 3QE3A 1MP0A 2NU9A 1YQDA 3UCFA 1R12A 3JQ9C 4QQRA 3G3EA 3V1YA 2POQX 2Q50A 2W4QA 4D3SA 4XDZA 3H2SA 2Y1OA 1PU2A 1N1GA 3H9GA 1A72A 1AGNA 2P4QA 3VDRA 1V9LA 3G79A 1C1DA 2C7GA 5HM8A 3RJ9A 2DTEA 2H1SA 1LRJA 5JCJA 3JSAA 2EKPA 4NK5A 4MOWA 3Q9NA 4PFJA 3BMOA 1Y6JA 1HE2A 3EUWA 1VJ0A 1B0AA 1AN9A 5JPIA 2X7HA 1HRDA 3PJGA 4IDAA 2P5YA 4OL9A 3Q3CA 1MB4A 3SJ7A 2EP7A 3PQFA 1IPFA 1VPDA 1VKOA 4AL4A 1ISIA 3O9ZA 3WTBA 2O3UA 3IJPA 4KDFA 1QXSA 3AI2A 5DP2A 2VTDA 5ENDA 3PEFA 3WQQA 4ALKA 5C7LO 3IMFA 3GN1A 2VHVA 3EHEA 3C3XA 3ASVA 4YWJA 4A2CA 4YAIA 2QIOA 3WB9A 2RHRA 3BYZA 4NI5A 1ORRA 3V1TC 1A7AA 1YGYA 4XYMA 4IGFA 4IJKA 4MIEA 3ZV5A 2NADA 4A5OA 2WD7B 5G0VA 1K3TA 1F17A 1VL8A 3QLJA 3WGOA 3KETA 2DUWA 3GEMA 4HY3A 4C7KA 4Q3CA 4YDRA 2WJPA 4FSHA 3PFWO 1HWYA 3GAFA 2DBQA 1I24A 3LC2O 3ONEA 2C2XA 4IMPA 4XKJA 5JCXA 1H6AA 3U4CA 1Y8RA 3EY4A 4E31A 3LQFA 4MPDA 4BO4A 3IDSA 1ZSYA 2Y1GA 3ETEA 4IGEA 3UW3A 2YW9A 4DPLA 2B5VA 3KYDA 4BHTA 5BT9A 2WDZA 2CFCA 3H5NA 3ZNOA 4AJ1A 4YAGA 1NQAO 4HWKA 4J43A 2NUAA 2J5RA 1B3RA 1PGJA 2H63A 4YJGB 3EW7A 2WMDA 3AU9A 3L4SO 3ULKA 3K6JA 5COBA 1PJTA 3NKLA 3PJDA 1C0PA 3DHEA 3GG9A 3KYCB 4O0LA 5JLAA 1ZCJA 1DC4A 5JCJD 4YT8A 1X7DA 1NFFA 2AQKA 1HE5A 4CV2A 1FDVA 3RKUA 1O8CA 1XELA 4Q3NA 4GSLA 4R1UA 2J3IA 3C1AA 3PIDA 3ANMA 4GLLA 3JQGA 4TRMA 1VLLA 2DBVO 4LMPA 4OQZA 4BNHA 4N18A 4NU5A 1EUZA 4WKGA 4NFSA 2C54A 4E2WA 2EKLA 1Q7GA 4Q3AA 1ZSNA 4WPGA 3L6OO 4H15A 1I3LA 2FSVA 1ID1A 3O8QB 4CV0A 3JD2A 3TOZA 1BDBA 3JQ6A 3I83A 3JQEA 4NR0A 3CE6A 1LDBA 3WS7A 1R66A 3S2EA 4YJFA 1PIWA 5G2OA 3QSGA 3NDRA 2YHIB 5HS4A 1VJTA 1MUUA 1R15A 5GZ1A 4AJ4A 4YPOA 2BRUA 1R4MB 5L7WA 5JYDA 2JKVA 2VHXA 3OMLA 3BHJA 3RROA 4PVCA 5TJHA 2RBEA 4L4SA 3GGGA 4ND4A 2PA3A 1SPXA 1RPNA 2B5WA 2PH5A 2Q1SA 4FC7A 3I4FA 3G17A 1YONA 5THQA 4R51A 3U49A 3VAZA 3X2EA 3JQFA 4Y6SA 4EUHA 2W90A 4OOEA 1RYDA 3UUWA 3SXPA 3PYLA 4R16A 3WYBA 1LSJA 3C85A 3RUFA 2AMFA 3MJSA 3ZI0A 1KC3A 2C20A 1KOLA 1XWFA 2X5KO 5HWSA 1IULA 1E7RA 1LDGA 4UEJA 3WG9A 3SVTA 1EUCA 3CMCO 3WOHA 4RQUA 1TLTA 1WVGA 1QMGA 2G5CA 1TB4A 3EC7A 1WZEA 2PK3A 4I5GA 1EE9A 3HE3A 5KJCA 5F1PA 1GPDG 5TJ9A 1ISHA 3ZV4A 4LVCA 3H8VA 2D59A 1ENYA 1GD1O 4MVJD 4PG5A 5HTOA 1YH3A 3IC5A 4N5NA 3FWNA 3OHSX 5TSDA 5DOVA 4BKQA 2F1KA 1YKFA 3DL2A 4HUJA 3AY7A 1BDMA 1NBOA 4DL9A 5I8WA 3ZU4A 4GKVA 4FQ8A 1ZNQO 1U7HA 4R3NA 4MO2A 4PRKA 1OI7A 2YHUA 4EBFA 4XGKA 2Q2VA 2ZQYA 4R69A 3LLVA 4JK3A 3H9JA 5J23A 5ER9A 4RGBA 4N5MA 1I0ZA 2VN8A 5JDIA 2JD1A 3W8DA 5CDTA 2B37A 1D1SA 1O9BA 2XXBA 3IOYA 1ZK1A 4HX5A 1MGOA 4Z0PA 2OMEA 4E30A 3Q6IA 1NP3A 3KHUA 1PQUA 3LVFO 4J1SA 4W9NA 1JWAB 5L95A 4LRTB 4BNLA 2B83A 3FNEA 1X15A 4JN6B 1RM3A 3HFSA 1JKFA 1ZW1A 3RUDA 1L7DA 1T26A 2A35A 1E7YA 1JWBB 4CMHA 4CM9A 4TWRA 5IDWA 3CUKA 1MXFA 3OJLA 2FN7A 2FMUA 3WWYA 5JDCA 3B1JA 1ONPA 1HLDA 1U1IA 3D4NA 2Z1NA 4DLAA 3ZWNA 3DZJA 3GY0A 3DOCA 3WLEA 5T57A 1BW9A 4CUZA 5KIAA 1EVJA 3E5MA 1KEVA 3NX4A 3JYLA 3OJOA 1YDWA 3ZHBA 3GR6A 4L4RA 1RYEA 3RC9A 4M54A 1WDLA 3GMDA 4LRSB 2OBNA 1C1XA 4WE3A 1HDGO 3HJAA 2W2KA 5G4KB 4PLPA 1E77A 4I9NA 1DRVA 4XR9A 2G1UA 1ZZEA 4N7RA 2Z5LA 4RL6A 1LQTA 3FTNA 3LZ6A 4E5PA 1HSZA 2BD0A 3FD8A 4NBUA 4YEDA 1O89A 5C7OO 4RF5A 4XCVA 4UVIA 3K30A 5CHEA 5CPFA 4FGSA 2WD8A 1B14A 4GAEA 5T64A 2O3RA 4DC1A 1J5PA 5A3VA 2WEKA 2BH9A 2NQTA 3PTZA 2HRZA 4P22A 4XD2A 5IZCA 2RHCA 2VYVA 5BSHA 3KYBA 4JP3A 2DAPA 4RF4A 3NV9A 4XYEA 3H4VA 4URFA 2EERA 2ZTMA 1FMCA 1Y8QB 4K9DA 5A04A 1EK6A 2G0TA 3LT2A 1TI7A 3F9IA 3D3WB 3KV3O 4CLRB 5B4TA 4PRLA 3NYWA
chains in the Genus database with same CATH superfamily
3UJPA 1BJTA 4MWGA 4QM7A 3GEDA 5LQCA 1G59A 2DKOA 3TNLA 2BAGA 2BZ1A 1IDN1 2ZPUA 4KH1A 4PAWA 5T67A 1X6VA 3SS8A 3TLCA 3S8YA 3MJRA 4ZOAA 1E2JA 3K9QO 1VHQA 3IIMA 4CM9D 4FB5A 2ZRLA 3AI1A 3EWIA 1DEKA 3Q5DA 4TMKA 1N6IA 3WKDA 2H2HA 3JPYA 1B00A 1C5KA 2P9GA 5LMNB 1KMNA 2EL9A 3WXBA 5E4JA 4F2DA 4YACA 5DCWA 2IYAA 3H1PA 1DDIA 1R64A 3PDHA 2D5AA 2D1RA 1X3LA 4WLUA 3X2FA 5GZ3A 4AJ2A 1W8DA 2IY7A 3K35A 3WMFA 5TIIA 4B7XA 4TUYA 4XJTA 3UOWA 4F5WA 5AKJA 4OA5A 3ST7A 4ZOCA 2WQ6A 2NTEA 2XBUA 1L6RA 2BUBA 1L0BA 1R0YA 5TARA 4NK4A 3BSWA 3V4VB 2VHQA 2X9VA 4X7BA 1ZOOA 4JYAB 3R0JA 1QRAA 1JG2A 2JAQA 2O06A 3GNTA 3PC8C 3D1LA 3CUWA 4O2LA 4URUR 1W36C 3G1WA 1ZL2A 3I01M 3II6X 2QRGA 4BVLA 4ZYWA 3JXEA 3GDOA 2F6RA 2C3UA 5YASA 2B8EA 2PT9A 5TQ2A 3V1KA 1WDWB 4BGUA 2ZIFA 2C78A 3L7OA 1Z6QA 1XIVA 1GTL1 3H1FA 3HUDA 4YNBA 4CJXA 4ZTUB 1DC7A 4JLUA 5FA8A 3TW8A 1M6NA 3CO5A 2OUIA 1Z75A 2PR2A 3NTLA 3AFHA 4N1AA 4EMTA 3X1YA 2AOUB 5BSTA 3U2QA 3A9VA 1CQJB 3V2GA 2IIVA 1DDOA 3GFTA 3K6SA 1YTLA 4G4SP 5GVSA 3JQDA 3UN1A 1GQSA 2ORWA 2OT3B 4BE7B 3GGJA 4PZDA 2NPFA 2VYVD 2PO5A 1LDYA 1UK9A 3C3KA 3LO5A 2ACVA 1L4MA 2O7RA 4K1LA 5GAJA 1W7AA 2WT8A 3L5KA 3B5JA 4BKPA 4RFVA 1LC0A 3A9CA 1XYVA 4RESA 2DFLA 4LSGA 3WK7A 3LIPA 1MORA 4ZALA 3TCKA 5DT9A 2WUGA 2FLWA 3E7FA 3L6CA 4WTOA 4PC7A 4UQOA 3TXYA 4AUKA 5IJ9B 4YJGA 3W2TA 2V03A 3AU8A 5DJ5A 4C7BA 5IPFA 1FMFA 3WHPA 1Q0LA 3UF0A 3RAFC 4EZIA 3DVAB 3VDXA 2P1ZA 2VHEA 1HDOA 4TMWA 1TVEA 4ENSA 3BGWA 3SR3A 4IDHA 3W1EA 1A1SA 1BKYA 3MJTA 4MI1A 1ZN9A 4PWZA 4E88A 3W78A 3RO7A 4OJQA 1W96A 4YALA 3B1ZA 5EZ6B 5I9MA 3BWBA 3G2QA 5HTKA 4IUDS 3AY0A 1CZLA 1MBZA 2A88A 2R8ZA 4HXFB 4LHXA 1JHYA 1Q57A 4H08A 4LJLA 4NCIA 3GAZA 4W7IA 1ZU4A 5B3JC 5HIJA 2FE1A 4C4ZA 3HJFA 2VVTA 3JAWA 1JHXA 3IQGX 3K9NA 3L79A 4UNQA 2X1HA 1JKJA 3SQNA 2P79A 1UH5A 3LQ1A 2PJZA 2B8NA 4JI5B 1OAKA 3IILA 3P2YA 1ORDA 4MUAA 3FVVA 1F9AA 1I33A 1R4ZA 2MYNA 2NU7B 2OKCA 2UVDA 3H42B 3IBSA 3KJIA 2DQSA 1UMKA 1VPLA 2O7VA 2ODPA 3HM2A 3IKJA 4RJLA 1Z15A 3A4VA 5BSVA 1KI4A 2ERYA 4FS3A 1JJIA 3K1TA 1DRJA 1GPBA 3F7NA 2QAGA 2PNJA 1E3JA 5CM9C 4I8DA 1NRXA 1Y7PA 3E48A 5CFLA 3L6DA 4KO4S 2Z5VA 1SVKA 1GY8A 4XAQA 5FNVA 3SVZA 3NC0C 2AK2A 2GVDC 3BK1A 1Z0IA 2VQFB 1M1YE 3K4QA 3OZBA 1XQ1A 4M60A 4UJ3A 5A9TA 1E6UA 1J0EA 3D43A 1HYGA 4RIFA 3W79A 4S3MA 1J5XA 3CLHA 3RC1A 1TM2A 1UCFA 3RT9A 5B1EA 4A16A 4G81A 5IHXA 1HDIA 4NS1A 1QVAA 4WUVA 1AK2A 1XFAA 1SVNA 4M1YA 4B3HA 1MG5A 1AKTA 3UJDA 1LU9A 3H7AA 1KARA 1EM6A 5WRFA 2ID9A 3ML1A 3B70A 3N59A 2V4MA 4XM2A 2WM2A 1AGPA 1KKUA 2I3DA 3ZH2A 2RGWA 2Q6VA 1F12A 5CX1A 3S3TA 1GGNA 1ZCBA 4TWBA 4BZZA 3ZZ1A 1G8PA 3HZRA 2MR5A 4JASB 3UWMA 2A6PA 1JECA 2ZANA 3JD4A 1D9ZA 3ZDEA 1WMBA 2EIXA 3E9ZA 3COPA 1E9BA 1Z45A 2PGNA 4EJSB 1FS4A 3BMCA 3AHGA 2I8LA 5LA6B 3C3BA 4U2EA 3U13A 5CD9A 1PT8A 2QAIA 5JEEA 2RAPA 5EWJB 2GO7A 1PWZA 2GBLC 2X58A 3LI2A 3ER9A 2FRXA 1QYDA 4YGYA 2ZE5A 5EE9A 1W5AA 2FW9A 1CQWA 3VR3D 1QO9A 1YU9A 1ZIOA 1UDBA 2V9CA 4N6GA 4PYNA 1SUDA 2FFJA 4MDFA 3I01A 2RGRA 3AIKA 3M2PA 3DBOB 1CUZA 4W4TA 3NRBA 4D4MA 1RYMA 3VQTA 3KFVA 1TW2A 2CXPA 2OQ2A 2VXOA 3NHMA 3O8NA 1NGSA 2QTCA 4G65A 5CPBA 5HCIA 5J40A 3MS4A 3VR0A 3OFND 1MNQA 5HX7A 1HNNA 3IAS1 1BVUA 2ZBDA 1VA4A 1WTCA 1DKNA 2CLCX 4LUCA 1EGHA 5AI6A 1Q6YA 3VJMA 1WM1A 5GJWC 3ANLA 4IDUA 4LSWA 4B9AA 3L4BA 4OX9Y 1K5DA 4DDMA 1V7ZA 4FIDA 4S0ZA 1I14A 2VJBA 1E5LA 4Q39A 3K2EA 2PRJA 2XKBA 4MQEA 3KHTA 4B0PA 2F9LA 2HI0A 4YCCA 3EZGA 5MFPA 1G5RA 1PJRA 4CM8B 4J0FA 3CVXA 1U90A 3TNDA 1IXRC 1EDBA 4D9GA 3TPCA 4NZNA 2YWJA 1NYTA 3WXMA 4G23A 1XJ5A 1ZJ5A 2PV7A 3OKFA 4NZ9A 4YRBA 3BRWD 4YRQA 1U31A 4DEVA 1FA9A 2QVCA 1DT5A 5CD1A 4C05A 3I61A 4M38A 1UJ2A 5DN9A 4CLEA 1BA3A 1KSHA 2QZ4A 4MV6A 3E9NA 2QQ0A 2B61A 1N33B 2PGLA 5LA6F 5E0KB 3QEBZ 4GLBA 2HF2A 4BLSA 2YV5A 4I4CA 3TGLA 3LFTA 4ZO4A 4LZPA 3JQFC 1A4IA 2XUPA 2JZCA 3BKXA 3LNCA 1Z74A 3CJRA 3QPAA 5CNMA 4DC0A 2FH5B 3A3NA 2JVIA 3EXG2 4OHCA 1HT3A 4S12A 121PA 1FDIA 5JXWA 5KC9A 3D2BA 3HVUA 1C3EA 1UKAA 2P35A 4MS3A 1L5GB 3NTUA 4AJKA 4B7CA 2R11A 3THRA 4F6CA 1E92A 1G6KA 2WVAA 3LRTA 1HYBA 5T4HA 2BCGY 1OZHA 4QXOA 1LBQA 2XE6A 1D2MA 1TE2A 4DKJA 2QVGA 2O8CB 2X3YA 3HR8A 2QZZA 1M7HA 4KC0A 3V4ZA 5C1DA 1EUDB 1QLHA 3GNSA 1TK2A 3ESAA 4JGIA 1DB3A 2IPAB 2XD9A 4LNAA 4QX6A 3QVGA 5GY7A 4F9EA 4RDXA 5CDGA 4HDAA 5AM1A 4J03A 3RRBA 4OH7A 2QY9A 2FFRA 1ZQ9A 4HDQB 1RADA 2A9OA 2DULA 2UYQA 2DVMA 1DU4A 4GIBA 1OT3A 4I6GA 4MQ6A 3VH3A 4CEHB 2GAAA 3O8DA 4PR3A 2B4TO 1U8EA 1Q7BA 3BERA 5T3YA 1V8ZA 1Q0RA 2FPUA 1OU4A 4EEZA 3RK4A 1XPUA 3CA8A 1I3CA 4URYR 3GRFA 4V2UA 3T4XA 2PQ0A 3BKWA 1P1IA 2ZJ7A 3HKDA 3UCXA 2EGUA 1JNXX 2ZSKA 2WNSA 3NHLA 4U02A 1U9JA 1BC5A 2HK8A 3SJCA 1SHJA 1NQOA 2WTNA 1D1TA 4B35A 5CIQA 1ULAA 4OHVA 4PZLA 2HA0A 4QBHA 1SUEA 3ZDAA 4J0QA 5HKLA 3HCOA 3G5MA 2ZYIA 2CHEA 2PCLA 4V24A 4QLOA 3LYHA 3HMKA 4JDUA 4AJOA 2V7XA 1S9DA 2WIKA 3AHIA 5E6RB 5IK2A 1CJTC 1ZIPA 1K68A 2R62A 5IP5A 4Q4HB 4A8JA 4UEQA 2RDMA 3IOCA 1U8YA 1LX6A 2AI2A 3ZYCA 1NDQA 1NSTA 3I1YA 1U1CA 4W9NC 3SVLA 3JQ7B 1O95D 1DIAA 4QSMA 3DAGA 1FDSA 5GZ6A 1A9XB 1E1YA 1W85A 5T3UA 4AZ3B 4DA7A 4RMHA 3RFXA 4BHHB 1E2IA 1EA7A 4LN1A 4JEMA 2ONKA 2HSJA 3OX1A 3WNQA 3A6PC 1GITA 2CWWA 1UC8A 2HRQA 4A0GA 3I32A 1V4VA 4KYVA 1XX6A 2D3TA 1GZ3A 1D2AA 2FWRA 3QWIA 3RRXA 3H2HA 4N49A 1GJRA 2A92A 3ENNA 4JLJA 4DMFA 3R24A 5AVQA 2VSFA 1NW5A 2JIRA 2RAFA 2HCFA 3AY3A 4O0MA 3MA0A 1PJLA 1P72A 5EE5B 1L4HA 2GB4A 3FBTA 2EEPA 1QLJA 4F8JA 1GPH1 1IBMB 3H5WA 1E6CA 1JZQA 2GEJA 3IUEA 5UKDA 3C16C 1I94B 4KN5A 3K9WA 1GAXA 4TRNA 1XDWA 3MOIA 2KQUA 1CETA 2VCEA 3BBLA 1AKRA 1DLIA 1JKMA 3DWGA 4DCUA 3RB8A 3IA7A 3QVTA 3UQZA 3D8SA 4ZC1A 4I9UA 2C99A 1ZJYA 3HUEA 5ALHA 5B3KA 2AOUA 2G06A 3WV5A 2X0NA 2PX5A 3NI2A 1CQJA 5EMHA 4B8YA 2D00A 3H65A 2XZOA 1I9GA 4I14A 4Q12A 5G1OA 4EG7A 3T7CA 5KHLB 3VPSA 3MERA 3NWOA 4C7JA 4A4DA 4B3MB 3BGDA 2H8GA 1X80B 3UAGA 2QE7A 2Y1CA 3EIHA 3GYGA 4GYYA 4R1LA 4B6PA 1E1LA 5IANA 4CIDA 1HEUA 1X38A 3JTMA 4TLMB 2VHTA 1PK7A 4QC2A 2CLSA 2D0DA 5HE8A 5LQUA 3KAKA 2WOOA 3G9QA 4L02A 2Q46A 1E3MA 4Z4CA 3ZK7A 1YD7A 2IIPA 4F60A 2B1RA 3MLBA 1YUMA 2BFOA 4JIMA 5IZCC 2H0AA 4CG1A 3K09C 4BLPA 1HPLA 5JWRA 2WSBA 3CGWA 4ARZB 1JHRA 4Q3LA 3OTOB 5FOVA 4FBLA 5BV7A 4E22A 3OZCA 1WXIA 5DDIP 4BVBA 3QRWA 1Z5PA 1KJNA 5CEJA 4YRGA 1QJ4A 4CQMD 2D5CA 1UPBA 3PL5A 5AI5A 4DMGA 5B7QA 4BRSA 1WD5A 1XI2A 1AUXA 4M98A 3RU9A 4EECA 1U0NA 4QUGA 5C8DA 2ASEA 1DCMA 3QPVA 3OKAA 2AOVA 2EJWA 4IUCS 4I81A 1JL3A 2YNMD 5ERXA 3A9WA 4XWTA 1QWSA 5IYZF 2C97A 2YJNA 4UVGA 1LJ8A 5ARDA 2G83A 4GRAA 4DNOA 2Y6UA 5DHQA 1H94A 3NEPX 1ZZGA 3WISA 5IS2A 4AS3A 4QOGA 1X7XB 2JGNA 4ILKA 4ZQGA 4AURA 4HWOA 2F00A 4DAEA 5I4KA 4Q9KA 1NVVQ 4OQQA 3THOA 3X1KA 3GGSA 1LFAA 1JIXA 3OOJA 4PR0A 3WFZA 3DV9A 4AVYA 5EE3A 1IK6A 4NBRA 3UAZA 4TVKA 4IF4A 4UBLA 3OZXA 2SNIE 5KTKA 2C2KA 1CYEA 4KWTA 3DOUA 3AL0C 2QUJA 1O5IA 1X9HA 2XMBA 2NU7A 3COWA 4Q03A 3KL2A 3JVEA 3H0KA 1XLUA 1XRMA 5JAQA 4G1BA 4D4LA 1S9HA 5K3BA 4F0JA 3K8OE 2QTVB 3RF6A 2X15A 3AF0A 3VBEA 1AY0A 5CIYA 3TLGB 4JVMA 5B7GA 3NM5A 1IEQA 2V4ZA 2C04A 1XGKA 2VDKB 3VXKA 3ZGNA 3ESBA 4F8YA 3SKYA 3BH0A 4TL6A 4R9UC 1GQYA 4RULA 1EFAA 4NICA 4BEBA 3GRVA 1KERA 4BO1A 2HC9A 3ADKA 3AJ8A 3EAGA 1M6WA 3L8HA 1JKXA 3DWIA 3DVRX 1VP3A 3NUZA 3OAAD 1WMFA 2PKQP 1JTFA 4BWVA 1CUEA 2BLNA 3B6ZA 4MYUA 1MVNA 4V03A 2VFAA 3WLPA 1DBVO 2Z6QA 4GE3A 1KJ8A 2D13A 1JAZA 2ZJ1A 3TZLA 1D2GA 2VYNA 2P3QA 3M6UA 3NBQA 4QOHA 3TKAA 1DMSA 4JGBA 1A27A 5BYJA 1JSRA 3IP1A 1G63A 3PWSA 2PL3A 3D7RA 3TZQA 2AG1A 1XEXA 4G5XA 1CUYA 1SD1A 7REQB 5AW2A 3T8YA 1EIZA 3MAJA 2XB4A 1XTTA 4L15A 1C0IA 1Q74A 3RYCA 4LY0A 3BDIA 4NZOA 3ED1A 1KZGB 4IFTA 5DNYB 2G4VA 1XJQA 5GINE 3T3OA 1COWA 2XMPA 3MWGA 3EW9A 4M36A 4URXR 3JARA 3BL6A 3BXZA 4HK4A 5HILA 1QFYA 5KU7A 1XZAA 4E5MA 1XQXA 2FJUA 2PKEA 1JYEA 3CXRA 1P62B 4KFSA 3U81A 1DBWA 3PQDA 4WX2B 4Y3UA 2GYVA 1PHRA 2AG5A 5FXMA 3BXPA 1HO3A 3BAFA 3QITA 3J81k 1NVGA 1YA8A 2R65A 3LPNA 5B2ZA 5KNCA 3DNPA 4MR7B 3IBTA 3B6EA 3CN7A 3TTTA 2C5AA 3CLSD 4J3NA 4DZRA 1OE0A 4R8LA 3OC0A 2QA5A 4V02A 3DDCA 2C9YA 4GVLA 1OYYA 3UAVA 2G4CA 1TO2E 4LDQA 1KWGA 2W71A 4TZ6A 5BV8A 4KLRA 3VHRA 3VUFA 3T1NA 2C7VA 3QXGA 1FTWA 4E1AA 3OCZA 5HKKA 3DQPA 3D3KA 5BQXA 5IAOA 3VO8A 1UBGA 2UZ1B 3GFGA 3MJDA 4MS1B 4N03A 4RLSA 4WACA 5KYKA 1O3YA 3DMPA 1JR6A 4HRAA 4QQNA 1U8TA 4UUQA 2HRRA 2NN3C 1B6TA 4TLAA 4A03A 1O8BA 4CM8A 5JS8A 4HEQA 3TX2A 2HNAA 3FKSD 5CEFA 2GYYA 1NX9A 3L7NA 1MRZA 4ZV7A 4DQXA 4NMXB 2D5IA 4PIPA 4M21A 3ZGOA 2KJQA 2QNIA 3OM8A 2PUJA 3FIJA 2QAGC 3HKBA 4JB0A 5BN5A 4J9VA 3CU5A 1UANA 3BVPA 1VKRA 4BNKA 4MPPA 5EPUA 2VTBB 4FYVA 1KJIA 2XQVA 2AEJA 3LHIA 5I8ZA 3V1UA 5FPKA 1YACA 2A9JA 4RZXA 3CF6R 4JQYA 3FMPB 3L02A 2GTHA 2PS9A 5HK8A 4IRMA 1Z4OA 2OC9A 2VDJA 2COKA 1NDUA 3FOBA 1V6SA 4CTNA 5IDXA 4J2OA 1I30A 1WU7A 4P4GA 1ZHHA 2FK8A 1ETUA 2R4TA 5CNIA 2P2CA 4UPDA 1G8GA 1IOWA 1DPGA 3UT0A 1VA5A 2GM9A 3D1JA 4KIJA 5JAOA 4K6KA 1YJQA 2JI9A 3SF8B 3ZW7A 1F1JA 1FB5A 1VPEA 2JLQA 2K87A 3Q8WA 1R9NA 1P31A 2VDUE 1KRXA 1A2QA 4WJKB 4ZVNA 1WOMA 3AERB 3G8BA 3TZ6A 1HFWA 3S8MA 1M2VB 4KQFA 5HDQA 2PYZA 5K0BA 3L4JA 2WPDA 3K92A 3R6WA 3ND9A 2BEWB 2WZCA 1W0JD 1TJ5A 3O26A 5EA2A 2Q4OA 3WYGA 3S2IA 4DCJA 2AIRA 1IN4A 5ADVA 4H6WA 1U5BB 3S5UA 4OJMX 5TLSA 5BPHA 1N6NA 4GKAA 4Q24A 2C7QA 3M3DA 1T5DX 16PKA 3AVYA 3USES 1BXRA 2IEDA 4IV5A 1KO8A 5DNWA 5DSZA 4YX9A 4AO7A 2B3DA 3DBLA 1KAGA 5JSZB 2W70A 4G67A 4BMSA 2PUGA 4Q1VA 3VR6A 5FTLA 4OB7A 3BUSA 4G0YA 3ZE2B 4EG5A 2FTKE 4LOHA 3MILA 1KXZA 3JY6A 5FUMA 3DR3A 3VI3B 1G1MA 1LPMA 3IKLA 1JI0A 2YWDA 3IEPA 3LC0A 4MXDA 4U6SA 1P0CA 4D45A 2N75A 1FTSA 3AW8A 2GF0A 4NJMB 4D9KA 3L4BC 4GXQA 3G0GA 4KBFA 1GDDA 4FZJA 5DTJA 4N0MA 1Q2XA 3G2PA 5F5XA 4BV8A 5D86A 5E6RA 2ONJA 3NJRA 2V8OA 3A4YA 3CSDA 3E3MA 4YCJA 2C5BA 4QJIA 3RD5A 4L8YA 3BILA 1K7CA 1Z4MA 2EEZA 3JQ7A 3ACCA 2L17A 3RIGA 1BMDA 1K8XB 4BIIA 4AZ3A 1A9XA 2G1JA 2WFLB 3O95A 4AO6A 2JFXA 4LMAA 4P4LA 4O02B 4NYMQ 1RW4A 4BXOB 1FVOA 5AHKA 1QHSA 4OQEA 3V1MA 5JWOA 1UR5A 4N5LA 3UHJA 4GPD1 4WEOA 2XUKA 4K8RB 5U4QA 2J0QA 1TDJA 5NLLA 4TQUS 3C7KA 1M75A 5FUVA 4EOGA 1NVXQ 1Q1NA 1UKCA 3M5PA 3V4SA 2Q5CA 2XITA 1PRYA 2R2GA 3EXIB 3IURA 3OCJA 3PPWA 2ZIZA 4G4IA 3WGJA 1T3GA 4RANA 1LK0A 1H69A 1WF3A 4TPKA 4RETA 4N5HX 5DHPA 3S0JA 2DEUA 2YN4A 2P9YA 2DFVA 2Q3BA 4AY6A 2H7VA 2DWUA 2WP8J 1OI3A 3UIEA 2B78A 3VUEA 2IGTA 2CEKA 2C31A 3HB4X 3GPCA 2Z83A 2XWPA 3B7PA 4JROA 4MUIA 3PNPA 1PNVA 3OQ1A 1V11B 2SKEA 3O94A 1AXEA 1FNBA 1FRZA 2KX7A 4HNQA 4F5EA 5CCEA 3RUIA 1GUAA 1J0CA 1AQ6A 5KVCA 5LOVF 2WWIA 1W4ZA 1HY3A 1OFTA 3NDBB 1SXPA 2RAVA 1DLJA 2E6UX 4DUPA 1EDDA 1K7FB 1PTJA 5KX5F 4OSPA 1SR8A 2O3QA 3ITDA 4G36A 3WAKA 5HR5A 3HYLA 1X80A 1UMCB 4BATA 1ZI9A 1BOOA 3BMOB 2AI3A 2FGKA 3RYTC 1THTA 4IQGA 1YR6A 3T9AA 1PEDA 4DIDA 5EGSA 2YMQA 1CIJA 4PQRA 4IQFA 2H1HA 2MCFA 2I4NA 4DQKA 2QXTA 2RC6A 1QCDA 1XKLA 2W6OA 4RYDA 3W7AA 1CRQA 1E2UA 3ZLAA 4ZO9A 3LT1A 4GNKA 3GIWA 5C52B 3RS3A 2YV1A 4ARZA 3P52A 5JJLA 4FOOA 2CB9A 1U0LA 3SX2A 1DKPA 2AN1A 1N2OA 2VSXA 1CT9A 3VPHA 4AO8A 4EIWA 3PGXA 2VQDA 5DGXA 1FFEA 1EQAA 5ALTA 4K6OA 1RWNA 2Q4BA 4N8DA 5DTMA 3GGDA 1IK4A 3LHFA 3KT3A 5THKA 1PT6A 3MCUA 5MGBA 4HB0A 3WBBA 3W5BA 4UHBA 2XZPA 1P77A 2H1VA 3E9MA 4A8JC 3JD3A 1GNRA 4R0NA 4H7FA 3QEMB 1TRKA 2ZQZA 4MUJA 4R1MA 1ZK3A 4MV8A 3U3RA 4XB1A 5C5CA 5AW0A 4CFZA 4HSEA 2C9BA 4IRUB 3URKA 4UZEA 3CX6A 2R4UA 4NBSA 3SZ3A 4RTMA 3GLFA 4NDNE 1Y8RB 4UOEA 3K94A 5F2KA 3DT9A 3PIRA 5GONF 3STHA 1G1AA 4ESHA 2IZ0A 4EX6A 1RXCA 2QEQA 4MA0A 4B3JA 5C8YB 1O96A 2O52A 3RODA 4AMBA 2RK3A 3Q1LA 3DFMA 1SVLA 3DTYA 4MMZB 4L78A 1EG2A 4UNRA 2IHZA 5KTRA 2LWIA 4C87A 2DSTA 1SUPA 1T36A 1ZGZA 1SA0A 3CEPB 3HO8A 3OD1A 3VPBA 4EGFA 2W2LD 3KYIB 3TLGA 5KYVA 5I7UA 3QPWA 4PZAA 3O21A 2BGGA 3RTDA 3VYWA 4IUBS 2Z3ZA 3WBKA 3I8OA 4S35A 3RTGA 4CM6A 2Z09A 2Y0EA 1LPSA 1YZVA 2ZATA 2BBSA 2Q3FA 1R9GA 2KS6A 4TWIA 3QKUA 1JH9A 1KZ6A 1QU2A 3FMVA 5A5FA 2JLCA 1BE6A 4AK9A 1XF9A 3AETA 3HV0A 2FSUA 1IOLA 3B9RA 5A3RA 3CW2A 2HXYA 1TLLA 2F3SA 4R6WA 4UM7A 3M9XA 4Y9RA 1TT7A 1HR0B 2C5SA 3PUWA 4QU0A 4Y6PA 5BQFA 1ZOIA 2J5KA 1VSVA 3ZZNA 3RUHA 3Q8KA 3MYYA 2DLDA 3GH3A 3HNPA 3QFHA 3TDNA 3EGWA 5J2UB 3WYAA 1HETA 1NN0A 1RPAA 2D1QA 2ZRGA 1KAHA 2REQB 3MW8A 5BQPA 4Z4IA 4QJBA 1L5OA 3RWBA 3DDOA 4TZKA 5IT0A 1C9MA 2WSYB 3M0EA 4DXAA 1T3LA 4PC2A 2DX7A 7REQA 1ZGGA 3QEAZ 1BXZA 1X74A 3QVUA 1Z08A 3ZOKA 4CKXA 4NBNA 2YZ2A 2VPZA 3AWIA 3PHLA 4IHKA 4L0CA 4BAZA 4FQ7A 4S1TA 4EYQA 4CDRA 2B7BA 1OV6A 1SK9A 3LS2A 1DMRA 1R8QA 2R4QA 2TMGA 4S0XA 3IIJA 4U7TB 2W48A 3ZU2A 5FOQA 4AKIA 1SXHA 3L46A 4ZQBA 3LAWA 3AJAA 3JPWA 4RZQA 2OHOA 5CK4A 4MKRA 4BTVA 1ZNXA 4BX3A 4TXNA 4AAYA 4WNIA 1OJLA 1YT5A 2ZJ4A 3ZI4A 1MTOA 1S6YA 2NAFA 1IDOA 1QS0B 1F0KA 2W6JD 1RXWA 1MO4A 1Y5NA 4Q5IA 4ZT7A 1GUFA 2DE0X 2W43A 4I50B 4MR7A 3DPIA 3G8AA 4LXTA 4JBNA 5A6VA 4XDYA 1EJ0A 1EINA 1FE8A 2ZU6A 2IIQA 5KAMA 4F93B 3ZCTA 1VYHA 2GFQA 1I4EB 4PQGA 5DLYA 1KC1A 4XOIA 2EF0A 4WLFA 3V8NA 2ZBVA 3A4NA 4ZHQB 1Z7YA 4UM9D 4G9GA 2UZ1A 4U7HA 1UINA 2B34A 2WVHA 2PDAA 1EFPB 1U11A 1K6EA 1NU8A 2WTUA 1U8XX 2W6QA 4X84A 4BVJA 3KTFA 3VHLB 4A1FA 1WUYA 2YJ4A 4M76B 5AVZA 2QF7A 2WTEA 5E7QA 3UJ7A 3ZIAA 3CGGA 1UK7A 2XEXA 2Z3WA 1QANA 2R6CA 1DAOA 4IKEA 1P5HA 3GCWA 2BIFA 4RPGA 4Y0AA 4ZREA 4F5DA 9LDTA 1ND6A 3A31A 5JS6A 2XB2A 2VTBA 2XIQA 3I2FA 3ILSA 2QMUA 1U0JA 4HO1X 4RE6A 3IPAA 5C81A 4YJ2A 1O9GA 1Y5MA 1XEFA 2OFOA 4UHEA 5FBHA 1LTKA 2D5LA 2YASA 4G89A 3KR0A 3SAJA 1VJ1A 1K89A 2AD5A 3DMGA 2C8VA 3TSCA 5BSWA 2AMJA 2B35A 3WLOA 3W4IA 1QAQA 1V26A 2GZRA 1I13A 3CKKA 4FDVA 4WIAA 3ZDBA 1K0UA 1UPAA 3LRPA 4IAOA 4R8RA 4A92A 2PMKA 2H5EA 3SKXA 1M6EX 3ZY6A 2B0CA 3EXFB 3TJRA 4WESB 1YI1A 3PNQA 3GVXA 1KOJA 2FA9A 3PNMA 4KXYA 3SR0A 3GVIA 4YMWA 4ALIA 3QXCA 4K9RA 1CW2B 1LVGA 1W4CA 1W47A 2E9SA 3OBIA 2YDYA 3AERA 5A62A 3BOSA 2N1MA 2GEUA 1S3IA 2XE7A 1LX7A 2VPTA 2EFJA 1M2VA 3G1UA 1SVMA 4KE9A 5CGZA 5DN6A 3FUVA 4D8XA 4LOIA 2JIMA 1R0KA 1LLQA 3OT4A 3LHSA 3E3AA 1NG1A 5JBQA 2RB4A 3G2JA 4HDCA 2EG9A 4HQRA 4JGGA 3E4CA 4DM4A 1N0VC 4ZJZA 3N0TA 2HIGA 1G5QA 1UOEA 3GDWA 2FVYA 3L7AA 1PV1A 3PXEA 5EZYB 1IHXA 4JUCA 4H7KA 2AHOA 5F3RA 4ER5A 4M99A 1B26A 5JSZA 3JQ8B 1G3UA 3QELB 1M2OA 3UJ9A 1QRRA 3SCZA 1N34B 1PFVA 4EY4A 4BDSA 1RWWA 1XZQA 4PTLA 3PT9A 4ZMRA 4DLUA 4ZRMA 3CG0A 2AEMA 2FWBA 1CFZA 2W6NA 4RD1A 3CPSA 5TMBA 1RWXA 4EI7A 3BAZA 2VDWB 1RPTA 4K6HA 2GVZC 2X0IA 1DJQA 2IEAA 3W5AA 1MDFA 1S3GA 2IGBA 2QMOA 2VAPA 1XF1A 2PS0A 3EZ7A 1KK0A 3WX0A 4FCCA 1RFLA 2BM0A 1O08A 1TQ2A 1TD1A 1XG5A 1SU7A 2AEEA 3FCUB 4NJMA 3T9DA 2C5GA 1J49A 2YYYA 5IT5A 1EDZA 3ZBQA 3DEAA 4D0RA 2K6GA 2LKDA 3LBIA 5I51A 1E79D 4CCAA 1GL6A 1U3UA 2IDJA 3R2JA 1WF6A 1XCMA 1KZ7B 1WX1A 3FSEA 4XGIA 2GF2A 2H1LA 3M7IA 3NUQA 1QFXA 4CIYA 2PVCA 2ZJ3A 3KALA 3TB4A 3BGSA 5AVUA 1TVKA 2A59A 3M3PA 3ZZUA 1UF9A 4ZI7F 1N3IA 3V3TA 2HW8A 1IUPA 2WFLA 4JITA 1E4VA 5KHAA 4ARBA 4D9MA 1KOFA 3WWDA 2Z58A 9ATCA 2EP8A 3JD1A 1DJOA 1CRLA 1AB6A 1ZGAA 4ZVTA 4L8GA 5LVAA 3HWSA 1TMOA 4HVAA 1RJWA 3E18A 1IEXA 3MMZA 4UW9A 1E1CB 4DLPA 5JTTA 1WETA 4MVWA 3H2ZA 1CUIA 3OETA 1RZVA 4Z4FA 4FM9A 3N0XA 3LLMA 4PS0A 4JYZA 3EXIA 5AIBA 1Z4PX 5JXJA 4ISBA 1XVUA 3DQZA 1Y4UA 2BMDA 2QIPA 4YV7A 3DONA 4UTPA 5JH7B 2ZJ6A 5L6MB 3AHEA 4IX9A 1E8NA 3OIDA 2WDPA 3Q10A 3QJGA 4BN5A 3VMMA 4BFSA 2LPMA 3B1WA 4JZYA 2FFQA 4QFCA 1RZUA 4R31A 3LKDA 2ZYHA 1V6AA 3ZDFA 1GPYA 2VEOA 5EP1A 4YPVA 2HEGA 2X0KA 1PQPA 1RFGE 3BIJA 4N0EA 3ZE1B 3RAEC 1VIYA 3RF7A 2GTPA 2JFVA 4WN9A 3HQ4O 3L7YA 3SLRA 2EX1A 4WLNA 3H1GA 1SK8A 1C9DB 2ZYTX 2HK6A 3GFQA 4MUBA 2PJUA 5B58T 5BSUA 1KTVA 2ZRPA 3CEMA 4BGIA 1DAPA 5HGXA 3T38A 3TJMA 4CI9A 1QG6A 4GX2A 1FU8A 1UMCA 3IO5A 2C2BA 3KNZA 4Q9HA 3KVOA 1M1ZA 1Z2CA 5DASA 5JALA 1CY6A 3I0NA 3FE2A 1FPQA 2WF7A 1WB9A 1A9RA 3Q3EA 4MYTA 5HQTA 3W5HA 2XVZA 2P78A 3R3HA 3FNIA 4DLLA 1WRBA 1CLEA 3Q9SA 5LR6A 1FZQA 1JHOA 3AUYA 2PBFA 2OXFA 3AUKA 3H1BA 3I72A 3R0XA 3U40A 4DM3A 5KTNA 1L6IA 1OFVA 3T34A 4MAAA 2Q45A 2ZI9A 2FEXA 3MPUA 3WZ2A 2Z04A 3RS2A 5LJLA 2XCTB 1IHDA 3TM4A 1Y37A 1KYWA 3IAHA 3PUVA 1WW2A 1ZR2A 2WR8A 5FBKA 1QGUB 2OHJA 1FYXA 4Q05A 4YIHA 4BFTA 8MHTA 5BV2P 3D8NA 1SHZA 2H51A 3GPDG 2O5EA 5JADA 4MVXA 1PDVA 1N3LA 5JH7F 2NTVA 2RHGB 5DSXA 5GV8A 5JNRA 1P44A 1SEVA 1BD3A 2FXVA 2GO1A 3CBGA 1GKLA 4J0GA 5BNIA 3DCJA 4XEHA 1L1QA 5DX1A 2A9VA 1Y6FA 3D2LA 2C1EA 2YZNA 4MDHA 1DUSA 4FWBA 2V7WA 3I5AA 4KRFA 4TV8F 3PXGA 1MH9A 4M22A 2QENA 2V6BA 4MZDA 4EF5A 3IR7A 4XWKA 1P6QA 2IOHA 3VNBA 2RGDA 4JP1A 3D81A 3FDJA 2AKAB 4C7OB 1KK1A 4PF1A 2OZLB 3ZEAA 2HSEA 4I9HA 1GL9B 3MHPA 1J97A 2OR3A 4KQ1A 4E3WA 2VOEA 3FLMA 1YRLA 2ZRFA 4YJDA 2RH5A 5FIUA 1E1RA 5KI6A 3ZC3A 1T0HB 2NZVG 3DWEX 4K6GA 1XNQB 2PGXA 1K1EA 4QFDA 7ABPA 4R2KA 1YS9A 1E60A 1MENA 1RHMA 3UENA 4GKBA 4X6LA 4DSZA 2QN8A 1T4BA 3L7IA 1I1HA 3SSNA 1UAGA 2UDPA 1AKQA 3R7DA 4TZTA 2VP2A 2YWFA 1JA1A 2HHJA 5EYPA 1KJYA 3NOQA 2A30A 4JLBA 1USKA 5ALFA 4D79A 1NP7A 1LF0A 2VWQA 4MQ4A 1C30B 1KMMA 3IAEA 4MVJA 3LBNA 4MKZA 4NQRA 1T6YA 5TC4A 5CFOA 4DR6B 5KQGA 2WV7A 4WUTA 2CSUA 1WXHA 1E6WA 1AKYA 1YJXA 4L57A 1XQWA 3GFRA 5BSKA 1E6EA 1VJRA 4GGPA 1ZJJA 2XUOA 3EOBI 4M9SA 1K2WA 4A9AA 1PTJC 3Q4GA 4YLEA 3PT5A 4REQB 3WK5A 4NEHB 1XK6A 1J20A 2D1YA 5IAJA 5J2UA 2REQA 1G5PA 4PBTA 4GO1A 3LH5A 3OFKA 1OILA 2VYFA 1E89A 5DYIA 2ZSBA 5DVZA 3F9RA 3JQBA 1VYTA 4H0NA 3LT0A 4KQMA 4P35A 5K1ZA 3U62A 1C9JA 1U28A 2ZWIA 1XTQA 4IIXA 1FUIA 1Y3IA 2WTBA 1EVYA 3DC2A 4RFLA 3VX3A 4YRAA 1SC9A 1VHJA 2C8LA 1RSZA 2A5FA 2GN6A 3GC6A 2BH2A 3BIOA 1MAAA 2Z1MA 1GAEO 1LSOA 2J7KA 5LP6F 2RE8A 1KI6B 5HSGA 1LQUA 2DLCX 4O4LF 1DQRA 1MX9A 2AB0A 1GGHA 4P3OA 2Q41A 4NBVA 4AP5A 4WZBA 2EJUA 4DWOA 1BN6A 3IBGA 4I2NA 4ZJPA 2PUEA 1V5EA 3G1TA 3JAMA 4G1EB 4Y2XA 5DT2A 5HRCA 4KR7A 1CZRA 2F4VB 3G0CA 1F2DA 4GQAA 2X6TA 1ACJA 1LLDA 3PHHA 2V3WA 3D9QX 3I1IA 4LDAA 4H0CA 1JEQB 1GVNB 2N0SA 4LJ9A 4TLCA 2Q6TA 3I5UA 5CB4F 1N5MA 2HDWA 4YDQA 1GDHA 2IFTA 3G7NA 5FQOA 4Z2YA 3RVQA 1YE3A 1I0IA 5T6BA 2RHTA 1RMTA 1XYYA 2QN3A 3L4EA 5K9ZA 4JUIA 1NM5A 4LRUA 1C81A 3AF1A 1WBDA 2QYHA 5KU1A 1YVDA 2XV1A 3ELYA 3L04A 4YJ3A 4D96A 4PNPA 3FHLA 2J48A 4Z9YA 3SM3A 4ALNA 3SQXA 1IWOA 4DR2B 2NSJA 2VQSA 3CEAA 3WIVA 4LC9A 3M6VA 4FKZA 1NUSA 4DLVA 1Q0ZA 1Z56C 3TL3A 3SZUA 3D1VA 1CDEA 3IKTA 3B60A 3ZY5A 1YV9A 3B85A 3L01A 3DE0X 4EH1A 4YLGA 4F97A 4ZEXA 5GTDA 2XYVA 3U19A 4KG7A 5F9MA 1F6WA 4ZT6A 3I73A 5BR8B 2AWNA 4J7AA 2HPVA 4QJ4A 3HG7A 5H8WA 1ISRA 2D0IA 4GM4A 4EZBA 5I7WA 1CNFA 5A02A 4YXFA 3LUKA 1C4WA 5E1MA 2F17A 1LI4A 1PWEA 3IVRA 4FMBB 4OBEA 1QYIA 3OFSA 1JEDA 2W6PA 8ADHA 1NIPA 3PR1A 1G5TA 2QN1A 1DKOA 4Y1RA 4YI3A 2WZQA 4BS9A 4L5IA 1V71A 3C6BA 1SRQA 3HYRA 4QNMA 1FMJA 2MINB 4BCCA 2EARA 1UUFA 3BCRA 3EF1A 1LY1A 2NZXA 1V5WA 1XHFA 3VTAA 1ZMOA 4MV5A 1OR8A 2O5VA 1CR0A 1WVIA 2FJPA 2G40A 3Q72A 2CDAA 3T3EA 3UHPA 2H5LA 4DUGD 1QB7A 2GXAA 5K0SA 2JANA 3EXFA 3IAXA 1NUTA 5BR4A 1XCPA 1A7KA 2Q8QA 2XTMA 4WESA 4JLSA 4LYHA 1M54A 5HA5A 1V3TA 1H6BA 5GJCA 1P1HA 3E8XA 4JUDX 1NQ5A 1GPUA 2UZIR 3GT4A 4HXEB 4ND8B 1Z17A 4AROA 1KFEB 2A1UB 3AH8A 4MVJP 2WHRA 5DBFA 1RBZA 1B2LA 1YZQA 3MT8A 2QX4A 1E9CA 3E27A 1Y9DA 2AXQA 3HSSA 1GRQA 5EZQA 5AM0A 5ITSA 2F9FA 2PNFA 4NZPA 1P75A 4Q7MB 3W6NA 2P3SA 3QVVA 1XVIA 4A6XA 3WGUA 3DF9A 5B1YA 3AESB 3NHFA 1SPBS 4I9FA 3JQ9A 1NJFA 3HP1A 4JWKA 5HM6A 3FTFA 5EZYA 4KYIB 2WIJA 4MVYA 3UWDA 1RC8A 2DERA 3PKJA 4D02A 1GUDA 1IRIA 1CF9A 1O94A 2K5UA 1UPCA 2XWQA 3JQ8A 1KBOA 1LV8A 3QELA 2YC2C 3DDNA 4HRYA 3TF5A 2AYZA 2HWUA 4PS1A 1N5OX 3BJRA 5DBEX 2O8VA 2IS6A 1I4OA 2OFXA 4QUEA 4GX5A 1IVSA 1EFLA 1MTZA 3EXHB 5F23A 5FOWA 3G82C 1PZGA 4JOBA 1TFUA 1DC5A 3FG9A 3VAAA 1ZO8A 2D62A 2FZ4A 4WBNA 2VDWA 1P5RA 3M3HA 1Q7RA 1VCMA 3NEJA 3CX7A 4BYGA 2F1RA 5DHAA