3RU7A

Specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
341
structure length
336
Chain Sequence
YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific recognition of N-acetylated substrates and domain flexibility in WbgU: a UDP-GalNAc 4-epimerase
rcsb
source organism Plesiomonas shigelloides
molecule tags Isomerase
molecule keywords WbgU
total genus 117
structure length 336
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ru7A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3ru7A02
5G4KB 2EP5A 1YE3A 5A02A 3MTJA 3ONFA 3C85A 4WPGA 4XYEA 1E3EA 4BS9A 2YFQA 3N74A 5CPBA 5JMPA 3UCFA 5I9NA 3HN2A 1RM3A 4PRKA 1ZSNA 2OUIA 3FTNA 4PIVA 3MOGA 4JXKA 1RM0A 4NQZA 1V8BA 4ALKA 3JQGB 1OZAA 4CM4B 1HWYA 2QZZA 4BNYA 1IYZA 4ZRMA 4O59O 1ORRA 1YB5A 3SVTA 3DQPA 4M86A 3AOEC 4XYMA 1LXCA 1RPNA 4H7PA 3RUCA 3K2BA 4D0RA 3T4XA 4GVLA 5TC4A 4AJPA 3QVOA 4D44A 3H3FA 1KIFA 2NVWA 3MZ0A 5ILOA 5C7LO 4YA6A 3AU9A 1YDEA 3FSRA 5DNAA 2ZB3A 3GGGA 4UULA 4E2XA 1Z45A 5L9AA 3IAHA 2IDZA 4ZHSA 2X6TA 4BO4A 2RHRA 3MJSA 2VHVA 3WTCA 4ZRNA 1XR3A 3M2TA 2VQ3A 3NJ8A 1A4IA 4YJGA 3HN7A 1OBFO 2QG4A 3H7AA 1I2ZA 1SOWA 3WR5A 4LRTB 3KLMX 2X4GA 1VM6A 1U8XX 3WFJA 5ES3A 3WX0A 1PR3A 4NK5A 4IDAA 2OP1A 5G0WA 3H2ZA 2WEKA 1NQOA 4QEDA 4RLHA 4R1SA 5F1PA 1U3UA 1HYHA 5IDXA 3UICA 2FR8A 5MGBA 3CPSA 1F14A 1VE9A 2PH5A 5CDSA 2B36A 3OBBA 3P19A 3UHAA 4UVEA 1T2DA 1OC2A 2GO1A 2BF7A 4JK3A 2GLXA 1P77A 5EPOA 4CMCA 3NEPX 3P2OA 4RPGA 3WIDA 5KIAA 1QLJA 4W4TA 1QSGA 1J4AA 1X1TA 1PJ3A 1BVRA 1HDCA 5KVVA 3B6ZA 4LSMA 5DCUA 3WQRA 3AUUA 1C1DB 3TJRA 3FTPA 1I2CA 1ZSVA 4N5MA 2JFHA 4E2WA 4DYDA 3IUPA 4P4GA 3GN1A 3EW7A 4MP3A 3EVNA 3CTMA 4PGFA 5IN5A 1YQGA 3JD4A 4LISA 4PZDA 1ZSYA 2YV3A 1IB6A 1HLPA 2O4UX 3H6KA 3RU9A 3EK2A 1Q2XA 4QO8A 4RLSA 4I1IA 4OKNA 2FY8A 2HCTA 4R3WA 2AE1A 3GVPA 3KV3O 1B8PA 3WMWA 5L3ZA 3MJVA 2YV2A 2B69A 1UXKA 2Q50A 2JKVA 1WWKA 2ZQYA 1Y9AA 2Y0EA 3JTMA 3EGOA 1E5QA 3DMYA 3K96A 4UUNA 1ENPA 5TF4A 3QLJA 4NFYA 1ENZA 4R9SA 1MX3A 2PD4A 1D1SA 4RVHA 4C4OA 3GLQA 5CDGA 2PFGA 2YV1A 4CMIB 4E30A 2PH3A 3EY4A 5A9SB 2ZB4A 3U62A 2G5CA 2V65A 4DPKA 1HT0A 3NTOA 4BO9A 4GX0A 4NJOA 3OECA 3QWBA 3WS7A 1VSUA 4KQXA 3RBVA 1F0YA 4D3FA 1I30A 3HSKA 3OF2A 2PA3A 2X7HA 5T8KA 5A04A 3PP8A 3R6DA 1ISIA 4PZEA 2JAHA 5B37A 3LZ6A 2PK3A 3A4VA 3QHAA 4BGUA 2B35A 4PVDA 1Y7TA 2GZ3A 1U4OA 3S2IA 4YT5A 1XG5A 2GN8A 1JQBA 1H6BA 2IZ1A 4QXMA 1AXEA 2VWQA 4DIBA 4KTVE 4TQGA 1F8GA 1DAOA 5JCJA 5IZ4A 3L4SO 3JQ8A 3D4OA 5L95A 1GTMA 4RJTA 3CINA 3DBVO 2TMDA 2OP0A 3JQEA 4DQUA 1H6CA 5TLSA 5A06A 1U9JA 5FI3A 3LLVA 1YBAA 3K31A 4KUEA 5JFOA 5KJEA 2Y0DA 2EW2A 1WLYA 4A03A 2Q99A 3D64A 3TZQA 2VZ8A 1C1XA 3GVHA 3NGXA 4K1LA 1C3VA 2B4TO 4IINA 7ADHA 1GL3A 4EUFA 1O95A 4IDGA 1GR0A 4W7IA 3AJRA 5EMHA 3U9LA 4YR9A 3FR7A 1H0KA 1NVGA 1ML3A 5F1KA 5T5QA 3ZU4A 2NV6A 1LLCA 3LVFO 2O7SA 2VZ9A 1E77A 3ADPA 3QVXA 3FR8A 3PK0A 4BNTA 4U7WA 1MB4A 3UN1A 4NBUA 4CMIA 1F12A 1Y5MA 2C7VA 4I8XA 3V2HA 1AE1A 4IBOA 3R0IA 3VH2A 4Q39A 1JN0A 3ZU2A 1EVIA 4O6VA 4BVAA 4GKBA 4B7CA 1E3IA 2BGMA 3TOXA 1XQ6A 3GG2A 8LDHA 1X7GA 4XDYA 2X22A 4E32A 3ABIA 3PHJA 4QO7A 5AQ1A 1R12A 4NNJA 4YVFA 3ZZNA 2WYVA 1VJ1A 3BHJA 1LQUA 3D3WA 4EEXA 4B79A 3FNEA 2FN7A 4D43A 4WEQA 1P1KA 2G1UA 2FR0A 4PG8A 1PU2A 5JS6A 3W6UA 3AY3A 2PWZA 5JAMA 5THQA 4U0KA 2LDXA 1EBFA 1Z82A 1E7MA 3DZKA 4KP7A 4RVFA 4TZTA 3PGJA 2CF6A 1BTOA 1K6IA 1U3TA 2G82A 4NIMA 3ZWVA 4FGWA 4YT2A 3SBOA 2H63A 1CQIA 4WCFA 2C54A 2HRBA 2BFMA 4CMEA 3UF0A 5KVSA 2JD2A 1HRDA 3VH3A 3DONA 3OIFA 2B4QA 2X0RA 2AQIA 1PS0A 3OJFA 1P0FA 1ULUA 1C0IA 1PJ4A 1X7HA 1DC3A 2NVBA 3CKYA 1E7SA 2H9IA 3RFVA 3TZKA 5JDCA 2FRDA 2YDXA 1TLTA 1LU9A 1EFKA 1RKXA 2P9GA 4IQ0A 5JBIA 4Z9YA 4BQRA 4PG7A 3KZVA 1U5AA 2DBQA 3IJRA 3OICA 4I08A 4IXTA 1RWBA 1MFZA 1WXDA 5AXAA 5K0ZA 1WNTA 2UUOA 2YW9A 5HA5A 4XQCA 2RBEA 2C7GA 1V0JA 4M55A 1DAPA 2JAPA 1YB1A 1GZ4A 3AY7A 2Q1TA 1E3WA 3I4CA 1OOEA 1NFRA 2I67A 1YL5A 3W8EA 2V6FA 4E33A 1N1EA 1G0OA 1X0VA 2DPHA 5ENDA 4CM3A 4XX0A 3LQFA 1GUZA 2EKPA 3KYCB 3PJDA 4D0SA 2Q1UA 4JBIA 1PQWA 4HXYA 3ULKA 5CDUA 3CZMA 1EE9A 5IXSA 5A5FA 4JJGA 2GRAA 2FZEA 3S8MA 4M87A 4TWRA 5EESA 1EE2A 4CJXA 3OIDA 3G17A 1MLDA 5I8ZA 1GD1O 2PKRA 3GDOA 4MIYA 1DIHA 4MVJD 3H9GA 5DULA 1FXSA 1L7DA 2DBZA 2FR1A 2J3HA 3CE6A 1EUDA 3KB6A 4WECA 4ALNA 1GCUA 2FWMX 2WD7A 3PWSA 4BNNA 2QX7A 3R3JA 4PFJA 1T25A 2B4RO 4MKXA 1I5RA 1GAEO 2ZJ1A 3F5SA 1B16A 3VVCA 3DEYX 3OETA 2HK9A 1HKUA 3TOZA 4IXWA 5KJFA 3AOGA 1IULA 3DXFA 2I9PA 4F6LA 2HSDA 4NBRA 1BW9A 4LMRA 3ZW9A 4DLLA 1GEEA 3BTSA 3SC6A 5KKCA 2W2LD 3A28A 3CIFA 2JJYA 5G0VA 1J0XO 4BB6A 4QSMA 1K6JA 3E5MA 2ZB8A 4DRYA 1LDBA 4L73A 4E4YA 3IMFA 1PZEA 3DMTC 1UZMA 3GN2A 3OJOA 4U8GA 4IUYA 4MJLA 3UH1A 4URFA 4ZU3A 1P0CA 1IL0A 1UR5A 3KTDA 3PFWO 3F5QA 3L77A 3FWZA 5K6AA 3RCBA 4ZQGA 4XQ9A 3SLKA 1ZEMA 1KYQA 2CUKA 4BGIA 3E9MA 4UEKA 5B1YA 1XA0A 1K89A 5ER9A 3ANMA 1SMKA 2G17A 4CQLB 1YXMA 4GAEA 1NBOA 4BNHA 4GBJA 1F06A 5T64A 4Z9XA 2GYYA 3ADOA 2AEMA 3WGZA 3IIEA 2BH9A 2GNAA 2X0IA 4MVJM 3ZWMA 2J5KA 4B3JA 3B1FA 1N2SA 3WLEA 5COQA 3WNQA 2GD1O 3L6EA 6ADHA 3JD0A 3FCOA 2Y68A 5IF3A 5TS3A 3RUAA 4MKRA 4BO3A 1IHXA 3ZHZA 1N9GB 4A26A 1VI2A 5L7YA 2HMVA 1NASA 3ZWBA 2VYVD 4G65A 2JFGA 7MDHA 4CL8A 3VH1A 5LDHA 3GK3A 4J9VA 4KMSA 2CNBA 2O48X 4J4BA 5L45A 3CUKA 4B3HA 3ZWXA 1YGYA 2Q2WA 3VVBA 3DZBA 4TRJA 4B3IA 5L51A 4OQZA 1UP4A 1KERA 2PGJA 4DYVA 3PLRA 1YQXA 4YAGA 2C2YA 1QP8A 1YKFA 2RAFA 3M1LA 3DTYA 4XD2A 5U4QA 1EZ4A 4J49A 1HDRA 1W8DA 2EF1A 4CR6A 1Q0HA 4NU6A 4NU5A 4YB8A 2Y1EA 2VWGA 1JAXA 3K73O 2E37A 1PL8A 4AJ1A 2BHLA 2IXAA 4MVJF 1T1RA 4YQYA 3DDNA 2NUAA 1DIBA 4P38A 3QV1A 2ZCUA 2YQ4A 2C5EA 2NQ8A 1B3RA 4H3VA 4KZPA 2DTXA 2HAEA 4OJNA 3ZWAA 5G0SA 3AI1A 1V3UA 4EBFA 3CMMA 5C3MA 1R4MA 3DBLB 4L9RA 1Y8QA 3UUWA 1DSSG 3NAQA 2NTNA 1ISGA 1HZZA 2Y67A 4TSKA 5LCXA 3TSCA 1M66A 3ANLA 1NQ5A 5CG1A 3DBHA 4Q3DA 3DHEA 4RCVA 2IYOA 5TT1A 2HK7A 1UXGA 1SC6A 1I24A 2QRLA 2WD7B 5DCYA 4OGWA 4CM9D 4E5KA 3L6OO 1WMAA 2O3TA 4FFMA 1IE3A 1YO6A 4Q3AA 5DDIP 5ITWA 4BO5A 3KSZO 3Q11A 3BAZA 1H2BA 2UV8A 3WQSB 1ZIDA 5G4KA 4ALJA 1EMDA 3VC7A 1PGNA 1DHTA 2QRKA 1LLDA 3P2YA 4JBGA 4K26A 3KOUA 5TJHA 1N7GA 1UDAA 3BHIA 3AFNA 2EGHA 1B14A 2CF5A 2BI7A 4MVJG 2QRJA 2ZJ0A 2EP7A 4FC6A 1M6WA 3SXPA 1ONOA 4IJVA 5JO9A 5K9ZA 2VYNA 2TMGA 1NWHA 3JQAB 3STHA 3E8XA 1XQ1A 2DTEA 2DQ4A 3EC7A 1N7HA 3IUSA 1M67A 1HSOA 1DIGA 3LT0A 3LU1A 3PDUA 1GCOA 3H5AA 1WAMA 2PZKA 4NDNE 3IP3A 2V6MA 1M2WA 5HS6A 1XEAA 3GG9A 3UGKA 5J23A 2IYPA 2O50A 4MVJH 4XGIA 4IMPA 1UZNA 2OZPA 1Q7GA 3K9QO 2Y0CA 4DC1A 1G0NA 4RVUA 3UCEA 2VT2A 3AI3A 3ZNNA 3MCVA 3LK7A 3MJCA 3Q2KA 4LK3A 3R1IA 3I9KA 2PTGA 4IDFA 2VRCD 3T7EA 4BUCA 3E03A 1Y81A 3HADA 2E82A 1VJTA 2X86A 4J1NA 4HWKA 3RU7A 1BXGB 1ONPA 3H5NA 1T2AA 2IXBA 5I7FA 4PG5A 4E13A 4ZQFA 3GNQA 3WICA 5KNLA 3HWRA 3OHSX 1FDUA 2DUUA 2QYTA 9LDBA 3ENNA 1T4BA 3MTGA 1XCBA 5HRUA 4HADA 4J7XA 1I3KA 3BIOA 4UUMA 4D42A 4DBVO 3JQ9C 5B12A 4PLTA 5ER6A 3ZW8A 4BKOA 1PGOA 3BMNA 3C1OA 1HTBA 3GH3A 2DVMA 3E9QA 3AWDA 1LX6A 1XGKA 1X15A 1Z73A 4WLOA 2X8LA 2HMUA 2ZTMA 2YQ5A 1DC5A 1PL7A 1ZJYA 1F17A 1CQJA 4DXHA 1KVSA 2GPTA 4LSWA 1N5DA 4MVJI 2G76A 1VL6A 3OM9A 1QYXA 3QE3A 3FI9A 4J91A 4GSLA 4LCJA 3G79A 5L7TA 2EG9A 1B2LA 4ND4A 3WIEA 4EW6A 3KM0A 2WWRA 3TZ6A 4OKIA 4R5HA 2NSDA 1C0KA 2C59A 4WGGA 3JQ9A 5BSGA 3EYWA 5CPFA 1CWUA 1UXHA 3WGIA 3ZV5A 4OSPA 4X54A 4WLUA 5TRTA 2AG5A 3D5QA 4EJ0A 4GLOA 4UREA 4ZQBA 3NTRA 3BMNB 4J7CA 1KC1A 4XGNA 3IKTA 4L74A 4BNUA 4CLOA 1RYDA 4YAIA 1A5ZA 4CLEA 3OH8A 3RSHA 4INAA 5C7IO 1R16A 1EUCA 4EUHA 1ZFNA 2BRUA 3U4CA 4XRGA 3F46A 5T6BA 1PQPA 1JWAB 3D1LA 3DL2A 3JYPA 1LC0A 4WUVA 5KJ1A 5IDQA 3DZGA 1WW8A 4PG6A 4BNMA 4JJFA 2BGKA 1I3MA 4OL9A 5FF9A 1CYDA 2VNAA 4E0BA 2B5WA 1D3AA 5EJ2A 4ESOA 4WLVA 2OBYA 5H81A 4CUJA 4ZJUA 3NT4A 3BA1A 1AHHA 3M1AA 3V2GA 4YJFB 1LBEA 1P33A 4Q3BA 3KETA 5LDGA 2H1SA 4XIYA 3F9IA 1PJCA 3RASA 1SCUA 1J49A 2AXQA 4HP8A 1DRUA 5BSEA 1DFGA 1NFQA 3WSWA 3HE3A 3B70A 3ZV4A 4EJMA 2ZTVA 5L4SA 4ITUA 3NGLA 3O8QA 4G2NA 1XSEA 4D46A 2NTJA 3S1LA 3PYLA 4EI2A 4XYLA 5FEUA 9LDTA 4BKUA 5GY7A 4N5NA 4PLPA 5F5LA 2DBVO 1AN9A 2RHCA 3KBOA 5KOIA 3RKRA 3VZQA 4WK6A 1EEHA 1HDZA 4AJ2A 3WTBA 4MVJP 3OFSA 4JX8A 4Z9FA 1SEVA 3E82A 1R6DA 3B20A 3JQGA 4Y9DA 3WWYA 3ZWNA 1ISFA 3M6IA 4DTIA 4B8WA 1P44A 3A9WA 3DZJA 3GAFA 5H82A 4E2ZA 3AFMA 2J5QA 3AW9A 4FFRA 2HU2A 5AXDA 3GFGA 2CFCA 3GMSA 3TZCA 1SZJG 1K3TA 4PLYA 4EDFA 4PLWA 4HUJA 3ZV6A 1XELA 3QRWA 1O94A 1ZK1A 3HDHA 5TGDA 2Q49A 2NNLD 1U28A 3DAFA 1ONNA 4IY1A 2F1KA 4YRDA 1WDLA 5F1OA 2WMDA 3TPCA 4WNIA 1LI4A 4BNFA 1NQAO 1UZLA 2I65A 1DLIA 1R0KA 5CHEA 5KKAA 3W4IA 4OIMA 3ZDFA 3ZN2A 4AJOA 4BB5A 5THKA 4AJHA 1FDTA 3I4FA 3JV7A 2GN6A 1E6EA 4IDDA 4ZVVA 3RAJA 1UJMA 1VRWA 2OGUA 1ENYA 1ADBA 5B4VA 1MC4A 3ENKA 4A0SA 5C7OO 4CM6A 2UAGA 1NVMB 1PWXA 4BNIA 4WLEA 3RVDA 3DTTA 1NP3A 2HRZA 3IOYA 3EVTA 4TVOA 1PJQA 1E3LA 4OO3A 3BMCA 1MV8A 1B3BA 2HMSA 4R3NA 5KJ6A 4MOWA 2VOJA 4CM5A 2O7QA 1J5PA 3HDJA 3QY9A 4YDRA 3VDQA 2PZJA 4UAGA 2UUPA 4HFRA 3WJAA 4S1VA 4CUZA 5U9CA 4MO2A 5EN4A 1LRLA 1XYGA 1EK6A 2GZ2A 4R69A 3FPLA 4BGEA 2I76A 3F47A 1LEHA 3CSDA 2EWMA 2J6IA 2AMFA 4NH4A 3WDSA 3TZHA 3ZWOA 1VPDA 2BGLA 1MG0A 1T2CA 5JCJD 1Y6JA 4E12A 4CR8A 3F6YA 3LT1A 2EJVA 3JQFA 3U4HA 3VZSA 3ZU5A 3VTFA 5G2OA 4BO1A 2DAPA 1UDBA 3VPFA 1L1FA 4L0QA 1FDWA 1I2BA 4CM8A 4W7HA 3B1JA 3Q2IA 4DIFA 1PS8A 5CEFA 1UH5A 1ZMTA 4RPHA 1O6ZA 4JLWA 3ZWWA 4CODB 1YJQA 1PQUA 1ZBQA 2ZYGA 2EW8A 4WNCA 4O63O 3HFGA 5EL0A 3PYXA 3DOOA 3K30A 1UXJA 5H83A 2I3GA 4XQEA 3BZUA 4YXFA 2W2KA 4Y6PA 2PZMA 1HYEA 1LDNA 4RDIA 4I9UA 4RV9A 4NR0A 4J2HA 2HDHA 1A9YA 3I9MA 1NAIA 1DJNA 4RF4A 2O3SA 3GZNB 1Q7BA 3G49A 3H2SA 4JGBA 4FFOA 3HNPA 5K6AC 1N9GA 3MJ4A 3RIHA 2P5UA 3LDHA 4YYZA 4E2YA 3JQDA 1X1EA 4MIEA 3GPDG 3NT2A 3GEGA 4CV2A 3C1TA 4Q3EA 5JCXA 4YCAA 3SX2A 1JW9B 5TIIA 4FJ1A 2PKQP 3Q1LA 4D45A 3NJ4A 4IJUA 1PIWA 4DPLA 5JDIA 2PLAA 4KOAA 2OL4A 4XJSA 1MXHA 5T8KC 1E3WB 3JYQA 3WGTA 2P91A 3C24A 1U1IA 4RL6A 1PR9A 2AA3A 1C0LA 1Q1NA 3V5NA 5HTOA 1YS4A 1YOVB 3BMQA 1MXFA 3TL2A 1KVUA 3HG7A 4W6ZA 2YHIA 4BNXA 3U3XA 1T2FA 1GUYA 1QYCA 1QG6A 4QQRA 2Y1DA 5JNLA 2A4KA 3I1JA 3O03A 1TXGA 1DC4A 1QRRA 1E3SA 2OOSA 3RROA 2O4CA 5I9LA 2EKLA 3IDSA 4BNWA 3WNVA 2GZ1A 4XYBA 2UYYA 4AJIA 1KY5A 3WG9A 2GCGA 4WEOA 4KUGA 4BNJA 2DKNA 4LW8A 3PJGA 1HXHA 4DLAA 1KVRA 5IXYA 5JO0A 1UUFA 1QV6A 1Z6ZA 1YWGO 1GZ3A 1BXZA 1ZEJA 4IDBA 1DB3A 4CLHA 3GAZA 1MG5A 1LRKA 3CEAA 3JQFC 4AVYA 4Z3DA 2OMEA 1ZXBA 3PPIA 4N7RA 3QWIA 4HNHA 1I36A 2XPCA 3NKLA 3O26A 1SBYA 4AJKA 4I5EA 4JROA 1HL3A 1YBVA 1P1HA 3FBTA 4FOSA 5CAEA 5DOZA 2VOEA 5DF1A 5TNXA 1WMBA 1PJSA 4BV9A 4NG5A 3G0OA 4Y6RA 4BNGA 1N1GA 1ULSA 3GVXA 2GF2A 2Y1FA 4FFLA 1P1JA 1Z75A 4YJHA 5ICSA 1HETA 3HDYA 2JCYA 2OBNA 4O5OA 2BELA 2HKIA 3M2PA 1SO8A 4A2CA 1LSJA 1H5QA 1DBVO 1KOLA 1YL6A 2PY6A 3ICPA 2JCXA 4DBZA 1YVEI 2A94A 2W98A 5DN9A 4YEDA 2YZ7A 8ADHA 1JDJA 5JXWA 2JHGA 3L0DA 4GX5A 1E0DA 5JE8A 1LDEA 1HEUA 4A5OA 3PWZA 3DBHB 1LC3A 1Q0QA 4BOYA 4G5HA 4KTTE 1W73A 2QZ9A 2P68A 2RH8A 4CMAA 4DIOA 3WGGA 1SNYA 1WP4A 3AK4A 1K0UA 1WZIA 2QQ5A 4WCFB 4CM7A 4XGKA 3SJUA 5JDIC 2JL1A 2I6TA 4GL4A 4FW8A 1BXKA 3H9EO 4M8SA 1S6YA 3TWOA 1PS9A 4P4LA 3ROQA 1UXIA 1DFIA 2WYWA 3A06A 1EK5A 1TB4A 4FCCA 1QYDA 3E18A 3KYDA 4GMFA 1NQTA 6LDHA 1RYEA 3GDFA 1TI7A 3JQBC 5JDCC 2WE7A 3JSAA 3Q6IA 5ICMA 3EHEA 4FOOA 2NLOA 1PSDA 5KTKA 2NTVA 3OP4A 4TRNA 1EDOA 1FK8A 1JKJA 1JU9A 3EZYA 1QORA 4RORA 3RQSA 3GOHA 3PZBA 1ZK0A 5HM8A 1NXQA 4OXKA 2QHXA 4BO2A 4CV0A 4NK4A 3C7DB 3ROMA 1E1LA 4BKQA 1JWBB 3RBZA 5IJZA 2R6JA 4QFDA 3WLFA 5I7VA 1C14A 2C07A 4IJWA 3W4KA 4PLZA 4HV4A 3EDMA 1BDBA 3I6QA 1R0LA 4PLCA 3D5TA 3VKVA 4L76A 2PGDA 2IZZA 1VL0A 3TFQA 2VTEA 5FFFA 5B4UA 4HNGA 3GA0A 2Q2VA 3AUSA 1XWFA 1SB9A 1Y8QB 1U7HA 2E48A 3WJ7A 2D2IA 2PD6A 3NUGA 3LLSA 1GV1A 2Q45A 5U1PA 5KJCA 3KSDO 4ZICA 1YBMA 2JD1A 3JCZA 4RF3A 4FPXA 2CD9A 2WE8A 4NFHA 3PQFA 2PD3A 4HKTA 1W4ZA 5IN4A 3H9QA 5JAQA 3L9WA 3RFXA 4UVDA 2GGSA 2ILTA 3UAGA 5IDWA 2CVZA 5I7EA 4KDEA 4WE3A 5JC8A 3HJAA 3CMCO 1ZZEA 2GUGA 4AJJA 3WBFA 4XYGA 1GYQA 3KYBA 2HO5A 4RZIA 5CP8A 1DFHA 5JAIA 3DAGA 2ZK7A 4JJIA 3QA9A 1GQQA 1XU9A 4MDHA 4P8RA 4YAJA 1NTOA 3W6ZA 1E7QA 3OJ0A 4YJFA 4DL9A 4E5NA 1P9LA 3EUWA 3KVOA 4RF2A 2VRBA 4G81A 3AM5A 1V9LA 5IAAA 2YUTA 2V6BA 2VTDA 2O3RA 3GF4A 5ENVA 4UVHA 1A71A 1TVEA 4R41A 2DT5A 1GEGA 3JQAA 5EQFA 1A72A 3NYWA 3JQBA 2FP4A 3FD8A 2W8ZA 3ZWPA 1FJHA 1M75A 2VYND 1O89A 4XCVA 4EZBA 1V3TA 3SJ7A 2VWPA 5HBRA 2PV7A 4PZCA 2D1YA 4R9RA 1RM4A 3BTVA 4K9DA 3ITDA 4BMVA 5A1TA 4MVJE 3HFSA 2ET6A 2IODA 4ID9A 2CMDA 4J43A 1IY8A 3TQHA 3FNHA 2UDPA 3ETDA 4R1TA 1WZEA 3ORFA 2ZATA 1C1DA 3KXDA 1X14A 1NVTA 3GVIA 2DLDA 4U6QA 3DFZA 1ENOA 3PHGA 3QVSA 4ROSA 4MPDA 1DRWA 2Y1GA 1DO8A 4OOFA 4BV8A 2VCYA 5ITVA 2P9CA 5CG2A 2J5RA 5ILGA 3BHMA 4J4HA 5CDYA 3I3OA 3OJEA 4CV1A 1UAYA 3C7AA 3QP9A 4I5DA 3GVCA 1E5LA 2JD0A 2P2SA 5EINA 4RVDA 3D4NA 4Z6KA 2DFVA 2BLLA 1A4UA 3MWEB 1I8TA 4DLBA 1ZMOA 1Z7EA 4OXYA 4GQAA 3W8FA 2VZ0A 3H4VA 5I9MA 1GUFA 4L4XA 3KRTA 5JYDA 4ZGWA 4OXNA 3DHNA 5BSFA 2Q4BA 4GWKA 3PGXA 1YONA 2WJPA 3WQQA 3T7CA 1CETA 1NFFA 1PJBA 1X13A 3K5PA 1LTHR 4F6CA 1T1SA 1ISJA 3RFTA 4IS2A 4OMUA 1M6HA 2X5JO 3JD1A 3CH6A 3OQ1A 4LN1A 4XR4A 5BNFA 3ZHYA 3F4LA 4RDHA 3ZHXA 3BYZA 1BWSA 4IDEA 3ITKA 4YPOA 1ADFA 3A14A 4YBZA 1SB8A 3G1UA 2O3JA 5IG2A 4LVUA 4ONEA 3H3JA 5IDYA 3QWHA 4RQTA 5DOVA 4CMBA 4TROA 4Y67A 4YT8A 1LA2A 3GUCA 4DMMA 4BHTA 4BMSA 3TFOA 1HDXA 4FD3A 3NDRA 3ZH2A 3U0BA 1VL8A 3QIVA 5A3JA 2J3KA 3L9XA 1J6UA 2ZYAA 2NVUA 4WLNA 5DBIA 4IPTA 4NJMB 5DP2A 4YJHB 4HBGA 2YFHA 4LRSB 4Z3KA 1NHGA 1O8CA 4UEJA 1IZ0A 1AUPA 2EKQA 1IPFA 5A3VA 1NAHA 4YJGB 3HDQA 1KEUA 1EVJA 1BRMA 3KYCA 1H9AA 4CM9A 3E5RA 4CM4A 4TKLA 4IIVA 4PLHA 4DPMA 1JVSA 4WCFC 4CMEC 2CVOA 3I52A 4CLRA 3MOIA 2E49A 5CFZA 2FMUA 4BIIA 3G1TA 2EIHA 2FPPA 4RGBA 1XIVA 4GH5A 4PVCA 3F3SA 3HHPA 1XU7A 1NWCA 2BFPA 1ZJZA 2D8AA 4WCDA 1G6KA 3H65A 4BKRA 1W0CA 1R4MB 3DBLA 4ND5A 4O1MA 4PRLA 3PLNA 4K6CA 5G0UA 3JQ7A 4QT0A 4AFNA 4ZD6A 1JA9A 2QYSA 3MWDB 1FF9A 5COBA 2FSVA 3GNSA 1MUUA 3O9ZA 1GU7A 1CRWG 1LDMA 2NM0A 2ZIZA 3MJTA 4XDZA 3SEFA 1BHSA 4CUKA 2AG8A 3BXXA 1GQ2A 1KEVA 3WB9A 2Z95A 1KEWA 3QJ5A 3ROPA 2VYVA 2Z5LA 3Q9UA 3VH4A 2BKAA 3DBRB 2YJZA 1JKFA 5G0TA 5BR7A 3GGPA 1ADCA 1D1TA 1UP6A 4EYEA 1EFLA 4DUPA 5L53A 2PKQO 2C5AA 3DOJA 4TMFA 3TRIA 4PLVA 3H8VA 4R1NA 1LUAA 2X9VA 4KDFA 2CDAA 3PVZA 4MVJA 4A73A 4E5PA 5FI5A 4Q3NA 1YB4A 3C8MA 4FN4A 2V6GA 1BDMA 1ISMA 1ZXLA 4IJKA 3JD3A 4II3A 1K6XA 1PZGA 3GT0A 2VN8A 4J0FA 5A9RA 3KHUA 5A9SA 1YQDA 3FWNA 2YYYA 1U3VA 2D4AA 3NDJA 3LT2A 1Z74A 2WYUA 3PXXA 3I9JA 3KLPX 4J6FA 3VPXA 3T4EA 4E31A 4QUKA 2PZLA 4XB1A 3AUAA 2HLPA 2XAAA 2Z1NA 3PIDA 4P22A 3LF2A 4UUPA 2Y66A 3V1TC 4ZQEA 3IS3A 3NRCA 3PTZA 3IC5A 1YJ8A 1LLUA 2DBRA 4U0JA 3VAZA 3LYLA 3L4BC 4P4NA 5FWNA 2FSSA 4D79A 1PJ2A 4M54A 4UVGA 2Y1OA 1A9ZA 2D5AA 5C5IA 4I5GA 4BKPA 1WVGA 3GZ4A 2RIRA 4MINA 2EEZA 1ZCJA 1T26A 1BG6A 4PCVA 3RJ9A 1GQYA 1N8KA 1GDHA 3HB4X 3SLGA 3ZI0A 1K5HA 4GSKA 1P1RA 3K2EA 1PJTA 3OEYA 4TZKA 2A35A 3TF5A 4OSOA 5JW6A 1DRVA 2BFOA 3VPSA 1GYRA 2OXIA 3ZNPA 4Z0HO 2B5VA 3RUHA 4LMPA 2ZYDA 4NBTA 5A05A 2HMWA 4BMNA 3I9NA 4IM7A 2YHUA 4ZN6A 1K2WA 4W82A 3CXRA 5EIOA 3L07A 2BD0A 1GYPA 4JP3A 4FJ0A 1VC2A 2NADA 4YWJA 1KEPA 3CZRA 3JQAD 1KBZA 1EQ2A 1U2DA 4A27A 4F45A 5AXCA 4FDAA 1V3VA 1R37A 4C7KA 1Y9EA 4J1QA 1FDVA 1R4NA 2NU8A 4CV3A 1LQTA 5DT9A 4CLDA 1PGJA 1U5CA 4XKJA 4K6FA 4IGFA 2PGLA 3FF4A 3RI3A 2WTBA 4R68A 2YHIB 3ZHBA 2F00A 5GZ6A 2A92A 3LSYA 1U8FO 2X1HA 4ZQHA 1PJLA 2XXJA 2ZB7A 1D8AA 1X7DA 2AQKA 1D7OA 4QFCA 1A7AA 3UKOA 3KO8A 4EUEA 4GVXA 5BSHA 3F4BA 3TNLA 3LC1O 3JYNA 5JC1A 3GEDA 1QXSA 1H94A 3TDKA 4BO0A 1QYWA 4KQWA 3QSGA 3QWAA 2I5PO 2JHFA 2PR2A 2X5KO 3RUEA 5C37A 3COSA 1C1XB 4CQMD 2GN9A 4U6SA 2VHWA 4RQUA 1V35A 4KUHA 2IZ0A 4NBWA 5JLAA 3U4IA 3EMKA 1EUZA 3FNGA 3HQ4O 3ZNOA 1W6UA 2PNFA 1EBUA 4J90A 5CDTA 1HE3A 3RUFA 3I9OA 5COAA 1NYTA 4L75A 4GGPA 1JLLA 2O23A 3ZV3A 1DLJA 4ALLA 3IL2A 1AGNA 2D5CA 1N92A 1E1KA 4OYRA 2I3AA 3BTOA 3WYEA 1OMOA 4N54A 4LGVA 1ZUD1 2ZKLA 3PQDA 3ONEA 4D3DA 4RPKA 5L40A 2BI8A 1DPGA 1O0SA 1NR7A 2JCVA 5A9TA 3PQEA 2BMAA 3JYOA 5GZ1A 4YQZA 3GMDA 3X2EA 3PFFA 3INRA 3MEQA 3W8DA 1DOHA 3DO5A 1B26A 1H2HA 2FHSA 4LVCA 1QLHA 4BNKA 2AEJA 1TEHA 3GDGA 5A5EA 5AYVA 3O4RA 3IQDB 2EXXA 4JP2A 3KYDB 4IZHA 1ZK3A 1BVUA 2WDZA 2Y05A 2XXBA 3PHHA 4KWHA 3VZPA 2O3QA 3DR3A 2B83A 4IMRA 4M49A 1Y8RB 3AOEA 3PDJA 2GASA 2HQ1A 4WASA 3U09A 2UVDA 4WKGA 1PTJA 1YH3A 1ZO8A 3QVTA 2GERA 4FC7A 1BW9B 3AU8A 1R0SA 1HSZA 1ZNQO 4QX6A 4S3MA 4F46A 4E5MA 4R01A 5JY1A 4JNKA 3RUDA 5MDHA 3DMTA 5JSFA 3F1KA 5HWSA 3BMOB 3ZU3A 1ADGA 4B4VA 1MGOA 4CR7A 4L4SA 4CLOB 1G1AA 1ISHA 1EVYA 1YDWA 2CDBA 2CDCA 3GC6A 4AG3A 4J9UE 4BL5A 1DIAA 1EQUA 1DEHA 1XLTA 3FNFA 4J2OA 4AICA 3JYLA 3OQBA 4IS3A 1LSSA 1P31A 1ARZA 1I3LA 1NX6A 1I3NA 2P9EA 3OMLA 1CJCA 1YRLA 5KVQA 3Q0EA 1I33A 4BNZA 4Q9NA 4AL4A 5KWEA 2Y99A 3N7UA 3O8QB 3I6IA 4TRRA 1ZK4A 4NBVA 1M76A 3GUYA 3WGHA 2VUTA 3ST7A 2D3TA 3RC9A 4CLXA 4Y8VA 1PZHA 1BMDA 2V7PA 5F21A 1U4SA 2Q3EA 4BO7A 1ID1A 5BNIA 4IQGA 3VOSA 5DBFA 3W4JA 3P5SA 4RVSA 1DIRA 4I9NA 1D4FA 2A9FA 1WDKA 4IDCA 4NHEA 2D59A 4C7JA 3GY0A 4CM1A 3E9NA 3PJFA 4GGOA 2SCUA 1RJWA 2W2KB 4B4OA 1CF2O 4DQVA 3ASUA 4FS3A 3VHRA 3VPGA 1H93A 2ZQZA 3JQ8B 4R4JA 4GWGA 2CSUA 5I7SA 2NACA 1WDMA 3HZZA 1A7KA 4GI2A 4Q3CA 2ZCVA 1JTVA 1KS9A 1ZW1A 1DJQA 3C1AA 3PEFA 2WM3A 1E3JA 4ILKA 1LRJA 2Z1MA 3BMOA 5EERA 4R5MA 1SPXA 4LCEA 4OAQA 3WGYA 2WSBA 1UP7A 4UEOA 5L7WA 3VTZA 4WOKA 2CY0A 2HK8A 1GFSA 3D3EA 1U3WA 2R2GA 1H6DA 2I99A 3Q9NA 3VPHA 2GR9A 5A03A 1HYGA 2IRWA 3L6DA 3DBRA 1B8VA 2RCYA 3S2GA 3UFXA 3KUXA 1B7GO 5TQVA 2NU7A 2NQTA 4OHUA 4R16A 4WJZA 5JY6A 4J3FA 1QYVA 3DZHA 1E92A 3WFIA 1JKIA 4AJNA 3C3XA 2P4QA 1SOVA 1DHRA 1E6UA 1E7YA 4R51A 4YRBA 1LLQA 1PX0A 3LC7O 3I23A 3I83A 3V1YA 1KVTA 1NNUA 3FN4A 1VSVA 5JPIA 3ETGA 1XKQA 4RPLA 3WWZA 1HDOA 3ZWYA 2VHZA 2J3IA 3WMXA 1I10A 1LDGA 1TT5B 1MA0A 2Q1SA 1P45A 2NU6A 2Y1CA 3A1NA 3PJEA 2YY7A 1E6WA 1NPTO 1MP0A 2X0NA 3V2UA 4FSHA 1HF3A 2VT3A 3H9JA 3H5RA 1YL7A 5A4DA 1PZFA 1KETA 2QIOA 4Y6SA 3WBBA 5TJ9A 1FDSA 4CM8B 2AQHA 3UW3A 3K6JA 4J1SA 1R15A 3UVEA 3K8ZA 5BT9A 4IGEA 3V1UA 4GMGA 4MP6A 1NM5A 4ALMA 2DC1A 3E6AA 4RF5A 2O2YA 1ZKMA 2C0CA 1OFGA 2R00A 5JMWA 3TN7A 3JD2A 5GZ3A 5GMOA 4XJTA 2OHXA 4J7UA 4YTEA 5TT0A 3UOGA 4NZ9A 4MIOA 3GNTA 3ROKA 3TL3A 4TKMA 4U5QA 4GLLA 1NHWA 2C29D 4II2A 4RO0A 4B4UA 5IZCC 4D7AA 4YACA 3RD5A 4EITA 4JBHA 2DTDA 1RM5A 4YJDA 1UDCA 2GSDA 2B0JA 4XWYA 5G4LA 4Z0PA 3ZGYA 2ZTUA 3GHYA 4EGFA 1T24A 1I01A 5L4LA 3B1KA 2FPIA 2OORA 4MP8A 4B4WA 1OI7A 2EV9A 4OQYA 4AJLA 3PZRA 3E1KA 4HY3A 4BO8A 3IKVA 2X58A 2Q2QA 3GPIA 2C20A 2NU9A 3GRKA 1T2EA 3GQVA 3IP1A 3WYBA 3DOCA 1PL6A 3ZNQA 1MC5A 4L4RA 5KCZA 2OFPA 1I32A 1LSUA 2VWHA 3EZLA 3FBGA 5T57A 2IEDA 1EVZA 2EGGA 4O0LA 4L8VA 4DMLA 4BGVA 3D3WB 1JVBA 1MFPA 3OEWA 3RC1A 4YAKA 1GADO 2ZTLA 4IIUA 4JCOA 1P74A 4E6PA 5BQFA 5BNTA 1CDOA 1L7EA 3H9UA 3AM4A 1O9BA 1KY4A 1HE2A 2FOIA 1VLLA 3GRPA 3FHLA 1SEPA 4GX2A 1HDGO 3OJLA 3WGQA 3NT5A 2YDYA 3S55A 1IPEA 5AXBA 2GDZA 3DC2A 2B37A 4YRAA 3U49A 3NTQA 5JAZA 1GY8A 1QV7A 1T4DA 4W9NC 3JQCA 2CVQA 4ND1A 4W9NA 1DXYA 3ANNA 4E21A 4JIGA 2X23A 4XIJA 5TSDA 1P3DA 3WSVA 1GPJA 2DUWA 4M1QA 1Y8RA 4XEHA 3PI7A 3ZWCA 4TVBA 4UVIA 3VDRA 5B4TA 4CQLA 2WD8A 1Y1PA 3KEOA 3N58A 1F8FA 3JQ6A 4OH1A 4DWVA 4HX5A 2VHYA 4FFNA 1TA4A 5TX7A 2HJSA 4W99A 3NV9A 1LJ8A 2JFFA 1P1IA 3DFUA 5EQDA 4NMHA 1LNQA 1FMCA 2X0JA 3DZFA 2X9NA 3GFBA 3UXYA 2P4HX 4CMHA 2RH4A 3MJEA 3RJ5A 1HLDA 4PLGA 3QWFA 3RC7A 2Q4EA 3AI2A 4NJMA 4BQPA 4XQGA 4K28A 4UUOA 1Y5RA 4N5LA 4Y98A 4FR5A 5DZSA 2W2LA 4PLFA 4N18A 4JQCA 2GN4A 1Z7BA 1H6AA 1YOVA 1CERA 3BMQB 4OOEA 3AY6A 3G3EA 1GPDG 5IFLA 3Q3CA 4CLRB 4D3SA 2AQ8A 3ETEA 1BSVA 1IHYA 1E7WA 1P1FA 4GX1A 3DWFA 3ASVA 1KC3A 1ZVMA 3OA0A 4I9HA 3RBXA 3UCXA 1Q0LA 3GHHA 2EJWA 3OIGA 1TT7A 4CL3A 4FB5A 3LC2O 2LDBA 1BXGA 5L4NA 1PGQA 4B7UA 2HMTA 1BGVA 3S2EA 3OA2A 4H16A 3P7MA 3O38A 4CQMA 1GV0A 4B8ZA 5T67A 5AOVA 4XRRA 3GZNA 3PRJA 2FPGA 2I66A 3HUDA 4ZA2A 4OM8A 3DZIA 4CPDA 2W90A 1JAYA 3KEQA 3OQ6A 1V6AA 5F3RA 5LC1A 1B15A 1DDOA 2D0IA 2H5LA 2IE0A 4BNLA 1VJ0A 3PHIA 3X2FA 4CMKA 4DA9A 4CQMB 2IEBA 4J0EA 4QTZA 1SAYA 2VNSA 3INGA 1UAGA 4H15A 5KVCA 1PGPA 3R3SA 4CMGA 4IQ8A 2HJRA 1E1NA 2P5YA 2BFAA 3WXBA 4DVJA 2VUUA 4FJ2A 5F5NA 4GKVA 2HUNA 3ZCXA 1QKIA 1R4NB 3DHYA 3PHLA 4E3ZA 2DPGA 3RC2A 1ZH8A 2DU8A 4ND3A 2X5OA 1LDYA 2NWQA 2EHDA 3DB2A 3I9LA 4TRMA 4PN3A 4XA8A 4BO6A 3FRJA 1H9BA 4NPCA 2W4QA 1C0PA 1NPDA 2E6UX 3OSUA 2VUSA 1B8UA 2XF8A 2FZWA 3F1LA 4RVGA 2CZCA 1IOLA 5DCWA 3WOHA 4ALIA 2EERA 2O2SA 1A27A 4YT4A 2G0TA 3ON5A 4EEZA 4XB2A 3RWBA 3L4BA 3U4DA 4AJEA 3BMCB 3S2FA 4A7PA 3IJPA 4NFSA 5AVOA 1NPYA 1Q7CA 1CIVA 5FYDA 1U2GA 1S7CA 3GR6A 4DGSA 5DP1A 4J4TA 2Q46A 3QVWA 1IUKA 1X0XA 2POQX 4WOJA 4F3YA 2Y93A 1TT5A 4FQ8A 4FIZA 4RPJA 5ADHA 5HS4A 2VRCA 3BTUA 1E1MA 2E4AA 1B0AA 3PWKA 4RZHA 1VKOA 4PG4A 3NDIA 1OAAA 4YAEA 4DC0A 4FBGA 1LSOA 3D7LA 3FPCA 2AW5A 1GZ6A 2DM6A 5DBGA 3AUTA 3V8BA 2XOXA 3RUIA 1I0ZA 3AM3A 1HE5A 4XR9A 3W1VA 3D4PA 3WGOA 1QR6A 5JYEA 1AXGA 4CMJA 2VHXA 1DC6A 1HE4A 1PEDA 1R66A 1WPQA 2AE2A 2DFDA 2H6EA 4HFJA 4I5FA 4IZIA 4B7XA 4BNVA 2O3UA 3LF1A 3K92A 2AHRA 4NI5A 3PYMA 5CEEA 5CEJA 4KWIA 3NX4A 1PWZA 3C7CB 4FFPA 4R54A 1NR1A 3DAPA 4DREA 4GPD1 1QMGA 2OO5A 2NVUB 3VKUA 4J1TA 1U7TA 3U5TA 2J3JA 4E5YA 3I5MA 1VKNA 3GGOA 2X9GA 5IZCA 3QW2A 3KSUA 3E48A 4HFMA 3GEMA 4M89A 4WLFA 3WYCA 1O5IA 3ICCA 4Z0TA 2Q1WA 4R1UA 1AHIA 4MKZA 1IZ9A 3RKUA 2R00C 1CEQA 2C82A 4EJ6A 3ONDA 3HB5X 4QECA 3LT4A 2C2XA 4FGSA 2AEFA 3PIIA 4ND2A 1XHLA 1OC4A 4D41A 3QQPA 4HFNA 3VZRA 4DQXA 3INTA 1KVQA 4XZ3A 4J16A 3SC4A 4A10A 4AJ4A 1EDZA 1HDYA 3JQ7B 3D0OA 2QW8A 3EAGA 2J8ZA 4JN6B 1HZJA 1ZK2A 1XDWA 1E7RA 5I8WA
chains in the Genus database with same CATH superfamily
1G2OA 2G07A 3KKEA 3QU4A 1VLQA 1YE3A 5A02A 2XEDA 2VJDA 4DRXA 1AO0A 2PLRA 2D5LA 2WC1A 5K05A 1XAGA 1ZI6A 4M21A 5ALVA 4JL5A 4RAQA 4RZXA 4KH1A 4W1SA 3F71A 5EUBA 1RR6A 2Q5CA 3UCFA 3LKZA 4QUJA 4Y9UA 5TPWA 2XUFA 3VX3A 2C1EA 4F2HA 3FTNA 3OEED 1ZH6A 1RWOA 4OXIA 1TU4A 2B25A 2H2AA 1LI5A 4TMYA 4YBRA 4D4GA 1Y1RA 4A0QA 3EEBA 4HVAA 3DR5A 1W0JD 2QZZA 4GLFA 3QVKA 4LYEA 3AF0A 1IBMB 1QIFA 4JLSA 3AVXA 3E61A 4WY2A 4XFDA 5SV2A 3WLPA 1YB5A 3SVTA 3EJ6A 3DQPA 2NU6B 4LF5B 5T41A 4XYMA 1CUHA 2JIOA 1LXCA 1A88A 5LQKA 1ZC4A 3QBTA 1TW3A 3RUCA 3EWIA 2FMXA 2QXTA 4D0RA 4EHDA 5BN4A 8ATCA 1SHJA 2SCUB 3MTEA 3UIEA 5EHXA 3IV9A 1L7AA 3TKYA 5B2ZA 4UW9A 2J09A 1ZN9A 3UGJA 3MZ0A 4YA6A 1ESZA 2H92A 1YDEA 2WSLA 5DNAA 4E2XA 5L9AA 1YZUA 1S0UA 2GAAA 2IHJA 2RHWA 3LQ1A 3EVZA 4I81A 5DHTA 4ZHSA 1EB9A 1N2IA 1KAEA 1A7JA 2X6TA 5JFGA 2FMFA 1WY7A 1QH0A 3SX4A 4CG0A 2EKZA 2VA9A 3KJZA 1WV0A 3N8IA 2REXB 1I4WA 4I1YA 1SUAA 2ZIFA 5FD8A 2ATIA 1XJWA 2VQ3A 3L0PA 1LV8A 3M2TA 1PJ8A 1A4IA 4YV0A 4C6TA 1ISPA 4P35A 3PXCX 3N8NA 5FUMA 2J7PA 5EKDA 1SXIA 1D0SA 4PYLA 4LRTB 4F2WA 4DAEA 5HQ3B 4N0PA 4A4DA 2Z8YM 1U8XX 1UBNA 4C6TB 2H5JA 3I28A 3U7HB 4IDAA 3ETLA 3I2YX 3H2ZA 1NQOA 4FGZA 4RXTA 3VZDA 1OAOA 4B75A 4Q1BA 5HZMA 1QH9A 4R1SA 5F1PA 4DIDA 1HYHA 5EE0A 2REQB 5AVZA 5JZSA 2FR8A 3PICA 3CPSA 1F14A 3WHIA 3DE3X 1SU6A 5ETJA 3EXIA 3C4JA 4DY6A 2E0IA 4RSGA 2B36A 3P9IA 3D3QA 5AKLA 5HRAA 4PHFA 1U0EA 2C61A 1XDUA 1ZOPA 2B6NA 4RTQA 4JK3A 4BQOA 2GLXA 4U2FA 5EOVA 2VS1A 5HRCA 5JRJA 2PXAA 4BN5A 3WMRA 2W7TA 1TM2A 3NEPX 3P2OA 2HSJA 4PNZA 1QLJA 4O25A 2FSUA 1X1TA 2XTNA 3RANA 1AGXA 4F0JA 4EMUA 4DLYA 3AX6A 3R0ZA 3FMFA 3HA5A 3QJGA 4KWCA 4LSMA 1SXJE 2CUTA 1CY7A 3B7WA 3IT2A 3AUUA 5F51A 2RGCA 1R6VA 4FMCB 4BV3A 1CRLA 2P1RA 2IC5A 3IUPA 4IHQA 1T9HA 3OKAA 3P94A 1M8PA 2OM2A 2QTLA 4MI6A 4YCDA 4EG7A 1BN7A 1YQGA 2C31A 3JD4A 1DO0A 4AK9A 1H8HD 2YV3A 4MVYA 3RU9A 1J0BA 2W11A 3UWMA 2QRNA 5EMJA 3SC3A 4K0KB 1O8BA 4BE7B 1ES9A 1U1EA 5TPWB 2O2ZA 5C8YF 4B8YA 4KBGA 5D51S 2NXCA 1GPKA 4OKNA 3M6VA 2QP3A 2HLDA 4URYR 3EBOA 3OTQA 2H4FA 6YASA 4EY4A 2JIZD 1L8OA 4R6XA 2B69A 5DXJA 2Q3BA 1VE3A 5IC4A 4DRXB 4DV0B 1KYIA 1X8KA 2WAAA 2PKCA 1ZJJA 5FOXA 3NIWA 1XCLA 4Y9SA 2ZUEA 1CJKC 1HT2E 1RMYA 3K96A 1SQ6A 3BQNB 4IVQA 1E1CA 1ENZA 5HEKA 2GB4A 2JLCA 3QVGB 2F3UA 4LNHA 1MX3A 1P1BA 3KKZA 4N0QA 1D1SA 1A95A 2A1TR 2B8JA 4AAYA 3LOPA 1NG1A 1EM8B 1KEZA 2YV1A 1QIDA 3F7OA 1XTUA 5GPBA 3BWEA 5LQSA 3QU7A 3U62A 3DV2A 2G5CA 5CH3A 2W37A 4BAGA 2BDUA 5JI3E 2GT1A 3QG1A 1RXYA 1WXQA 1L7RA 4NATA 1XP8A 4A23A 8AT1A 1Y4SA 3ADCA 1GO2A 1DBRA 2ZETA 3WS7A 2ORIA 1VCHA 1W0KD 2XRYA 4KFTA 4AG5A 1FTNA 2WSSA 1EZ1A 3HJUA 4Q3LA 3KOZA 2QTHA 5JBNA 2WHEA 1TK2A 4R2JA 5A04A 4OLHA 4L4ZA 1MJNA 4HGYA 2H1LA 3P2KA 3NYQA 5J4YA 4RLFA 2BM1A 5HQTA 1YNOA 3PC8A 5B37A 1G3UA 3U26A 1BX0A 2PK3A 3QHAA 4F5DA 2B35A 1P5ZB 2KPOA 1ZGZA 1TOAA 3S2IA 4JC8A 5ITSA 2IZ1A 5CCDA 3UW1A 4CL2A 3P8ZA 4JENA 4DIBA 4KTVE 3FVWA 4DARA 2PUTA 4DKXA 2MOKA 3CZQA 4TQGA 3Q3EA 13PKA 4LDRA 4UHFA 1RAAA 5JCJA 3DXYA 3QJYA 5L95A 2CEKA 1TVMA 3DBVO 3QOWA 2OP0A 3OO0A 1H6CA 5FI3A 4Z7JA 3LLVA 3K31A 2FZCA 5JFOA 4NYMQ 4U3JA 1L6RA 1PV1A 2DPXA 1YAJA 4EJFA 4RD0A 2NO1A 3D54D 3D64A 1IXRC 1E6LA 2Q9AA 3MJHA 3N8KA 4H59A 1DTWB 3GVHA 3PUIA 4J0DA 4YMIA 2B4TO 1XL0A 1KJQA 2UZ1B 3BIWA 3HLYA 1KU6A 1U7DA 3HWX1 2ZRCA 3L0BA 4JKYA 4W7IA 3HSYA 3U9LA 1DAGA 2VNHA 1S8FA 1X39A 2PQ0A 3DE7X 3N2GA 4ZRDA 3WZLA 1CRZA 2PTHA 1M33A 1PTKA 4G0PA 3EA4A 1AQIA 2XLCA 5BW5A 3FR8A 3ABQB 3PK0A 1MB4A 3SZGA 4CMIA 2B1RA 1O6GA 3DFKA 2JPDA 3B2NA 4RL4A 4XPIB 3V2HA 3VJKA 4DV3B 4KXWA 2DULA 2IUSA 3IIJA 1NUTA 2H1CA 3G2MA 3A3KA 3FB1A 1IXSB 3MPUA 3P9KA 2VJAA 4L6IA 2PYDA 4PHHA 1PEKE 3O0TA 4G1FA 4LJRA 3KE9A 4O6VA 1SQGA 1W5SA 3FKJA 2GAIA 1NE2A 4GKBA 5CVDA 1XZAA 4B7CA 3B9BA 2KM1A 2ZWMA 3M6WA 4JU8A 4X7RA 1X7GA 1IHDA 1FFGA 2HEGA 3IQWA 4RJLA 3ABIA 3MMSA 3LV8A 3PHJA 3EASA 2FETA 1GSHA 2R751 4QO7A 1A7UA 4C4RA 3SK0A 3V7UA 3W5DA 1VJ1A 3WC4A 2ODPA 2WJIA 3FCYA 5DXAA 4KR9A 4DCTA 3D3WA 3WGVA 2FN7A 5CFOA 2G1UA 4MKFA 1VPEA 1YS7A 1ZJ5A 2WRZA 3VR3D 1EDBA 5CB4B 2Q28A 1XTIA 5THQA 3FRIA 3OIYA 1E96A 1U2TA 4N40A 1E7MA 1R5NA 3DZKA 4NC9A 4RVFA 5HJEA 1YZHA 1OTHA 2WU3A 3SQLA 5ALDA 3NHFA 3M83A 5FULA 1DX9A 3FJOA 1I4DD 4YT2A 3SBOA 2R7KA 3PGKA 3EZ2A 2HRBA 3OOJA 2BFMA 5LZ8A 3V4OA 3UF0A 4C5AA 1RHJA 4CMEA 5KVSA 1HRDA 3VH3A 4GDFA 3DONA 3JQQA 1PVVA 3SBEA 2YOFA 4F12A 4M0UA 3MT0A 2A1TS 3IAS6 1C0IA 1CEEA 4ND6A 2XQKA 5CNJA 1E6KA 3MHPA 4NCNA 1E7SA 2YJ5A 2RC5A 1XZQA 3KQVA 2R11A 1W48A 5IU6A 5F4BA 2H2DA 1P39A 1QJ4A 4RTRA 2BUAA 1QAOA 2QLNA 4PG7A 2R6AA 5KC8A 1DQRA 4W8OA 3OICA 2DHDA 4IXTA 3ZDAA 1K63A 5CFRA 1EXDA 1HFJA 3GLSA 3LQKA 3JRNA 1LGYA 2H06A 3KP1A 5AM2A 4DMRA 1NJSA 2E87A 2ZIXB 1YR9A 2A9VA 2JI8A 1XTKA 3A10A 4PSCA 5HA5A 3F5DA 1P7WA 5CHYA 3MQ2A 1DAPA 4NEGA 4YLGA 3ZJYA 3E22A 1YB1A 1GZ4A 4YRMA 2PSFA 3Q3IA 2HRDA 2Q1TA 1QVWA 2Q5QA 3BT7A 1NFRA 3ZCQA 1UQTA 1W49A 4PS0A 2NAPA 3NAMA 3RDPA 4XX0A 1UZAA 3LQFA 1XNRB 4D0SA 4G9GA 4AKTA 1K7YA 4JBIA 3NI2A 3ZR4B 1Y1SA 4ITVA 2NZVG 3MTIA 4II7A 4JC5A 1G4HA 5IXSA 4JJGA 3T1HB 4AF8A 1TLFA 4CGZA 3CZCA 1UIMA 3N05A 2Q5JA 3MWJA 4TWRA 4OHBA 3N0VA 4FCTA 2CNDA 1P6XA 3ODPA 2AF3C 4HF7A 1JLRA 4ZVNA 4LDNA 1W7AA 1UWCA 4N41A 4UAVA 2PKRA 1JR4A 4ZGBA 2CFIA 2GTIA 2ZYRA 1UT8A 3GDOA 3W1EA 4C76A 4EGJA 1FXSA 1H1LB 3CNBA 5L6MB 4KR3A 4JQSA 1ZM3A 3HACA 1UQRA 3N2KA 4JSTA 4WECA 1GCUA 2Z2KA 3RRXA 4ALNA 4BU0A 3EPKA 2VF4X 3JW8A 1G60A 3W5VA 4B2LA 1XMQB 4D6XA 3G6KA 4QOGA 1KZGB 2FP4B 2D0OB 4G5FA 4DJAA 2YV4A 2I2CA 3R3JA 4UBNA 4MKXA 1YNSA 4KITB 1IN1A 2ZJ1A 1Y0BA 1SGWA 4A2QA 5C35A 3ELWA 3UJ7A 1QFZA 3OETA 5K2OA 5A0VA 3C6MA 3ROFA 3TOZA 4EX6A 5KJFA 3AOGA 1N0IA 4HGOA 1C8LA 2O7NA 2G25A 4NAUA 2FW0A 4X8LA 1X7XA 3MELA 3BTSA 3ORQA 4WBNF 2W2LD 4YRGA 2QD5A 2WWTA 1M0TA 4R31A 4BFZA 4ASUD 2VF8A 3FTDA 2BJWA 5BQPA 4EHJA 2GETA 1Q21A 2NPIA 5B30A 4UXJA 1JIJA 3OJOA 3GN2A 4U8GA 1NJFA 4IUYA 2RGRA 3AZQA 1UR5A 5KDOA 2OG2A 3CB4A 3CM0A 3F5QA 3L77A 4F1KA 4HAOA 3SYLA 2GN1A 1Y33E 2CL5A 3R3HA 4LCBA 4PV7A 4UAUA 3RCBA 3UMFA 4CKWA 3TOSA 4YUXA 1ZEMA 3NOVA 2CUKA 4DCPA 4UEKA 4X1IB 2ETXA 3WP0A 1G7RA 1K89A 3U3OA 2GKGA 4NF2A 1G9SA 3W7VA 2IX3A 3OX3A 4G1MB 3IGFA 2OHOA 1NBOA 1NSYA 5EGSA 5LIRA 2CJWA 4M1MA 3A4LA 2QW0X 3C5CA 3RSCA 2D7DA 4JCCA 1PAUA 4BVHA 1V9CA 4M1WA 4R9VA 4TTSA 2FSIA 2A14A 4ZOEA 3IIEA 2OD9A 2HYDA 4I6JA 2GFHA 3ZV6A 2X0IA 4G4IA 2FZKA 4P54A 3C5EA 1EFDN 4PZLA 4ER6A 4B3JA 5J2UF 3RS9A 1P0PA 3CF4G 3VNVA 5IMBA 3WLEA 5COQA 4Z7OB 1GNVA 3JS5A 3WKCA 4PBRA 3E2IA 1KFKB 1GSOA 1WOYA 3VOBA 3HUTA 1AK2A 2Y68A 2VVTA 1OW3B 5TS3A 4DR4B 4UHJA 4N8EA 1JLLB 3BM5A 2ZJZA 3AEKA 3G2PA 2ZUUA 2PUWA 3WVNA 3U80A 3BXEA 1N9GB 3HBFA 1L5GB 4A26A 3DC7A 3FDIA 1D6NA 2VJBA 1CR2A 3TI9A 5BYAA 1CQXA 1KYYA 1S7GA 3PCTA 5LDHA 1V1MA 3GK3A 3MINA 4ZEVA 1N32B 4QFBA 1KMHB 3HH8A 3WIVA 3CUKA 2ORWA 2VJKA 2EFYA 3QPDA 3AUXA 5FR1A 3C0KA 2NN3C 4OQZA 1JJFA 1UP4A 2PGJA 1E98A 3PLRA 3W2TA 1YOBA 2UUAB 4FHCA 2RSLA 3KOMA 2WTUA 2XIQA 3IMGA 1Q0TA 1OXKB 4X8OA 3ADDA 1HDRA 1RAHA 4KV9A 3TLEA 3DKIA 3FCUB 1R6AA 1U1GA 2F1IA 4JIMA 5EFZA 1YCGA 2J6BA 3WRWA 5AM0A 1H2WA 1GM5A 4KDRA 2VWGA 1C8VB 1JAXA 4UASA 4BP1A 3U4QB 1VKJA 4ZMRA 1P2BA 2ZJBA 3IUQA 3UJ6A 2NUAA 4C7XA 1Y89A 4P38A 4ZPJA 4CMGA 2CNOA 2H4YA 3FB4A 1B3RA 3GBVA 2RJNA 2OCLA 4H3VA 4XVQA 5LB4A 3ZWAA 1M1YB 3IE2A 5G0SA 4BX3A 1ZM4A 1K8XB 2CCJA 4B31A 3NWOA 5DYNA 4J03A 2VUIB 4L9RA 2XE4A 4G1UC 1DSSG 1UINA 4TYMA 4AS3A 3OD1A 2NTNA 4LBWA 2OBXA 1HZZA 3NBKA 1P7YA 2OD2A 4TSKA 5LCXA 4ASUA 1Q14A 1XRLA 3CLTC 2C58A 3HVIA 4XX1A 2Q8PA 2QN3A 5IC5A 5CG1A 3B3QA 5EUCA 2C99A 2Y9MB 5BUCA 1G21A 2FLVA 3HU2A 3D3KA 3SJZA 5BMVF 2G67A 1AF4A 5TT1A 2HK7A 4BIMA 1UXGA 2ORED 5FUWA 5KYNA 5K0GA 1IVSA 5DCYA 4OGWA 2K5UA 3RFUA 4KRYA 3H1AA 4AMYA 1F7VA 2O3TA 1VHWA 4FFMA 1WHTA 4ZJYA 3WK9A 1S3IA 1IE3A 3UATA 4R83A 4LY6A 2C88A 3ET5A 2YVKA 3UZUA 1KI7A 2UV8A 4WFQA 2QRQA 3UWSA 3CUEF 2XMDA 4K26A 4D97A 4O2BB 3KOUA 5TJHA 1N7GA 5DNUA 1UDAA 1J8VA 4RACA 1WUHS 3D5EA 3DAYA 3K9CA 1EXVA 1B14A 3T99A 2GI4A 2WG0A 1E5DA 1OU4A 4DYHA 2ZUWA 2RCNA 2EP7A 4P7JA 1ESNA 4TV8A 2O2IA 4GE0A 3HCEA 3SFTA 4BN4A 4FYMA 1WTCA 2P2NA 1ONOA 3W77A 4LHSA 5K9ZA 3GLHB 2VDRB 3L7MA 2PRJA 1I7SB 4WCDA 3ND7A 5IW8A 3T5GA 3IEIA 1X7YB 3E8XA 1R1DA 1MTZA 1XQ1A 3FUCA 2DTEA 4IIBA 5JSYA 8GPBA 1N7HA 2DECA 4MYHA 2H3HA 3IUSA 1QQBA 1P1CA 5B58T 1EP9A 5FIUA 1HSOA 3O6VA 2PVPA 1EXWA 1I6LA 2G3YA 3QK7A 4MQBA 3SAJA 3A1WA 5KX5B 3SQXA 1TYCA 1WCIB 3IP3A 1Y42X 1CT9A 1M54A 3V7NA 2CCGA 1JR3E 3PEUA 3UGKA 3TNDA 1MOPA 2IYPA 1W4AA 5J23A 1AT1A 2XUQA 5K3AA 4UDNA 3UHFA 4Q37A 4ZC8A 3MTDA 1DKUA 2AOTA 1CLUA 2BDTA 2OZPA 2YASA 3K9QO 2Y0CA 3K09C 3OCVA 4O1HA 4RVUA 3AI3A 5F2KA 3UCEA 2UZ1A 3ZNNA 4E7OA 4TV9B 1L9KA 2HT6A 3DEIA 1FYEA 1FNDA 2VRCD 2RGUA 2WYOA 4ZI7A 3T7EA 1TNDA 1V96A 2XQIA 3E03A 5HGJA 1QE5A 4XD7D 2ZBEA 2X86A 3NBXX 4FD2A 3USCS 4KBFA 2RGNA 4TKZA 4TMKA 3MD9A 4WKBA 2IXBA 3ZY5A 1XDSA 3OEEA 4E13A 2GZSA 2WM9B 2OZVA 4I6EA 1YE8A 4ITRC 4P31A 3DT6A 3DV0A 3LY7A 2P4SA 4UPDA 4HBZA 2RG1A 1J0EA 4IHJF 1N2CE 3GRZA 3R5SA 4HNAA 3CVXA 1RE1A 3OOYA 4P0TA 1T4BA 4OV6B 1R74A 1XCBA 2XNHA 4J7XA 3BIOA 4D42A 1YT5A 2XWSA 3JQ9C 3H1EA 4PR3A 4D8VA 2IZOA 1NTRA 2D74A 2WILA 5ER6A 3ZW8A 4B2PA 4BKOA 3STXA 4DHWA 3JARA 5LU8A 1L5HA 4ZOCA 3T1QA 5JWHA 1LX6A 5CLLA 2X8LA 2HMUA 5FBWB 1F17A 1OXUA 5ISMA 1N5DA 3NIDB 1HNXB 5FUBA 1RRVA 2PU7A 3AESA 2FPRA 4CU2A 3OM9A 4QXPA 3OZTA 5JAUA 3IDZA 1Y37A 4GSLA 1O94D 2Q7OE 1JZQA 2PYZA 3G79A 4TXNA 2GJ9A 3C8UA 3IP6A 3L8GA 5L7TA 1XVIA 3VVMA 4YUAA 4ND4A 4M2LA 5KYWB 2HC9A 2WWRA 3FMIA 4QRDA 3T9FA 2ZIAA 3MT9A 3GJZA 3A4IA 3IHWA 3NC1C 4WQMA 3RF6A 1SQFA 2C59A 1R7RA 1RHRA 1A98A 1TUEA 5CPFA 1CWUA 4K9LA 4RV4A 2WIDA 3R3YA 4MPTA 5JSZA 1H3NA 2HADA 3H4TA 3HP1A 4B85A 1OBVA 4GLOA 5BVHA 4CZ2A 3B12A 5GONB 5T6MA 3HCNA 4XGNA 4MHOA 2G7ZA 2GFIA 2OMKA 2F6RA 4EYQA 5LIPA 3T5AA 3W7AA 5HZHA 2X4DA 4CLOA 1PNOA 4RZUA 1RBYA 2AI2A 4NV3A 4Z53A 4D4KA 1YD7A 1HORA 1K9VF 1B74A 1R16A 3MMPA 2VPPA 5IJ9A 1I7DA 2AGVA 3LWNA 1ZFNA 4A8JC 1E2HA 1KMCA 3U4CA 5KNDA 1USVA 2QJFA 3MLEA 1UK9A 4N9QA 2OQ2A 5J3JA 1GG8A 4C07A 4UAJA 3FLEA 3V8QA 5IDQA 2EQ5A 5CT6A 4PG6A 2WV7A 4PSKA 4JJFA 1QIKA 2BGKA 1AV7A 2VYFA 1I3MA 4GP9A 4IO1A 4OL9A 4RNCA 3VNRA 5K03A 4GQIA 4HH3C 5C34B 1O0BA 1NKVA 1BS1A 4R2MA 3AUJB 4UJ3A 3FUUA 3SZOA 4FT4A 5EJ2A 4DMFA 2WF7A 1JNYA 1NQXA 1T0HB 4DZRA 2FCAA 1GDDA 3TXYA 5B5SA 3GA7A 3QLVC 4ZJPA 5KOHA 2AF4C 1UPAA 4GR5A 3G0BA 2O2EA 1R0CA 3M1AA 2P4UA 3V2GA 4YJFB 4P0QB 5LYJB 4LDAA 5E0OA 3KETA 3AR5A 3FOEC 2KB0A 3LHKA 3OF5A 3ZQ6A 4XIYA 5BV8A 4R8VA 2VFAA 1PJCA 1J0CA 3ASYA 2AXQA 3FE2A 4HP8A 3ZXSA 3TM4A 4CKBA 3HXQA 1Z2NX 2JGFA 2N0SA 3HE3A 4AO6A 4EJMA 4KIUA 1IQUA 1DZ3A 2JG3A 3HABA 3BILA 4X6XA 2O0HA 4ITUA 1F4LA 3HUUA 4RX1A 1FSZA 1W52X 1BA2A 1FA9A 1JQAA 2HJVA 2QD1A 2YCLA 1UK6A 3IAFA 9LDTA 5E6RB 5I4KA 1TJ3A 4HN4B 4GEKA 1H1LA 3ODGA 4LXHA 5GY7A 1N8SA 3QYFA 5F5LA 1G66A 3C7TA 2XT9A 2DBVO 5L3SB 1JEQB 2QI9F 4QUBA 3BXPA 1T34A 4AKSA 4FUTA 5D6OA 3VHXB 1FP4A 4GWLA 1XD2B 5AKHA 2ATEA 2NT3A 4KPYA 4AJ2A 5T4BA 4MVJP 1JFVA 2FQXA 4PQEA 3F67A 4YNBA 2N3ZA 1VBNA 3JQGA 1RYFA 3WBJA 3L8CA 1II0A 3E1SA 3RLIA 3NDBB 1CZRA 3TW0A 5E1DA 2JAOA 1GTJ1 2IZ5A 3DO6A 4E2ZA 2OA0A 1P7CA 3PFIA 4JHLA 4AMGA 2C8VA 1EINA 3AW9A 2OZKA 4BTVA 1E9AA 2AJDA 2F64A 2GAFA 3DYIA 1G7CA 3GMSA 3TJMA 3TZCA 1SZJG 1S8NA 4CCYA 1K3TA 4PLYA 1HFKA 4TMZA 4BY9E 1L8QA 1NLMA 1VDZA 2WHXA 3S4YA 3HDHA 5DI9A 4KI0A 4KLRA 5JT1A 1XN4A 2GAOA 1ONNA 3EGVA 1FW8A 1J9GA 1TIPA 4WNIA 1LI4A 1FB5A 4BNFA 5ALYA 4AJOA 4BB5A 3OZDA 1KDVA 3IA7A 1EDDA 2GK6A 2WVAA 1FFYA 2XDAA 4NENA 4PC6A 5EYPB 3MB5A 4AJHA 4J2TA 3I4FA 4DSTA 3JV7A 1E6EA 2QRPA 3QPAA 3U7JA 4FMBB 1VRWA 3ECSA 3H8WA 4N3CA 3FTFA 2QE7D 2YOGA 1POXA 4JOCA 3DO8A 2VXBA 4A0SA 4RD1A 2Z58A 4CM6A 4ZI7B 2ZIEA 3RVDA 2GBPA 2VI5A 1U8AA 3UO8B 3ERCA 5IRCD 3OM8A 3B8EA 1PJQA 2VK1A 3S1AA 4BP9A 2J9RA 3L7DA 4OO3A 5M04A 5AVWA 4FE3A 2JFZA 2Z98A 5EE3A 2QX8A 3CX4A 1KEKA 4R3NA 1L5HB 4U7PB 2P35A 5AICA 4CM5A 1ZRSA 2O7QA 3AB3A 4DCSA 3MJDA 2CYBA 2GPSA 1L8AA 4QPJC 4A0GA 3WJAA 3L7LA 4HFRA 4DC9A 1K8YB 4YPVA 2ZRFA 1YACA 2PRSA 2NXEA 3PDWA 1LRLA 2RKBA 4MQUA 4R69A 4WJKB 3VR6A 2XT6A 1OFHA 3FPLA 2KS6A 3KXKA 4P36A 1U0TA 4RIEA 1NMQA 1LEHA 2O7VA 1NVFA 3NG1A 3CSDA 3FHJA 2EWMA 3R74A 5LXTA 4OG2A 2O9JA 4X3CA 4J3JA 1V25A 4BLQA 4C6SA 4Q4AA 2IHBA 3RRZA 3N87A 3R5TA 4LG1A 3OPQA 5E3IA 3SHQA 1OXTA 2J48A 1YQEA 1DEKA 3F2IA 1O4VA 3W2FA 3HYSA 2X0KA 4WFKA 1YJBA 2EJVA 3G2OA 1HQDA 1NBMD 3ZU5A 4UCQA 3LOQA 1FQKA 2DAPA 3H7IA 1UDBA 3I2IA 3VPDA 4B81A 3WYDA 3B3GA 2WHYA 5LNK6 1RI2A 3FKQA 1ZONA 3TI7A 3VJRA 4DIFA 1EHIA 4GE3A 1UH5A 2Z8ZA 2NO7A 4C30A 1X3SA 1VXOA 1IVYA 3BFPA 3T52A 4YI3A 3LX6A 1ZBQA 2HCRA 3EVDA 2BKLA 4O63O 3HFGA 5EL0A 3EZGA 3LCVB 4LWPA 4OMCA 3KD2A 1SKBA 1Q0UA 1HYEA 3GUUA 4L0MA 4RV9A 4P7FA 5KC9A 3R24A 5EVJA 5EP4A 1KAHA 3AV3A 3I9MA 2BFWA 1IWOA 1VIDA 2OXEA 1DJNA 3CV3A 3ROXA 3GZNB 1LZKA 4MJ3A 4WZAB 1JRLA 2MT9A 1G55A 2V3VA 4JT4A 2WF5A 1C7FA 5D3KA 4EHLA 2IIQA 1CFJA 1N9GA 4Y9TA 2P5UA 3LDHA 3C3WA 2RARA 3MQFA 3SSMA 1Z8FA 1X1EA 3K1JA 1QTQA 1W0JA 4Q7EA 3FIUA 3KQLA 2ANCA 3P52A 4Q3EA 1P6QA 3ORRA 1JW9B 3FCEA 2OLKA 2SECE 2PKQP 3AETA 3Q1LA 3NJ4A 4I5IA 4IJUA 2Z56A 4K9MA 1BE6A 1GFZA 5E6SA 3A32A 4X93A 1V1RB 1MXHA 3VSCA 1GZVA 5IM4F 5T8KC 1E3WB 1US8B 4F96A 1YVUA 4D98A 3JR3A 3C24A 2J3QA 3ABOB 2AYXA 1DNPA 3V5NA 1XZ8A 2QL9A 3BMQA 4HLQB 1MXFA 1QBGA 3TKAA 3HB7A 2QTZA 4A91A 5AUPB 1HV8A 1GXSA 4ZT6A 5LJLA 1UAAA 2EW1A 4DAOA 1H4QA 3E8MA 4DTCA 2ZBUA 3BK2A 3U7IA 3I1JA 3VZCA 3O03A 3GYBA 3DVRX 5K1ZA 1BMFD 2E4XA 5HIKA 1CUWA 1UBHS 1QRRA 1EFUA 3RROA 4PO9A 4KODA 4ENTA 4IGAA 4BNWA 1TE2A 1KQGA 2CKMA 1JSCA 1O97D 1X7WB 4AJIA 5PGMA 4URVR 3TAXA 4JFAA 1T0UA 3VPAA 1H4VB 1QVZA 5KBYA 3ICEA 2DKNA 4QL3A 3HGTA 8OHMA 1KVRA 4HMPA 2J41A 4MWCA 4BB0A 5G53C 1UUFA 2B7BA 1Z6ZA 5SZKB 1AF7A 1BXZA 1QE0A 3T41A 4MQ4A 1X1CA 1MG5A 3O1JC 3D7MA 4DDMA 5KOHB 1DBSA 5KNBH 1MX9A 1TK9A 3PPIA 1FRZA 5AVXA 4N7RA 4HNHA 4ARZA 1DKPA 1I36A 1OX4A 2NIPA 1Y4DE 1H5UA 3O8CA 4CCYB 4UNIA 1O96B 2LKDA 2XPCA 3O26A 2I4MA 4UTXA 1YULA 4LWQA 5HK8A 2JH8A 2J46A 3M6LA 4E46A 4HJRA 1MR3F 3KEMA 4FOSA 4I2NA 1GQRA 5C8XA 2Q29A 3C39A 3LBNA 5TNXA 3AEUA 1JHMA 2P75A 2Y2UA 1S2NA 1PJSA 5F78A 2NYUA 1ONBA 4D4HA 1AKQA 1ECCA 4FSDA 2K2WA 2X2FA 1P1JA 1U1DA 1Z75A 2Y1FA 1W5BA 3CH7A 1HETA 1CZNA 2CB0A 3PD0A 4BVLA 2JCYA 4QTTB 1IZZA 3BK1A 2OBNA 4A15A 2HKIA 4HXGA 5HBGA 4HQFA 2WHPB 4JP5A 3CX8A 1H5QA 3AB7A 3VOSA 1RHMA 5CITA 2OUKA 4LQ4A 2PY6A 3ICPA 2JCXA 3ZKWB 3OX4A 3QELB 2CXQA 2CL6X 1YVEI 2VSFA 1U99A 4RETA 3I6MA 2PRYA 4KMRA 1Z17A 4YEDA 3TTUA 3V6MA 1WBBA 2WJGA 3ZZMA 4TSFA 1RQNA 4EB3A 1JDNA 3FSGA 3FPKA 4IIYA 1IPHA 4GT1A 5F7OA 5JZVA 2C9MA 2YWDA 1Y6RA 3DVAB 1KKLA 1HEUA 2YZMA 1NY5A 1RYYA 2FEKA 2Z0MA 1NM5C 3DBHB 1JSXA 2F3TA 4IWXA 4TXJA 4BOYA 1Y6GA 3ETHA 3OHMA 5CVCA 1LFDB 2YYSA 4ARIA 2WKPA 2QZ9A 2W6NA 3L04A 1L7OA 4GBED 3A0UA 2NVOA 5C4IA 4DIOA 1AY0A 4FE4A 3IB3A 3OEHD 1QOZA 2ECOA 3WGGA 1F20A 3KHSA 4MHTA 1G9XA 1SNYA 5ADVA 1CBUA 2J85A 4O4HF 3I0NA 1M6NA 3GJSA 4QTYA 4WCFB 2QQ5A 1OWNA 2DFNA 3B7PA 3SMVA 4QDKA 5E8RA 4XGKA 1JR3A 4XLZA 4DSOA 4G26A 2JL1A 4R8KA 2JDID 2I6TA 4G4SO 5JDIC 4BTLA 2DQKA 1HQKA 1PS9A 4IVPA 3SJBA 3W5HA 4TV9F 4JLVA 4P4LA 3ROQA 3P2JA 2LZ0A 4RD6A 1G59A 1E2QA 2Z5GA 3BBLA 5J9FA 2I4TA 1EK5A 2FPOA 4X9XA 3O8OB 4NBNA 2W2XA 2J9FB 5HVNA 3L0OA 4WL0A 1NQTA 4ETIA 6LDHA 1RYEA 3GDFA 2WE7A 5D3MA 3DMPA 3Q6IA 4C2AA 2FX3A 4BC1A 1J8FA 1A04A 5FPQA 5AW6A 1FP1D 2W0SA 2FSHA 4FOOA 4GVPA 2NLOA 4WRRA 5KTKA 1UBMS 2OY0A 4QYTA 3H1GA 3UT0A 2YKGA 4RA6A 2C95A 1E61A 1YR8A 2XOKD 1EDOA 4GBGA 4TRNA 5KTOA 5KWSA 1GGMA 5J63A 2EFJA 1QORA 3RQSA 5TB5A 3GOHA 2B2NA 2EOAA 2QHXA 4NNPA 3DXZA 4NK4A 1EP3B 3QVJA 3SVZA 1OROA 4XE5A 2I80A 2RHLA 3ER9A 1PD1A 3ROMA 5CB4A 1XOIA 5J2UB 1OZHA 3RBZA 5IJZA 4X3OA 4QFDA 1X2BA 4B6OA 4BZWA 4RTNA 2EJUA 3WBKA 1C14A 3VUEA 3VR3A 1B2RA 1VGQA 2W6MA 4PLZA 4W5NA 1GN8A 3J7AC 1EKXA 1KYVA 4PLCA 2Q3FA 3D5TA 1Q1ZA 1VL0A 4QPNA 4YK7A 1S2MA 2L82A 1CQZA 1E9RA 2UYOA 3EUFA 4CTNA 4F2PA 4MPJA 2LCQA 1J1ZA 2ZYIA 3FZQA 4O4IA 4FI3C 4AIRA 4DJTA 4KRFA 1DUVG 4HNGA 5AJXA 2CLIB 4D82A 1FZTA 1ZXXA 2ICAA 1Q16A 5IAKA 5AHWA 1Y8QB 3X1KA 4GR9A 2PD6A 1OILA 3A04A 3I8SA 4ZQCB 3I6YA 5ANRB 5A3QA 3DL0A 4O33A 4QREA 2CXXA 2CD9A 4AMZA 2NYRA 1H3EA 3PQFA 2C2MA 4HKTA 3CLUC 1W4ZA 5CU7A 3L43A 3CZ5A 3OUTA 4EUNA 3AHHA 5CLHA 3EMVA 2XLBA 2PUEA 4UVDA 4G0WA 3G5TA 2C3PA 2JCBA 1W34A 2CVZA 1NKTA 5I7EA 1M5RA 2J67A 2AC2A 3ESCA 1ADJA 3IV7A 4L50A 2YYZA 4NH0A 2JI4A 5BOVA 4C0XA 3NIBA 3R6GA 4AJJA 3ED1A 2V98A 3E9ZA 3FOCA 1SVOA 1DQPA 2EBUA 5DFAA 2C94A 3RTDA 5E4YA 3O8DA 4CIWA 2HIGA 5BV2P 2VDLB 3VJMA 2ZK7A 4X63A 5KAPA 1Z7GA 3DLAA 2AHOA 2VHCA 1GQQA 3WL5A 1ZN8A 1QGYA 2VP6A 2Q5EA 1TO1E 4P8RA 2A5FA 4YAJA 7REQA 3FHTA 1SXJB 3G8CA 2X40A 1TMKA 3D6VA 3O90A 4TM7A 1JA0A 3OJ0A 4DL9A 1H2YA 1P9LA 2I78A 4G0OA 2DHRA 5EJGA 3OG9A 5EJ9A 3EUWA 5F23A 3QLUC 4RF2A 1VP9A 1EM8A 4G81A 2C4TA 3FNRA 3Q9SA 1H4SA 1V9LA 4MRNA 5IAAA 3ZD9A 5KCMA 4D80A 1EM6A 2SNIE 3BGIA 1E1CB 1TVEA 2V7WA 4R41A 5KTTA 1GEGA 5LP6F 3CCCA 1A72A 1PV2A 1HFEL 3JQBA 1NUSA 4HGZA 3DEJA 1BHO1 1FJHA 1WHSA 4IDNA 2IZ6A 3WHLA 2G36A 4TTIA 3RG2A 1SUPA 4N5DA 5H80A 1G8JA 3I62A 4L7VA 3QKSB 5T3YA 4BX2A 2VWPA 2PV7A 3QBVA 1JEJA 3BTVA 4Y6LA 5JXGA 3I2HA 3ITDA 1JQLB 2CHVA 4HAVA 2RGXA 5CVJA 1I0IA 3JRWA 4KYTA 3ZCRA 3IUYA 2IODA 3HV2A 2CMDA 4ID9A 1F6BA 5AR1A 3FLMA 3TQHA 5LQRA 1EX7A 2VBFA 3ETDA 4MROA 1C8KA 2FPLA 1FLNA 1WZEA 3ORFA 3R7LA 2ZATA 3D7KA 2F55A 2GAJA 4CTJA 4PONA 3F8WA 3PFCA 2YXDA 3QNUA 3QVSA 4KE9A 4QASA 2PO5A 2P3QA 3KQMA 1DO8A 1U7PA 4HS4A 4MPDA 3CRVA 1Z07A 5DMHA 2VCYA 4BV8A 3IIMA 1T5DX 3KSMA 3FCSB 2G9UA 4QDXA 2G8LA 2AN5A 3TOCA 2XH8A 4YR7A 4R8LA 3ZXXA 2A6PA 5BUSA 4AI6A 3G6WA 2JD0A 4RVDA 2J9GA 2GCOB 2P9TA 3ZJUA 2DFVA 4C0SA 4DLKA 1A4UA 1K7CA 1CS0B 1NDHA 1L8XA 1V5GA 3ABSB 2ZULA 2XB4A 1I8TA 4FGLA 2WU1A 5DN6D 1RFGE 3H5LA 4OXYA 2G06A 3GLGE 2NZ8A 3H4VA 3P32A 2GEUA 3HNOA 4A1OA 2XZOA 1B0ZA 1ICIA 1URPA 1WCYA 3LBIA 5B1IA 5AVYA 1JPJA 4S1WA 1YONA 1L5LA 2WJPA 3ZE6A 3IQEA 3T7CA 2ZUSA 1JH8A 3AP1A 4MEJA 1ISJA 3TOVA 3IHLA 3KALA 3X3HA 4IS2A 2BL4A 2NO0A 4JYAB 1QK5A 2QI9C 1L7PA 2X5JO 2QNIA 1R8YA 3N07A 2B92A 4LN1A 3ZHYA 6NULA 1RJFA 1SXQA 2YX1A 5AIBA 2FX2A 1V9SA 1LPAB 1G3MA 1FTQA 2R2AA 3BYZA 1BWSA 4RC9A 3W9YA 3T3DA 2GQ0A 1OGIA 2EX4A 3NOOA 3ZDEA 1E2EA 2PT7A 4DB4A 1SB8A 1IZ7A 1NW8A 1MH9A 4D74A 2YIMA 2AKYA 4LVUA 4U7TB 3H3JA 3QWHA 4QA9A 4R2KA 4CMBA 2VSNA 4Y67A 4F3RA 1LA2A 4ZOAA 5AMXA 4ERXA 1E2UA 1TZCA 4G84A 1CKEA 5JG7A 3U0BA 3CBGA 4BRUA 1VL8A 3QIVA 3CFYA 2OILA 2D5IA 2NVUA 4G23A 3U37A 1E4VA 3BFVA 4HDSA 4IX1A 4DDKA 4YJHB 3FDJA 1SXGA 2D1FA 3M4NA 1GZHB 2CWDA 3CW8X 1CU1A 1N0WA 1AUPA 1XKXA 3QG5A 4RK5A 1QHHB 1TQ4A 5K3SA 2I3BA 3DVSX 1KEUA 3HDQA 3LECA 3ZBTA 3MLAA 4CM9A 3CX7A 1LJUA 3ZY4A 1OLXA 2BGTA 4PTLA 4CEJA 4TKLA 2ZJ3A 4P1ZA 4OI1A 1G4UR 2JB9A 4FGUA 5JH7B 3ER8A 1E9EA 1SK9A 1XD2A 5LWQA 5I9BA 3BXOA 3GD5A 2W58A 5MF6A 4C20A 1TJ5A 4DIKA 2RH9B 4ZI7F 1JQEA 4AMUA 2EIHA 2YXNA 3EQ6A 4CWAA 1XIVA 4GH5A 4PVCA 3V00A 5BV1A 5DRYA 1XTJA 3KXIA 1F48A 3RVPA 1W0CA 2B1QA 2W2PA 3CZ4A 1JU4A 1R4MB 3DBLA 3O3OB 3BD6A 5AJWA 3RVNA 4Y30A 4K6CA 4LJKA 1W75A 3TH5A 2QSYA 3K9LA 3V1NA 2GEKA 1XZHA 2QYSA 1W87A 2WI8A 2YYAA 3MJFA 5DWDA 4MPRA 4ZD6A 1W25A 1GA1A 4I1RA 3P2MA 4KYIB 3RYTC 2FSVA 1SN7A 4OMDA 3DL4A 3T3PB 1Q0ZA 1P0QA 1GLGA 2GK4A 2YJ4A 1BHSA 2YZNA 1Y6QA 2XGSA 1RHUA 1KEVA 3BXXA 4XDZA 4XX0B 5D87A 5EWMA 2Z95A 5BYJA 3VSAA 1TQ2A 2H2IA 4W1QA 1R50A 1WSBA 2Q0HA 2FFRA 1D4AA 3T9CA 2A3NA 4PFSA 2XD9A 2PCLA 3Q9UA