3RU7A

Specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
341
structure length
336
Chain Sequence
b'YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WbgU
publication title Specific recognition of N-acetylated substrates and domain flexibility in WbgU: a UDP-GalNAc 4-epimerase
rcsb
source organism Plesiomonas shigelloides
molecule tags Isomerase
total genus 117
structure length 336
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ru7A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3ru7A02
1UDAA 4MP3A 1PJ3A 3KSUA 3DBRA 3EUWA 3JYNA 4KUHA 5CG1A 1P1HA 4PZEA 4RPJA 3R3JA 2VHZA 1DFGA 5JCJA 2NWQA 1H9AA 1B2LA 1UXGA 2VUTA 3RUEA 2X9NA 3HFGA 4D0RA 2W4QA 1LLQA 4DA9A 4EW6A 2IDZA 1YONA 3JQ6A 3C7DB 3H9EO 2HQ1A 4HP8A 4FDAA 4GGOA 3CXRA 4CLOB 3RKUA 4B3HA 2ZB7A 1GL3A 5IN5A 3NT5A 3GG9A 5AXBA 2VZ8A 4OSOA 5A3VA 3FNEA 5DBGA 1Z74A 2ZJ0A 5ENDA 1QSGA 2X6TA 4LRTB 3NT2A 2DKNA 1JKJA 3FHLA 3L9XA 3JYLA 4RLHA 2I3AA 4XIYA 1SAYA 1NHGA 1KVUA 2PK3A 1YBMA 2WD7B 2EG9A 2JHGA 5DCWA 1S6YA 1NR1A 1YDEA 3I9MA 4CLRB 1LRLA 1EK6A 1NM5A 1E7QA 4MIEA 1XG5A 3KM0A 1K5HA 3AY6A 1R4MA 2BMAA 1Q7BA 1QYWA 4PGFA 5TS3A 4IS2A 3EAGA 4XB1A 1EE9A 4IDGA 1LRJA 4OJNA 4E2YA 3JQBC 2DLDA 4EJ6A 1HDGO 3FD8A 5ES3A 2UAGA 3PPIA 4L4RA 3VH1A 3RFVA 5L4LA 1GZ4A 5CDYA 3JQ7A 1BVRA 3FNGA 3I9KA 3H5RA 1A4IA 1UZMA 2CDCA 1T2EA 3HADA 3P7MA 4XGNA 3T7EA 3F1LA 4ZICA 1DDOA 2I5PO 3V8BA 4KOAA 2EIHA 3F5SA 1YDWA 1QKIA 3W4KA 1K0UA 3BTVA 4E5PA 4QQRA 3U4DA 1DHRA 1HYGA 2BGKA 3MTGA 5LC1A 1DLIA 4A27A 4J90A 4W6ZA 3SBOA 3GVHA 4BNLA 3AJRA 4BNTA 2EGGA 1DC5A 3ZZNA 4HY3A 5JFOA 5G4LA 4BHTA 1HDOA 4FFLA 4IDBA 5EIOA 1LC0A 3AOGA 3G3EA 3DMTC 3L77A 3VTZA 1QR6A 2X23A 1AN9A 3U09A 4LMPA 2X0RA 1ZXLA 3I9NA 4DLBA 4FCCA 5IG2A 1SO8A 3RBVA 4PN3A 4IQ8A 3AUAA 3O26A 1ZEJA 4WASA 1XELA 2J5KA 4IMRA 4KWHA 1T2CA 2AQ8A 2GASA 4DUPA 3STHA 1PGPA 3HWRA 2XPCA 1PWZA 3ANNA 4YRBA 9LDBA 1ZJYA 3BMNA 4GH5A 3Q11A 3ROMA 2JJYA 4HV4A 2GDZA 2Y99A 4R1TA 2NLOA 4DL9A 4XYLA 1ZIDA 1SOWA 3NTOA 1NVGA 4FIZA 4BKUA 4GMFA 5HS4A 1GEEA 1TT7A 1ZK0A 1P3DA 2FN7A 3E9QA 1O9BA 3RUFA 4ALLA 3SLGA 1U5AA 5A1TA 2GN9A 3P2YA 2DBRA 4D3SA 4I9NA 2HCTA 2BLLA 3OIDA 2BHLA 4P4LA 1YB1A 2QRLA 3MWEB 1DIAA 3S2IA 4OAQA 1HSOA 5CHEA 3U0BA 2C29D 1X0XA 1T1RA 2FPIA 3Q3CA 2J8ZA 3EZYA 3ICPA 3I6IA 4M86A 4CM3A 5JCXA 3WWZA 3MJSA 2Q4BA 4IJWA 4I5EA 2D3TA 4IGEA 4BKPA 2HJSA 3GVXA 3AI1A 4H3VA 3F4LA 3ZWNA 1VLLA 4KP7A 3I4CA 5JS6A 2PNFA 4R9SA 1HRDA 3E03A 1JW9B 5DCYA 1I3LA 4Q3AA 4BKQA 1X1EA 3TPCA 1JN0A 3CMMA 4YJGA 1DFHA 3LDHA 4M8SA 4BNYA 5T57A 4RVSA 4BNIA 4UEKA 2OMEA 4J7XA 1BDBA 2Q2QA 1E6UA 2O4CA 2V6MA 2J3KA 1ZFNA 3SJUA 1A9ZA 3OICA 4M1QA 4U8GA 5EN4A 4GGPA 3WQSB 1YOVB 2GN4A 3GG2A 1T2DA 4TRRA 1ENPA 3INGA 3JQAB 1Y81A 3HB4X 4BGUA 3JQBA 3WGYA 4CL8A 3MTJA 2C0CA 1IL0A 1P1FA 4MKRA 1Q1NA 4PLCA 1J49A 1NHWA 3BMCB 1GV0A 3DOOA 3GEDA 4GAEA 4CLXA 1QMGA 1PJQA 4NHEA 4R16A 4TQGA 1F8FA 1ONOA 2H6EA 4W7IA 5TT1A 1KETA 3VZRA 3HQ4O 2YDXA 5B1YA 1UZNA 2OBYA 2B83A 1LDYA 3AUSA 4IQGA 2D5CA 4MP6A 3VH4A 2A94A 3WGTA 2HSDA 2WMDA 1LA2A 2Q46A 3OJFA 3ZCXA 3ZDFA 2PH3A 2DPGA 1Z45A 4J0EA 3ROQA 3D4NA 1PGOA 4IBOA 3QHAA 4CM8B 3P19A 3GGGA 1GFSA 4U0JA 1SNYA 1TLTA 2NTJA 2YHIA 2YV2A 4DGSA 1GUFA 3I52A 5F5NA 1NFQA 4PLYA 1PZEA 1UJMA 2CD9A 4XX0A 1Y7TA 3OJEA 1YQGA 3DMTA 1QYDA 2EERA 3VAZA 2W90A 1LX6A 1HTBA 2EKLA 2WWRA 1LU9A 3QSGA 2C2XA 3L6OO 4WLEA 5T67A 5I8WA 5U9CA 3PWZA 1FDUA 3RQSA 3ZWBA 1IE3A 4RZHA 5HS6A 5KJ6A 1B8UA 3GRPA 2GUGA 4QO7A 5TJHA 3IJRA 1BVUA 2CVZA 1PJLA 3VPFA 1RWBA 1J4AA 1N7GA 3AOEC 3EK2A 5AOVA 3TZ6A 4S1VA 3WYCA 3ZWOA 2HK7A 4YA6A 5DOVA 4H15A 1NR7A 4XGKA 4YJFA 5IZCC 3CINA 3S2EA 2UUPA 2W2KB 3TOXA 1HL3A 4WPGA 3VOSA 3BTOA 2DQ4A 3RC7A 1B26A 3PWKA 3RWBA 1JKIA 4TSKA 1ONPA 4MJLA 2BGLA 1RPNA 5B4VA 2J3HA 4CQLA 3FWNA 1LTHR 1D1SA 3PHIA 3DWFA 4NJMA 2FZWA 4NBWA 3KYBA 4R68A 4JP2A 3IKVA 2GRAA 4M49A 4R1SA 1HZJA 3F6YA 3ZNQA 1M6WA 3DTTA 4DIFA 8LDHA 1NX6A 2CVOA 3KZVA 1UAYA 2NNLD 2NV6A 3K31A 1MV8A 1PU2A 4DQVA 4O1MA 4DLLA 1YE3A 5BSEA 4J2OA 5GZ6A 4MVJH 2EP7A 3OA2A 4XD2A 1I24A 1AXGA 2WSBA 3DBRB 4FS3A 1O8CA 3WMWA 4BNFA 3O4RA 3IAHA 4JLWA 1F8GA 4NK5A 2X8LA 3PP8A 3RROA 3DBHA 1NQOA 1R6DA 4BMNA 1LDEA 4YWJA 1U3TA 3C8MA 3I83A 2CMDA 5JC8A 1E92A 5IJZA 5IDXA 2GPTA 4JJFA 1TEHA 1IOLA 3HZZA 2ZIZA 3RCBA 1XEAA 1EFLA 1ISGA 2HRZA 2DTDA 1E3EA 1I01A 1T26A 3LT0A 3TOZA 3QVWA 1JWAB 3OQ1A 4UUOA 4HXYA 5A9TA 5A02A 3TL2A 3W4IA 4MVJE 1LC3A 3VH2A 1JDJA 4UAGA 1ADBA 1QV7A 4UEJA 4W82A 4UVEA 1AXEA 1ENZA 3HUDA 1V3UA 2FPGA 5JAQA 4RCVA 4CQMB 2VTEA 9LDTA 5BSGA 5CDSA 3LC2O 1XQ6A 1FMCA 3IC5A 1WDMA 1SEPA 2D8AA 4ND3A 4QFCA 4QTZA 2QW8A 1HT0A 2WD7A 1UXIA 4R5MA 5COBA 2X86A 2ZB3A 4R3NA 4CLRA 3I9LA 3WFIA 5BNIA 2B4QA 3KTDA 4IDEA 1FDVA 1KEVA 5CEEA 1HDYA 2JCXA 2CDAA 5KKCA 2VHVA 3CUKA 1J6UA 1M76A 4U0KA 1DEHA 2XOXA 3D3WB 3VZSA 2PGDA 1KOLA 3WBBA 4CM4A 2C5AA 1LNQA 1YL6A 2BRUA 2YZ7A 3OP4A 1SOVA 1Y5RA 1XR3A 2PTGA 1XKQA 4CR6A 3SEFA 2FR0A 4BQRA 1LDBA 4ITUA 2VWQA 4LISA 2X0NA 1X7DA 3GFBA 3TZCA 3ZWXA 3JQAD 4INAA 1PZFA 1SBYA 2OP1A 5A9SB 4OM8A 3NX4A 1HXHA 3NJ8A 4R4JA 2DBZA 3RI3A 1O6ZA 3AOEA 2GO1A 3PVZA 3QA9A 4Z9YA 1R0KA 2ZQZA 2DTEA 4XQGA 4HFJA 5IF3A 1PGJA 5IZCA 1SB9A 3MOGA 4A2CA 2VNSA 1H2BA 2IYOA 1WWKA 3VH3A 4AICA 3A06A 1RM3A 4UREA 4CMKA 4U7WA 3ZWPA 3D4OA 1E77A 2B36A 1KS9A 2IE0A 4CUJA 1HE3A 1D8AA 1N1GA 3EVTA 4A0SA 3MCVA 3H4VA 1BG6A 5K0ZA 1IY8A 3I9JA 4CV2A 3BXXA 4M55A 3M2PA 3OQ6A 4YJDA 2ZQYA 4GX0A 4E2XA 4YYZA 4UUPA 5LDHA 4A03A 1KERA 1ISHA 4GI2A 3GGOA 1WW8A 4FB5A 4E30A 4HWKA 4L4SA 4PVDA 1HE2A 1C3VA 1LEHA 2NU9A 1FK8A 1NQTA 3GLQA 3LK7A 4DMLA 4J9UE 4BOYA 1SEVA 2VRBA 3DDNA 4JBGA 1VJTA 2RAFA 4YJHB 3INRA 2AQHA 4RPGA 3SJ7A 2GR9A 2YQ4A 3C24A 3D0OA 1ISIA 1M75A 3AK4A 1P44A 1OC2A 1DO8A 1VI2A 1XWFA 4J1TA 3ZV6A 4TZTA 3TNLA 1MB4A 4D79A 3ETEA 5ENVA 1U9JA 3GEGA 5GY7A 1X7GA 3RC1A 4B79A 4N5LA 2DVMA 4Q3NA 1X13A 2FHSA 3TFQA 3WSWA 3JSAA 4YT2A 1UDBA 3WLEA 4EITA 2P68A 3ST7A 5GMOA 3MOIA 1Q0LA 3BHJA 5ITWA 1ZMTA 2JD2A 3HN7A 4BKRA 2B35A 3D5QA 3L0DA 2I66A 4NFSA 1EZ4A 5KJEA 3B1FA 1GDHA 1Z7BA 3VPXA 1EFKA 1WDLA 3U49A 1T2AA 3QWIA 1T4BA 4EGFA 3P5SA 2LDXA 3GK3A 3KLMX 4URFA 3B6ZA 1M66A 5BSFA 4E33A 1NVMB 1Q0HA 5DF1A 2BFPA 1R0LA 4Q3EA 3PFWO 2XXJA 3LLSA 4CV0A 4TZKA 3WS7A 4B3IA 1Y8QB 1MUUA 3I23A 2OGUA 1Y8RB 3QVSA 3O03A 4D42A 4GX2A 2ET6A 1NVTA 4MINA 4RF4A 2IXAA 4FFMA 1U3UA 3JQAA 3NRCA 1GPDG 4MVJM 3GUCA 2Y68A 1N1EA 3I3OA 3W4JA 2HMTA 5T64A 4TROA 4WCFB 3BMCA 4YEDA 2J3IA 3DZKA 3GVPA 1HYHA 2RCYA 3E9MA 4Y8VA 2PKQP 2ZB8A 2CSUA 1WDKA 4J1SA 3HE3A 4G5HA 4ND4A 4HADA 3QP9A 4WOKA 1Y5MA 3VHRA 3GQVA 4BNKA 5DBFA 4BMSA 1VL6A 4RGBA 4BO9A 3HHPA 1YRLA 4AJJA 2D0IA 3GN1A 5FF9A 4C7JA 1K6IA 2HK8A 4CQMD 4F6CA 1ZKMA 3BIOA 5JNLA 3WJAA 2Y67A 5DP1A 1HDXA 5KJCA 4DYDA 4N7RA 2AQIA 2Y1DA 4PG7A 1U8FO 5F1KA 4E5KA 4XIJA 5JE8A 1T1SA 4WKGA 1F06A 3NV9A 1BSVA 3GAZA 2EW2A 1ADCA 1ORRA 4TKMA 4XR9A 1O95A 1WMBA 2Y0CA 2IXBA 2VRCD 1JVSA 4YQZA 4I9HA 3DR3A 5L7YA 2GLXA 2HRBA 1B8PA 3RFTA 1O0SA 3TZKA 2NQTA 1EQUA 1XU7A 1E5LA 3OETA 3HNPA 2F00A 3FNHA 4TKLA 1NTOA 5I9MA 1R16A 4I08A 1P31A 1QV6A 3AWDA 3TL3A 1A27A 4EZBA 1ZJZA 4FFPA 4AG3A 1GY8A 1DHTA 1ZBQA 3PTZA 1QLJA 3FTNA 4XYGA 5KVVA 2W2KA 2AEJA 1U4SA 4J16A 1L7DA 1P1JA 3NKLA 4BL5A 4MVJD 4OO3A 1V8BA 4ROSA 4AJHA 2OXIA 1E3WB 4WLNA 2XAAA 1P33A 1JLLA 3K2BA 3S2FA 1DC4A 3K5PA 3FR8A 1B3BA 3OF2A 4GMGA 1XDWA 5HM8A 1VC2A 4NMHA 5MGBA 1MG0A 3PEFA 1ISJA 3RBZA 2JD1A 4YAKA 2EXXA 5HA5A 4BO1A 3BAZA 3VVCA 3W1VA 2ZTUA 4L73A 2C59A 2GZ3A 4RVGA 5DN9A 1E6WA 4D0SA 3Q6IA 4PRKA 2O3SA 5JO9A 2PGLA 2DTXA 5KJFA 1Z82A 4XQ9A 3RJ5A 3F47A 3BYZA 1JU9A 4E6PA 3DB2A 3G49A 4RJTA 4BNMA 1K2WA 1YXMA 4WLOA 2JFGA 4IM7A 3RUDA 3FWZA 4B8WA 3Q2IA 4BS9A 1A9YA 1GZ3A 3LSYA 4HKTA 3R3SA 5HBRA 4FFOA 5TF4A 3L4SO 4O0LA 2FP4A 1FDTA 2IZZA 1H93A 1E1KA 3DOJA 1QORA 1DAPA 2DFVA 3OEWA 3DTYA 1IPEA 3AM3A 3H9QA 4ZHSA 1PQUA 4HBGA 3WNVA 3ZWAA 4Y6SA 2DAPA 2Y66A 1LJ8A 3R6DA 3E82A 2BH9A 4K1LA 5BQFA 4MVJI 1K6JA 3GGPA 4MKZA 3ZNOA 2JL1A 1ZSNA 2Y0DA 1A71A 1EBFA 3NDIA 4HUJA 4J1QA 3SXPA 4CQMA 1E5QA 3GDGA 1FF9A 2Y1CA 4CM4B 1VL0A 6LDHA 1EBUA 3OM9A 1NXQA 1AHHA 2X5KO 5TNXA 4YT4A 1OZAA 2GCGA 1M67A 3DHYA 3WWYA 3IP3A 3WBFA 4JQCA 4GSKA 1CETA 4PLPA 5F5LA 5CDUA 1A72A 3LYLA 2QQ5A 4CMBA 4PLHA 1L7EA 3ENKA 4EUHA 3WDSA 1BXZA 1CYDA 2VRCA 3RU9A 2NM0A 3QJ5A 3K2EA 1ADGA 3D3WA 3HSKA 5K6AC 5L45A 3VZPA 4OGWA 4GWGA 1HDRA 1QYCA 2PZKA 4QECA 1D7OA 5EQFA 5AXCA 4H7PA 4P38A 1ID1A 1N9GB 2G17A 3S55A 4XRGA 4J7UA 4WCFC 2Q1UA 2E49A 4A7PA 2NVWA 3PYMA 4JBIA 5HWSA 2NSDA 4ALNA 3S1LA 4J0FA 4QX6A 4LSMA 3KEQA 5A9SA 4MVJA 4B7XA 2OOSA 1KEPA 4E5YA 4K6CA 4OMUA 1DAOA 3KHUA 3FF4A 4RDHA 2OFPA 5IZ4A 4TWRA 3SVTA 3WQQA 2BKAA 2FSVA 3UXYA 3ZHYA 3JQGB 4WCDA 4CUKA 4YB8A 3RBXA 5CEJA 3N74A 5G0TA 3U4IA 2Q3EA 5H83A 1P77A 1ZVMA 3B1KA 4L8VA 2G1UA 2HMVA 3VZQA 2WEKA 3RC2A 4YCAA 3E1KA 4FC6A 2AA3A 3RUHA 1KIFA 1NP3A 3ZGYA 3JCZA 4I5GA 4XYMA 4E13A 1MLDA 4J4HA 5EL0A 3B1JA 5JAMA 1HWYA 4PRLA 1IUKA 4Z0HO 2BI7A 2X0IA 4MO2A 2OORA 4XJSA 1PL6A 4FBGA 4P4NA 3H9JA 3A14A 1NPTO 3QWFA 2EF1A 1LLDA 3KYDB 2VHXA 2YY7A 5I7EA 4HFRA 3UF0A 3VPHA 3AI2A 4UVIA 4C4OA 4YJHA 4RPHA 2A35A 2AXQA 2EHDA 2Q4EA 4KWIA 3D4PA 2P5YA 2NQ8A 3JYPA 3FSRA 4UUNA 1U2DA 2WJPA 1P9LA 2PLAA 3JTMA 3M1LA 2Q1TA 2OL4A 1N7HA 2Y0EA 4GX1A 4NH4A 4FFRA 1PZHA 3IDSA 3U62A 3RUIA 3JYQA 3F46A 1CERA 3PIDA 2Q1WA 3FR7A 2BFMA 3RD5A 2B69A 3ETDA 4UVDA 2AEFA 5A05A 1R66A 1RM4A 4E5NA 1VRWA 4Z0TA 1TVEA 3CZMA 4PLGA 1E3SA 1VSVA 3PQDA 1PQPA 2VCYA 3GPDG 5HRUA 3KXDA 4BO0A 3ZWMA 2IEDA 4WEOA 3EYWA 1C1XA 3ONFA 1V3TA 3WGIA 2GGSA 3RU7A 3GAFA 2FY8A 3PHJA 4GWKA 4BB5A 4DIBA 1C0KA 1I3MA 1U3VA 4G2NA 4LGVA 3DZGA 3PYXA 1H6CA 2R6JA 4L75A 1EDOA 1HLDA 2E6UX 4ZQFA 5KJ1A 1BWSA 2X4GA 4JCOA 1ZCJA 4LRSB 4ESOA 3ZU4A 3IUPA 3WTCA 2B37A 1UR5A 1Y8QA 4L76A 3D64A 5BNTA 2ZTVA 1Y8RA 2X0JA 3GDOA 1IHXA 4BO3A 5K6AA 3MEQA 1ENOA 3KSZO 3V1UA 4BMVA 2VTDA 3CE6A 1Q0QA 4MP8A 1KYQA 5DDIP 3C7CB 4XGIA 4OIMA 1E7RA 5MDHA 1ULSA 4QXMA 4WCFA 2YDYA 1X0VA 4RPKA 2WYVA 4ND2A 5A5FA 5ER6A 2DUUA 5JYDA 3VKUA 1LLUA 3RC9A 3ZHXA 4GPD1 1UAGA 5JC1A 1FJHA 3QWHA 4KUGA 1U5CA 4BNZA 4NPCA 4BKOA 2Q2VA 4JROA 3W6UA 3SC4A 5TIIA 4U5QA 1F17A 4QEDA 3NGLA 2RIRA 1Z7EA 2QG4A 2VHYA 4RV9A 3RUCA 1K3TA 3BTSA 4YDRA 2F1KA 3CTMA 5AVOA 4RF5A 3LLVA 4RVFA 4RVDA 4EUEA 3F1KA 4WEQA 1H9BA 3JV7A 2Q1SA 5KKAA 2CF6A 3ROKA 3DHNA 5TQVA 2V65A 5JAZA 2A92A 2YHUA 3H5AA 3ZW9A 4BO7A 3ADPA 5IFLA 4B4WA 3EW7A 4R1NA 3W8DA 3ITKA 3ABIA 4IMPA 2VYND 1R37A 3DFZA 1D4FA 1MFPA 1ZNQO 2YQ5A 2VN8A 1A7KA 1WXDA 3U9LA 4D46A 3QY9A 2PGJA 3JD0A 4MVJF 4K9DA 4RVUA 1ZK2A 4DYVA 3V1TC 4BGVA 3D7LA 2Z95A 3ZWCA 1JAYA 3PHLA 4IQ0A 3CMCO 1B15A 1PJSA 1I8TA 2AE1A 3DZHA 4PVCA 3U5TA 2V6FA 3FRJA 5C5IA 4FOSA 4O6VA 4CLOA 3AU8A 4BNGA 4R1UA 1KVQA 4BO6A 4RORA 1PEDA 4XRRA 1E3WA 1DXYA 4I8XA 4CL3A 5I9NA 3GEMA 2NVUB 4RF2A 2Y1OA 4J3FA 2ZTLA 4NBUA 5TJ9A 4FGSA 1QYXA 3HDYA 3EGOA 4BV9A 5F1PA 1A5ZA 3K73O 1GEGA 1DJNA 1LBEA 1PJTA 5JMPA 2NUAA 1QXSA 4CPDA 2RHCA 4Y9DA 2ZCUA 5JY1A 3D5TA 1R0SA 1G0NA 3PXXA 1WZEA 7ADHA 4FN4A 5ER9A 4IZHA 4LCEA 5JW6A 2ILTA 5DCUA 3OJLA 3KB6A 4ND5A 3ZHBA 4CM5A 2ZYAA 2PWZA 2XXBA 2CNBA 3GZ4A 3TSCA 3UCFA 1LI4A 4DPKA 3BHMA 3FI9A 1ISFA 1KEUA 1PL7A 1DRUA 4YT8A 1PJ2A 3GMSA 4CM9D 5ICSA 2EJVA 1XQ1A 2X5JO 3ADOA 4E32A 4E31A 4CLDA 2PZMA 1GPJA 1E7MA 2VUSA 1RM5A 4DREA 3PJEA 2YFQA 1MA0A 3EC7A 1IZ9A 3GVCA 1VPDA 1U2GA 4XJTA 1M2WA 2VWHA 3NTRA 1UXKA 3UW3A 4EUFA 2O7SA 2I99A 2HMSA 2IEBA 2EV9A 3C3XA 2I6TA 3H2ZA 1TB4A 5JDIC 3VVBA 4G65A 1HETA 1VE9A 3OQBA 3PGXA 3H7AA 1E7SA 4CM7A 1R4NA 3W6ZA 1MXHA 1PS0A 3F4BA 5COQA 1JTVA 1T24A 5A9RA 2VQ3A 3KLPX 1SMKA 1DB3A 4ZGWA 3MZ0A 4FJ0A 4BO5A 4A5OA 3QVXA 3WQRA 1YKFA 3I4FA 1C0IA 1WPQA 1G0OA 1KVTA 5L53A 4PCVA 2PZLA 1QYVA 2GZ1A 3ZW8A 4TMFA 1I32A 1S7CA 3EMKA 5B4TA 1ZEMA 1PSDA 5G4KB 4BO8A 3Q0EA 2JAPA 1DC3A 2YV3A 3HB5X 3WNQA 1BGVA 4EBFA 5C37A 3UHAA 2O23A 4WK6A 2DUWA 4BNVA 4YR9A 3TZQA 3D3EA 3LT2A 4ID9A 3DAPA 1BXGA 4DTIA 3PDJA 4RQTA 3PZRA 2VYNA 4GVLA 4DIOA 1N8KA 2A9FA 1I33A 3IP1A 4DBVO 4ZD6A 2ZCVA 5EJ2A 3EHEA 1N9GA 4J49A 4B4UA 2GNAA 3OA0A 4IIVA 3ORFA 4J2HA 2PZJA 4OXKA 1W6UA 4II2A 2FRDA 5J23A 5AXAA 2X58A 3A9WA 4DQUA 1H5QA 1UP4A 2AEMA 4MDHA 3WLFA 5GZ1A 2Q50A 2Q99A 2WE7A 5ICMA 4YTEA 2JCYA 5ITVA 4HFMA 5JLAA 3ROPA 3N7UA 5L7TA 2J6IA 3PIIA 4QO8A 1IHYA 4GQAA 1QLHA 5FEUA 2J5QA 4W4TA 3O9ZA 4B4VA 2TMDA 4X54A 3V1YA 1B3RA 2P91A 3WGQA 5TC4A 1ZO8A 4WLFA 4MVJG 4FC7A 4PG8A 1ENYA 3OSUA 1LDNA 3ENNA 1NFRA 3OHSX 1IULA 3UCEA 4D7AA 2B4RO 2IODA 4WECA 3JQGA 3KO8A 3KSDO 4U6SA 3WJ7A 2VT2A 2QRKA 3DHEA 3TZHA 3JD1A 1BRMA 2NVBA 3NUGA 4BNXA 1VJ0A 2H5LA 5B4UA 2J3JA 3QE3A 4BV8A 1EVJA 4FJ2A 1KVRA 5G0SA 5FI3A 3GZNA 3N58A 3WGGA 1GZ6A 3C1OA 1Q7CA 4UULA 4AVYA 1DC6A 4Z9FA 4ZA2A 4LVCA 3UAGA 4CM9A 5CDGA 5CG2A 2GSDA 2CFCA 2CUKA 3MJEA 5JDCC 4BNUA 3FN4A 2Y05A 2FR8A 3KYDA 3QRWA 4DC0A 2RH8A 3L07A 1KY5A 1CIVA 2O3JA 3DZJA 4FFNA 5L40A 5JPIA 1FDWA 1W73A 2D2IA 3QV1A 4KZPA 4DPLA 1PIWA 1VJ1A 2I76A 5KWEA 3GN2A 5L51A 1WZIA 2DT5A 3OBBA 3LT4A 5LCXA 2RBEA 1GU7A 2CF5A 3C7AA 1CF2O 3DAGA 2X1HA 3I6QA 1C1XB 4BNHA 3R1IA 5IAAA 2FR1A 1TT5B 2ZB4A 5U4QA 5TRTA 1LXCA 1OAAA 2P9EA 1DIRA 3FCOA 1N5DA 4Y6RA 5A06A 4ILKA 5JDIA 4CMHA 1P1KA 4EJ0A 3KYCB 1IZ0A 1HDZA 4IS3A 2GF2A 3BMQB 3OJOA 2UDPA 2J5RA 4R41A 5JXWA 1U28A 4FW8A 2O50A 4CLHA 4E21A 2Y93A 3ZWWA 2AG8A 4MKXA 4GBJA 1EVZA 1BMDA 3V2HA 2YW9A 1MFZA 2GERA 3DOCA 4Z3DA 2X9VA 4AJ2A 4BNWA 2OHXA 3AUUA 4UVGA 2QRJA 3ITDA 2NTNA 3UN1A 3ONEA 1U3WA 2Q49A 3HDHA 4AJ4A 1G6KA 3X2EA 4RL6A 4NR0A 2O48X 2NACA 3E48A 4GLLA 4NI5A 1Q7GA 3FBGA 1T2FA 2P9CA 4N18A 3DBLA 3PZBA 1UXHA 3WB9A 3NYWA 1PR3A 3W8FA 4Q3BA 1B14A 4NFYA 3L9WA 2Y1EA 3MJ4A 3COSA 4QFDA 4WJZA 3RKRA 3EY4A 2O4UX 2P9GA 3V2GA 3DZBA 1EVYA 2JKVA 4IGFA 5A03A 4D3FA 1ONNA 5IXYA 3WIDA 1CQJA 1KVSA 5JY6A 1SB8A 1I2ZA 1J0XO 2WE8A 3KV3O 3E5MA 2O7QA 4A10A 5IDWA 2VWPA 1NWHA 4JJGA 5F3RA 3K6JA 4XR4A 1KBZA 1PWXA 1ZH8A 5B37A 3VKVA 3BMOB 3H9GA 1EUDA 3WGZA 4RF3A 4DC1A 1I3KA 3QWBA 2P4HX 1UZLA 5DZSA 2DM6A 4XQCA 4J7CA 1M6HA 3IJPA 4FOOA 1DSSG 3TQHA 4Z6KA 2I9PA 3CEAA 1B0AA 3PHGA 5DP2A 4TRNA 2PD3A 1QRRA 5TT0A 5JDCA 2FZEA 4FPXA 4TVBA 3TRIA 3TDKA 4H16A 1JWBB 2Z1MA 3PWSA 4OOEA 5DULA 5A4DA 5C7IO 2P5UA 2O3UA 3WYEA 1VKNA 4W99A 1CWUA 3HN2A 4WOJA 3GR6A 1RJWA 3IOYA 3OJ0A 4L9RA 2NVUA 4YBZA 4RO0A 4F46A 3HDJA 3LU1A 1WP4A 2P4QA 1ZSVA 4R54A 4AFNA 1P0FA 4KMSA 3E6AA 5IDYA 3NGXA 1OBFO 3OFSA 2G0TA 3ZU3A 3Q9NA 2WTBA 1WMAA 4XA8A 2BI8A 1PJBA 1OFGA 4B3JA 5G2OA 1ZUD1 1YJ8A 3V2UA 2P2SA 1EMDA 2EWMA 2WYUA 1YGYA 2IYPA 4D43A 1Y9AA 3EDMA 3KOUA 3D1LA 1BXKA 3S2GA 2ZYGA 4NBVA 3X2FA 4YAGA 1I10A 3GFGA 3TFOA 1L1FA 2W2LD 3ICCA 3E9NA 4M54A 4BNJA 1X14A 5CFZA 3KEOA 3K9QO 2C5EA 3GUYA 1DIGA 2HAEA 3K30A 5G0WA 1R4NB 3UKOA 1PJ4A 3RAJA 2UVDA 4EI2A 4Z3KA 5CAEA 2UUOA 3Q1LA 3O38A 4D44A 3ETGA 2PR2A 4IJVA 5THKA 1OC4A 4O63O 3S8MA 1RM0A 5AQ1A 4Y98A 1NFFA 1PS8A 3PRJA 5C7OO 1MC5A 4EYEA 2ZKLA 3TF5A 4OYRA 2B4TO 1EQ2A 1SPXA 2C82A 3E8XA 3LQFA 3CIFA 4JP3A 5BNFA 1EK5A 2E48A 4HX5A 4BGIA 3MJTA 2IZ0A 3CPSA 2C07A 5FWNA 1GQ2A 1PTJA 2YV1A 4W9NC 3H6KA 3VDRA 1F12A 5JBIA 4EJMA 1E3IA 2JAHA 4E5MA 2I3GA 2WYWA 1BTOA 1BXGB 4OQYA 2DFDA 3BA1A 1GV1A 2OP0A 5F1OA 2D1YA 1HF3A 4BUCA 5A5EA 1N2SA 1NYTA 1B7GO 1RKXA 2WDZA 3GHHA 5A04A 5CEFA 1ISMA 4PG5A 5G4KA 3WFJA 2DU8A 5I9LA 1JKFA 4WLUA 3PK0A 1V6AA 5KIAA 1NQ5A 4PG6A 5BSHA 2Q2WA 4IDAA 4NFHA 3GT0A 3L6EA 2Y1FA 4YXFA 2PD6A 4FQ8A 4J43A 3C1AA 1KC3A 4PIVA 1XLTA 4LCJA 4QT0A 4IUYA 5KNLA 1I2CA 4WNCA 5G0VA 3PI7A 2W98A 3F3SA 4M89A 3AUTA 4OKNA 4PG4A 3NT4A 2Q45A 1IPFA 4PLTA 3IMFA 2NU7A 2O3TA 2BF7A 2B5WA 3O8QB 5DNAA 3RIHA 2Y1GA 4YQYA 4OOFA 1I30A 4AL4A 4DWVA 4S3MA 3VC7A 2DPHA 1Y6JA 1YL7A 3A28A 3GNQA 2GN8A 4WLVA 3KRTA 4Z0PA 1I2BA 2O3QA 2VYVD 4CV1A 1GCUA 4JBHA 1GYPA 5L3ZA 3INTA 3DO5A 5IDQA 3NTQA 1ZK4A 4J1NA 5L4NA 3HG7A 4CV3A 5CDTA 1PX0A 3GZNB 3ZU2A 3PHHA 3QLJA 3DQPA 4UVHA 4CJXA 3HDQA 3DL2A 4YRDA 3ZU5A 4DPMA 1SCUA 4NDNE 1A4UA 2QZ9A 1LSUA 2D5AA 4YACA 1O94A 3ZV5A 4CMGA 4QUKA 1W0CA 5L4SA 3VPGA 2PV7A 5TSDA 3QIVA 3ZH2A 1E1MA 5EQDA 3K92A 4IIUA 1NAIA 3JQ8B 4E0BA 1XGKA 2HO5A 4OL9A 4YPOA 5JMWA 2R00C 1MC4A 1ZW1A 4ZQBA 1X7HA 1GUZA 2W2LA 1EE2A 3ZWYA 1P0CA 1ADFA 4KUEA 3GMDA 4NIMA 1ZK1A 2G82A 1BHSA 4KQWA 3GHYA 3LC1O 3ONDA 4YAEA 3AFNA 4BGEA 1YQDA 2IRWA 2R2GA 5C7LO 4ONEA 4KTVE 4UEOA 2VT3A 2V6GA 1WNTA 1QP8A 1P74A 4G81A 3UCXA 1G1AA 4PFJA 1DRWA 1QG6A 3CZRA 4OXNA 1SZJG 4A26A 4LW8A 3R0IA 5TLSA 4ALMA 1TT5A 4AJ1A 1WAMA 1GYRA 4IDDA 4L0QA 2VOJA 3OIFA 2O3RA 3UVEA 5I7FA 1GADO 4NBTA 1I36A 4L74A 3GOHA 3KYCA 3WYBA 1W4ZA 1U8XX 2O2YA 4Y67A 3ZNPA 1BW9B 1XA0A 4KDEA 5DBIA 1CRWG 3BMQA 1EEHA 3LF1A 1UXJA 5EINA 2FSSA 1E7WA 3GF4A 4HNGA 4W9NA 2HU2A 4ZRNA 3H65A 3LZ6A 1Y9EA 1X1TA 5AYVA 2C7GA 1GR0A 1PZGA 4O5OA 1RYEA 2EP5A 1J5PA 3DBLB 3AY3A 3JQFC 3UUWA 3KETA 1HYEA 3JQ9C 4BO2A 1HSZA 4ALKA 2YJZA 2D4AA 4KTTE 4NQZA 4MIOA 4BB6A 3PYLA 1AHIA 4CMIB 3BTUA 5COAA 1HKUA 3KVOA 4ZRMA 2HMWA 4YRAA 3GY0A 3JD2A 4R9RA 3C1TA 3Q2KA 2UV8A 3WICA 4XEHA 5FFFA 3MJCA 2HMUA 3E18A 1YB5A 2NADA 3H2SA 1AE1A 3AI3A 4DMMA 5GZ3A 3LT1A 2V7PA 3WTBA 5LDGA 3ZI0A 4LVUA 3AFMA 1JVBA 2VYVA 4C7KA 3VTFA 4XDYA 1GD1O 1Q2XA 3KUXA 3ASVA 4GL4A 4IJKA 3H3FA 5I7SA 1LSJA 3GH3A 4ZVVA 4XKJA 1DLJA 2GN6A 1LLCA 2AW5A 3AY7A 2YYYA 3W8EA 1PS9A 1C0LA 1CEQA 1C1DB 3M2TA 4FSHA 4B8ZA 4YAIA 4NJOA 2EGHA 2W8ZA 1H94A 3G79A 1EUCA 4FR5A 5T5QA 1YQXA 3PDUA 4Q3DA 4WGGA 2ZYDA 3DEYX 4TRJA 2AHRA 2CY0A 1H6DA 3B20A 3BMOA 4Q9NA 4XCVA 2VZ9A 4IDFA 4JGBA 4FJ1A 4K28A 3GC6A 3RVDA 1E6EA 3H5NA 2FMUA 3VDQA 1E1LA 5B12A 1DPGA 3JQDA 4ALIA 1OOEA 2BELA 4HNHA 2SCUA 1WLYA 3FTPA 4LN1A 1ARZA 1RYDA 1MX3A 2DBQA 1W8DA 4NK4A 2R00A 1PQWA 4JK3A 3G0OA 1F0YA 4NZ9A 4RLSA 4F3YA 1H6BA 2JCVA 1VSUA 2VUUA 2HLPA 4GSLA 4ZU3A 4CMCA 3A1NA 3DAFA 3GPIA 4DLAA 4JX8A 3T4XA 4EDFA 3H9UA 4J91A 4J6FA 1P45A 5A3JA 3IKTA 1CQIA 4GLOA 2AG5A 1GAEO 2G76A 4CLEA 3PGJA 3UICA 1CJCA 3B70A 3GVIA 3QWAA 2HUNA 4IXTA 4BO4A 2E4AA 7MDHA 2JHFA 1NPYA 2JFFA 1B8VA 3IQDB 5U1PA 4AJPA 3LVFO 1UP7A 2EEZA 2EW8A 1V3VA 4L4XA 1VM6A 2QHXA 4PZCA 2ZATA 4DVJA 5H82A 2B0JA 1NBOA 2VZ0A 2ZK7A 2A4KA 3M6IA 3PQFA 4I9UA 1MP0A 2V6BA 4GVXA 3ZNNA 4F45A 2CVQA 2HDHA 4RDIA 2EKQA 1V35A 3Q9UA 5JYEA 4AJIA 1XHLA 4XZ3A 2Z5LA 3CH6A 1C0PA 4JXKA 2NU6A 1FXSA 3LC7O 4KQXA 1XYGA 3JQFA 2OBNA 2YFHA 3UH1A 4E2WA 3JQ9A 5BR7A 3AU9A 4ZJUA 3QW2A 4DXHA 1YH3A 2C2YA 1CDOA 3RFXA 1HEUA 1IYZA 4J9VA 3V5NA 2C20A 4CMJA 2XF8A 4FD3A 4CMAA 3TWOA 5EMHA 3JD3A 2BGMA 1YJQA 5CPFA 4IJUA 1YB4A 1YBAA 3ON5A 2FWMX 1ZXBA 1E7YA 1KEWA 3RASA 1R15A 1R4MB 2BFOA 4MIYA 3L6DA 4CR8A 3DZFA 3DBVO 4P8RA 4N54A 2ZTMA 1LSOA 2X7HA 3NDJA 4XDZA 2YUTA 2GZ2A 1B16A 1O5IA 3FBTA 5HTOA 4A73A 2POQX 2NU8A 1DFIA 2DBVO 4PLVA 5ADHA 3PQEA 1JAXA 3JQ7B 3I1JA 3AM5A 4JN6B 1UDCA 1XU9A 3IIEA 3EVNA 3L4BC 4ZQGA 1K6XA 4XYBA 5TGDA 4W7HA 4OHUA 4OXYA 2NTVA 5T8KC 2D59A 1KY4A 3VPSA 1LDGA 5KVSA 2C54A 4XQEA 1U1IA 3U3XA 5L95A 1PL8A 3EZLA 1E3JA 1PJCA 3K96A 3DONA 1ZMOA 4PZDA 5DT9A 3ZN2A 2FPPA 1VKOA 2WM3A 2UYYA 5IN4A 4XWYA 4IINA 3I9OA 4O59O 1E1NA 4AJKA 2X9GA 3M1AA 5DOZA 1MGOA 1YS4A 1YWGO 4Y6PA 2X22A 2QYSA 4CUZA 3OIGA 3F9IA 4BVAA 4UUMA 4B7UA 3O8QA 3GA0A 4WUVA 4Z9XA 1XIVA 1Z75A 4Q39A 3PFFA 4HFNA 1U7TA 3F5QA 4R51A 1TA4A 1T25A 2RHRA 5KVQA 2QZZA 1DIHA 1DOHA 3WXBA 1UUFA 3GNSA 3E5RA 3BHIA 3BMNB 3MWDB 2JFHA 4OSPA 1NAHA 2E37A 3WR5A 5AXDA 4IDCA 4XB2A 2RH4A 1PR9A 2H1SA 3C85A 3WG9A 4AJNA 1XCBA 1YBVA 2JD0A 1DIBA 1UH5A 3ULKA 4ND1A 1F14A 4EEZA 4E3ZA 1YO6A 2I65A 5EPOA 3CSDA 2O2SA 1E0DA 1HDCA 1LDMA 1TXGA 5EESA 4ZN6A 1H6AA 4R3WA 5JO0A 4IY1A 8ADHA 3H8VA 2X5OA 4RQUA 1ZK3A 1PGNA 3ZHZA 1YL5A 1EUZA 3JQ8A 4NU6A 2E82A 1GQQA 2VNAA 4MVJP 3GRKA 1DBVO 5F21A 3JQCA 1GQYA 4K6FA 4E4YA 4N5MA 2HJRA 3CKYA 4MOWA 1HE5A 3IL2A 4PLZA 4M87A 2BFAA 5L9AA 3JD4A 3IUSA 4CMEC 1TI7A 4R69A 4PLWA 1LSSA 5KVCA 1XSEA 5K9ZA 4DRYA 3NAQA 4I5DA 4WE3A 4IXWA 3WIEA 2PKRA 3AM4A 5FYDA 5ILGA 4YJGB 1R12A 5KOIA 4TRMA 1ZSYA 1U4OA 3BZUA 5T6BA 3A4VA 5JAIA 4B4OA 4GKVA 2QIOA 4AJLA 2B5VA 5L7WA 3ANLA 2I67A 1O89A 4AJEA 4E12A 4DQXA 1N92A 1LRKA 4RZIA 4ZQHA 3DFUA 4BQPA 2AMFA 4JNKA 2H9IA 3WSVA 1UP6A 3G17A 3RUAA 1GUYA 3AW9A 5THQA 5IXSA 1BW9A 2PD4A 1PGQA 2EKPA 1EDZA 3OH8A 4LSWA 1MXFA 2VWGA 4KDFA 5KCZA 3IS3A 4BNNA 2LDBA 2CZCA 5KTKA 4I1IA 2GYYA 1FDSA 4ALJA 1BDMA 3JQEA 1X15A 3NEPX 3RSHA 3ASUA 1HE4A 3HJAA 1GYQA 4RVHA 3SX2A 3L4BA 4CM1A 5JCJD 1V0JA 4JIGA 1DRVA 4K26A 4CODB 2AQKA 2OO5A 1YOVA 4PLFA 4II3A 5T8KA 3DMYA 2QYTA 4P22A 5C3MA 2PFGA 3WX0A 3QQPA 4NBRA 1NNUA 1P1IA 1YVEI 4GX5A 1ZZEA 1HLPA 3WOHA 3PJFA 1HZZA 2OUIA 3T7CA 4D3DA 1P1RA 3MJVA 1I0ZA 4CMIA 4JJIA 4LK3A 1WVGA 4DBZA 4R01A 3WGHA 5H81A 4FGWA 2FOIA 4YT5A 2QX7A 5TX7A 2TMGA 3P2OA 2PKQO 4J4TA 1GTMA 2YHIB 3DZIA 3UOGA 1NASA 1NQAO 1EVIA 4OKIA 1AGNA 4BIIA 1C14A 2BD0A 4AJOA 3FPLA 3FNFA 4I5FA 4F6LA 3JYOA 3NDRA 1AUPA 2OZPA 4NNJA 5I7VA 1LUAA 4OH1A 3G1TA 4CM8A 4TVOA 1Z73A 1D3AA 2HKIA 3UGKA 3QVOA 3ZV4A 2C7VA 5EERA 4OQZA 2GD1O 1C1DA 1H2HA 3OEYA 3NJ4A 1A7AA 3U4CA 4IPTA 1T4DA 4YJFB 4D41A 4NG5A 3GDFA 3PLNA 1SC6A 2PA3A 1LQUA 3GNTA 4CM6A 1DJQA 2VHWA 5ILOA 3PJGA 2ZJ1A 1OMOA 2H63A 1D1TA 3G1UA 4CQLB 1JA9A 3DC2A 1Y1PA 3TJRA 4U6QA 3SLKA 3WGOA 3ZV3A 4NJMB 1E3LA 5CPBA 3HFSA 3OMLA 1OI7A 4YAJA 3LF2A 3RJ9A 4D45A 1ML3A 2AE2A 2EJWA 1IB6A 3PLRA 3TN7A 4N5NA 3H3JA 4B7CA 5JSFA 1K89A 5FI5A 4ZQEA 5CP8A 4P4GA 4Q3CA 4NU5A 3ZWVA 2PY6A 1V9LA 4QSMA 1KC1A 2HK9A 2PH5A 4R5HA 1LQTA 4IZIA 4WNIA 5BT9A 1Z6ZA 6ADHA 4CR7A 4EEXA 3WMXA 4E2ZA 3K8ZA 3KBOA 3OECA 5G0UA 3DXFA 4CMEA 2VOEA 2Z1NA 1I5RA 4YVFA 5I8ZA 4GKBA 4XYEA 2G5CA 3ANMA 1U7HA 1I3NA 3DBHB 2WD8A 4LMRA 4MPDA 3T4EA 1MG5A 3UFXA 3I5MA 1H0KA 3PJDA 1GCOA 3QVTA 1VL8A 2DC1A 4RPLA 1NWCA 2CDBA 1JQBA 2IZ1A 1NPDA 3U4HA 3FPCA 3SC6A 4J4BA 1ULUA
chains in the Genus database with same CATH superfamily
1L4LA 1PN3A 1PJ3A 1UDAA 2Q3MA 3KSUA 4DTCA 1SK9A 3CH4B 3SICE 3UJAA 1HMYA 1ESCA 2WUGA 3OPNA 3KTOA 3R7FA 5HIKA 2A5DA 3WL6A 3R3JA 1OBCA 3F6RA 3LUFA 3CVWA 2WV9A 2FE1A 1DFGA 1WV1A 1L4YA 4G8JA 1H9AA 2AX3A 2QTVA 4BE4A 4ZYUA 5KNCD 3HFGA 4B6GA 4QDJA 2IDZA 2YWDA 1UPXA 1ZD5A 2BSXA 1A9RA 3VRHA 5K6TA 1XD2A 4TMKA 1LTKA 4B3TB 2HQ1A 3D8UA 5EKXA 1GAQA 2ZR9A 3EDOA 1G8FA 1OZGA 2CXQA 2HPHA 1Q20A 4ZCRA 5CEFA 3WLJA 4YX9A 5IVPA 3GG9A 1R5NA 4OSOA 5FOWA 2OENG 5TMDA 2PSSA 4OREX 1IDOA 2F7SA 2X6TA 4LRTB 3L9XA 1JKJA 3FHLA 3TKAA 4IILA 1G8PA 4PBRA 3AEXA 1WQ3A 1KVUA 2PK3A 4U2KA 1GILA 1LFAA 1XE3A 4FR0A 3GXBA 4V3CA 5GAJA 3C3KA 3I9V6 4BAUA 3RH0A 3AMVA 4DEVA 5JFGA 1FFGA 1Y8CA 5KMGB 3CF6R 1XG5A 3PKIA 5EXTA 1VA4A 2I4TA 3AY6A 1QMPA 2VP2A 1L5OA 2FCAA 5EMLA 3COWA 4IH4A 3GAMA 4I3FA 4K6GA 1JYFA 3VDNB 1ML4A 4PO9A 1N25A 1G3RA 4IS2A 1YS2X 4O1IA 3EAGA 2JFXA 1NV9A 1EE9A 4IDGA 2PUTA 5AM1A 4E2YA 3JQBC 2DLDA 1NMZA 2WIDA 3WZLA 1Z4IA 1A8QA 1YQQA 1HDGO 1FW6A 1A4RA 1S4MA 1U9IC 4Q1FA 1T0IA 1PSZA 1Z39A 3FWHA 4L4RA 1EH5A 5DB4A 1GZ4A 4HAXA 1KI6B 4E70A 1GKIA 2ASEA 2XUGA 3BUSA 3I9KA 2G71A 4B40A 3A4MA 3KQLA 1PNOA 1AQ6A 1T2EA 3T7EA 2RH5A 3UGTA 3QSYA 3UG6A 1JHOA 1M1YE 1T2UA 1THZA 1YJBA 2LUOA 3EW9A 1NG1A 4V2IA 3T7SA 1QP7A 2V6IA 4MCHA 2DFLA 3W6PA 1KQFA 1FFAA 3KJZA 4P4UA 3LLMA 1RVDA 3F5SA 3IERA 4YJ3B 2QRVB 4R9UC 1TEXA 2VDVE 3UY4A 3W4KA 3H13A 4D4HA 1C8KA 4NCXA 1RPAA 3U4DA 4EHKA 5LC1A 2ZROA 1E2HA 3I4LA 3MTGA 3QNMA 5ILQA 1R0ZA 4A27A 4KR3A 3U56A 2QPAA 4V1CI 5HUQA 4B5KA 3GVHA 3LBAA 3DE1X 1P5FA 3AFIA 2PXCA 1MO6A 4MR8B 5FL3A 2EWVA 1UKYA 2PMKA 5D7NA 2R60A 2RG1A 1JX6A 1Z4PX 4Q1VA 2HHLA 1HDOA 3HEAA 4Q4AB 1G19A 3T15A 5EIOA 1CUCA 4Y30A 3DMTC 5I7WA 3T12A 4CIDA 1HQDA 4QUJA 2A1UB 2VUHB 1AN9A 3U7QA 4M7RA 3GLFA 4N3CA 4FCCA 1ILEA 4NOJA 3MBKA 4PYJA 3RBVA 4PN3A 3V4RA 4B4KA 3CLTC 3MQFA 3AUAA 2V58A 4I4IA 2YHAA 4WASA 1S2NA 4TMYA 1T2CA 4DUPA 4LBZA 1MJNA 1E58A 2K5UA 3M4JA 2IXFA 1Y9DA 3NS7A 1Q16A 4LRUA 4EA8A 3MWDA 4RENA 2GA8A 1W29A 3HKBB 3HU1A 3M0EA 4PYOA 3IL2A 2JJYA 3BKXA 4ZT4A 4BRWA 4FFWA 2BGRA 1XOIA 4JDPA 4DL9A 3CVYA 3O2JA 4ENQA 1JA1A 2PQMA 4XYLA 2IH5A 2ZRMA 3GU3A 1X80B 4BKUA 2Z2YA 2UVPB 2XNDD 3DG9A 3LLCA 4EWLA 2CXSA 2XT9A 1V96A 2HADA 3RUFA 2BHNA 5K0CA 3KQVA 3R3VA 4FOTA 3KKEA 3P2YA 4YMUA 1BQ3A 5KNCA 3LIPA 2HCTA 3B53X 2BLLA 3KLBA 4CBVA 2VQFB 1YT5A 1IATA 1HURA 2QRLA 2WMNB 3ER9A 2XNSA 4C76A 1P39A 3ZEIA 1AUXA 1GU1A 4MROA 4NCKA 4B43A 4GRAA 1S5PA 4IIJB 1K97A 3KQPA 5F73A 5JJLA 3DLTA 3MPOA 1F5SA 1K6MA 2J8ZA 3ICPA 4G5FA 4WFJA 4KVAA 1L1EA 3SWWA 3D4IA 3U9SA 4IJWA 4MYDA 4I5EA 4JDUA 3A3YA 1KMHA 4LDRA 4LZLA 4BYMA 2EKBA 2XECA 4IGEA 2HSWA 4YQEA 5FWXB 4RVNA 1FP2A 2HJSA 2QRHA 3GVXA 3AI1A 5AKEA 2GZMA 3BIWA 5GIOE 1E4EA 1FRFS 2ZANA 5EGNA 3DVRX 3F4LA 4TMTA 5E4TA 5F7ZA 4D5EA 3BPSA 4HDRB 1QPBA 2NYAA 2PNFA 1Q50A 2VP3A 4L6CA 2Q5EA 3TS1A 2J0UB 2R7MA 1DWOA 1IK6A 1F60A 1L7AA 3N5CA 4LDJA 4N12A 4GPIB 4LKOA 4YJGA 3TPCA 1AUVA 4LFAB 3SCZA 4JC4A 1MC8A 4RVSA 4TQ9A 3K1TA 4DVGA 1NVUQ 4UEKA 4DA0A 3MWJA 4ESHA 1Q15A 2OMEA 1JJAA 1POWA 1GXSA 1T8YA 2QU8A 1BDBA 3EASA 3KQYA 4ML3A 3NTXA 4O4JF 2V6MA 4R40A 5TR9A 4QELA 2RI6A 3SJUA 5JQWA 5EE1A 1A9ZA 2OCGA 1D9ZA 3OKAA 3B52X 3ELBA 3KLNA 1CZUA 3L7IA 3NAZA 4NYMR 4WBXC 4KE9A 4GGPA 1EYZA 4MICA 3G2NA 4B83A 4TRRA 3VJLA 5J4VA 3A37A 1ENPA 2PMBA 4X92A 1NV8A 3S2UA 1L3IA 4BGUA 4W9RA 3QEMB 3WGYA 1VCOA 2ADFA 2FFHA 1M0EA 1P1FA 3I6BA 4JU8A 4PLCA 4P4TA 1CT9A 1YU6A 3AQ4A 1J49A 3KX2A 3SS8A 4BV3A 1B73A 4RY8A 4S05A 4GAEA 4CLXA 4TQGA 1F8FA 2BF4A 1GA1A 3E70C 3OLCX 1UMBB 1UIRA 5AICA 3HQ4O 2Q8QA 3THOA 1S8AA 2OBYA 3OTHA 1LDYA 4IW3B 2IVFA 4MTCA 4QJ5A 2PXXA 3PXGA 2QOEA 3W7BA 2HSDA 1ZESA 2RC6A 2WMDA 4YP9A 1O54A 4MYSA 2PH3A 2H9AA 1EP9A 1Z45A 1PGOA 1Y7IA 3W5HA 1W59A 3QHAA 4TYQA 5DRTA 1GFSA 1YA8A 4KPUA 4O33A 3O91A 4RFVA 1QRDA 5TXGA 3UMVA 3ZCRA 2V7QD 4OHBA 3ZX4A 4DGSA 821PA 2Q2NA 4GKKB 1Z2PX 4URZR 1P6UA 2H8KA 3T6KA 3T7IA 1AM4D 2B20A 1WVIA 3OJEA 4O5AA 1YQGA 1JHVA 1JMVA 2GVZC 1YQTA 3N8IA 4RHEA 4NYJR 1HTBA 2ZVQX 2EKLA 2WWRA 1LU9A 4FGZA 1YRWA 5HVNA 1LJUA 3G8DA 4H3HB 1U0SY 2XYPA 3QPVA 1X7WA 3PQ8A 3SKVA 1RQPA 3ZWBA 4FCTA 3AILA 4U9HS 4MZDA 3TG2A 4S2UA 4MUGA 3EPLA 1G5FA 2PLWA 2WHPB 2GHQA 2Y9PB 4ND7A 4QUHA 5GONA 4UXHA 5SV2A 3TGPA 3U61B 1BVUA 2XIJA 5FP0A 2XNDA 1KL7A 2MSWA 2KE5A 3HEBA 1PJLA 1YIOA 3FWPA 1RQNA 1RWBA 3AOEC 3EK2A 4LJ5A 1WMEA 4RJIA 3VPFA 4S1VA 4WZBB 3ZWOA 1WXHA 2JI6A 1N8TA 2ZXUA 1MH1A 4XGKA 3CINA 4Y2SA 1BMTA 3S2EA 3TOXA 4BZQA 1N0HA 3A26A 1HL3A 1FY2A 4WPGA 2Z2JA 4IMIB 3BTOA 2XRMA 3I76A 1B26A 4L27A 1N5JA 4LPKA 1JILA 4P93A 5FR2A 3PXEA 3K4QA 3U44B 1TD1A 5HE9A 1JQDA 2YBDA 4P7GA 2AWOA 4LHXA 1QC5A 4N0DA 3WNDA 1JJFA 2RHJA 3FJYA 2OHVA 4DABA 4JJKA 3KYBA 5BQPA 4ZIRB 2Y1LA 2CCGA 2GYUA 1XZ8A 2QXUA 4B71A 3NHPA 5TQ0A 4REMA 1Y3IA 3ZNQA 3DTTA 1CUEA 1UJNA 3ER8A 1NX6A 1I4DD 2H17A 4NAHA 1J2TA 1H0RA 1SUSA 5KYWB 5BT9A 3K31A 4QKQA 2QN6A 2VXBA 3T1TA 2F9MA 2JCGA 3IAM6 1JVNA 4C4TA 4QRHA 4DLLA 2COUA 4J2OA 2E6KA 4NECA 4LE1A 3AEZA 4MVJH 4DLPA 4F8JA 1Z37A 2PKWA 3FA2A 5LLTA 1NUQA 3VA7A 1AXGA 2QM8A 2WSBA 3DBRB 3SXUB 3WMWA 4BNFA 2HSEA 4JYAB 3IAHA 3AWIA 2XNHA 4KXXA 1F8GA 2X8LA 3OM1A 1QFXA 4BAZA 4S2EA 1RXVA 5IASA 1NQOA 2WPNA 3ZOKA 1H05A 3ENZA 3X2SA 2OYSA 2DUJA 4J2TA 4PTZA 4C2UA 1KI7A 2XUOA 3WP0A 1N2EA 4J1TC 4LJ9A 4DV4B 1CRPA 1JLMA 2LE0A 2ZS7A 2OFFA 1P81A 1JNYA 2YMMA 1YCFA 2VO1A 4JJFA 4DANA 4DMCA 2BZ1A 1PJ8A 3BCRA 3HYRA 4C5AA 2HRZA 2YXBA 1I01A 3AVWA 3LT0A 4YI3A 1CVIA 1CRQA 2C8JA 1E20A 4KLZA 1E2QA 1I6KA 2CLEB 4HXYA 3NU1A 4FDTA 2BWJA 3GOQA 5FBHA 1UDXA 2PX5A 1QV7A 1FNSA 1VQ1A 1XMVA 4UEJA 4W82A 5H5JA 3TW6A 3BFXA 3AY0A 2R6ZA 1V3UA 3NONA 4OPMA 1NJ1A 1N5RA 1V2GA 4CQMB 3Q3EA 1SUBA 3O3CA 2VTEA 3URMA 5BSGA 3FYTA 2GZHA 5CDSA 5I01A 2C1EA 2J3EA 5JD6A 2D8AA 2VJAA 4ND3A 4QFCA 5LZ9A 1AQYA 1FVOA 1HT0A 1L7OA 1TC1A 2V7QA 2X86A 2ZB3A 2C2BA 3AEUB 3HCNA 1DS6A 1Y89A 2JZCA 3I9LA 5KMGA 1WY7A 3F5MA 2DX7A 4Q9JA 2VDKB 2H2HA 1KEVA 4G1MB 2WHRA 4H7FA 4HGRA 2PRYA 2VHVA 3BB3A 1ZHHA 4FMDF 4FUQA 2I0FA 1QK4A 2HEGA 2PGDA 1V7ZA 3VZSA 4CQMD 1WVMA 3DGEC 4W9MC 1MJ5A 1EI9A 5JCOA 2C5AA 4B35A 1LNQA 2HBQA 2BRUA 1CVLA 1EDBA 1NJ8A 3KNZA 1SOVA 3FTDA 4FSDA 1IQPA 2PTGA 5CK5A 2OBLA 5B1DA 5LXTA 3MS4A 1E0KA 3LAWA 1LDBA 2B94A 2PZ8A 2VWQA 2P4EA 1KI6A 5C5CA 4Z1MD 3AC0A 3ZY4A 4IHJB 4HNAB 4TOIA 1PZFA 3QH4A 1SBYA 1HNXB 1VCIA 2D3WA 1X6VA 1EP2B 4INJA 3C3CA 1WZNA 2VJKA 4OGKA 3OPYI 2X8JB 2MTBA 5FBWB 3CVXA 2DBZA 4GPEA 1O6ZA 1ZMBA 1GVHA 1A50B 4CHTA 4XVRA 3H2IA 2DTEA 4FFVA 1ZR4A 3C6ZA 4PN7A 5IF3A 4YJ3A 3O7MA 5DLPA 5LLSA 2CB0A 1SB9A 2XTAA 4Q24A 3I5YA 1OILA 13PKA 4J0IA 4A2CA 4KYVA 1GSOA 1RE1A 1ZMRA 4PYIA 4KIGA 1RM3A 4UREA 5FNVA 3S29A 1KDVA 3VR6H 2IEIA 2MJLA 4FGKA 2DQSA 3D4OA 1OYWA 4K40A 3SKYA 2VUIB 2B36A 4MR8A 1P0MA 1Q1AA 4MB6A 1HE3A 5K05A 4G84A 5CCBA 3GEPA 5JD5A 1FMJA 4A0SA 5BUZA 4AI6A 3MCVA 5K0ZA 4CV2A 4YJDA 1TYCA 4ECEA 1O95C 5AVSA 3ZUGA 5I4IA 3N0VA 4GX0A 4YYZA 4JYBA 1TIBA 1V5FA 1FP4B 2A1UA 2G4LA 1WRBA 3NUQA 2QN2A 2C84A 4UUPA 1SVOA 4ZOCA 5TPZD 4A03A 4ETWA 5EE9A 1NP6A 1G20E 1KZ7B 5ICCA 2R8XA 4E30A 1SD1A 3BSSA 5GONF 3HL0A 1AKWA 4JODA 1RYYA 4UBMA 1NQTA 3GLQA 3DDHA 3LK7A 5IKEA 2Q27A 2XMPA 1QIKA 4DJTA 4ERNA 1SEVA 3IA7A 1XQVA 4JXXA 3PC4A 1VPEA 1FRNA 5DXFA 3TXAA 1VJTA 5K8VA 1XCPA 2ESRA 4JLUA 1X80A 2AQHA 2JGRA 2EL7A 2UVPA 3INRA 2GR9A 3LBYA 4FE4A 2MT9A 3FMGA 1F5NA 4FNMA 5JHGB 3C7KA 1ISIA 5MHTA 1M75A 5DYGA 3WKAA 1NUTA 1YFZA 1R6TA 3MHTA 1ABEA 3VQTA 1MB4A 4D79A 1HRKA 1U9JA 5A0FA 4P2GA 5H80A 3SYRA 4HDNB 5E6SB 5FOUA 4YUWA 2C4HA 1OWLA 3PG5A 4GW3A 3WRVA 4AIIA 4AUNA 3RC1A 4B79A 1XX6A 3EY9A 4IIJA 3DMGA 4RV5A 3UT5B 3SVZA 5ALVA 5IM4F 3WSWA 1A9OA 1D03A 1R50A 2AFVA 3JSAA 4C4XA 1RAGA 3UAZA 4D0NA 4NZNA 1RE0A 3YASA 1KGDA 4C4YA 3BKWA 5FWXA 2ZT8A 3LVBA 5A6SA 3KG2A 5EP3A 2IFTA 3D5QA 1XD8A 4IIDA 1E64A 2I66A 4QWWA 4ZI7B 3AHEA 4HYEA 3B1FA 1GDHA 1WSAA 2LWIA 4BJ1A 1EFKA 1GPMA 2BBWA 2IHJA 4HDRA 3U49A 3VZCA 2J0UA 1MENA 2WMYA 4Z0NA 3USZA 4AZWA 1Y8ZA 1HGXA 1LI7A 1IMOA 3H99A 4URFA 1W35A 4MUYA 4Y1RB 4HGNA 4MGYR 2BHSA 5FAXA 1DDIA 3B9BA 1Q0HA 2QSZA 1MTOA 1R0LA 1O9GA 3BDVA 4MWEA 4Q3EA 1JKXA 2XXJA 3KQNA 3ZZ1A 4Y7DA 1BWQA 2BTQB 5E1MA 4TZKA 1FQWA 4U2FA 2BMWA 4B3IA 5KQSA 3I23A 4C88A 5DTMA 4WN9B 2Z6AA 1CFJA 4D42A 5HF5A 1EBBA 3RK1A 4RF4A 2DGDA 3KKZA 2A7QA 1IEQA 1U3UA 4Z1MA 4D6PA 3D8BA 1TMYA 2DFPA 4Q00A 3QEMA 2XYRA 4KSYA 4M99A 5T64A 5CA1F 1Q44A 2E85A 4WCFB 1TGYA 2ZJOA 2OCXA 1QF6A 1K88A 2AIRA 4YEDA 3C8UA 3GCGA 3AVOA 2ZUWA 1OAOC 1L4BA 1UMBA 5JH7B 2XZOA 2XIQA 1AF7A 1K8QA 4PYQA 4QC2A 3UAWA 4UPEA 1NYQA 1QKJA 1KJNA 2IE8A 2GEVA 2RGNA 4I3GA 1UBSB 5ALOA 1ZOSA 3QP9A 2QTGA 4WOKA 4A23A 3UJNA 5F33A 1M5RA 4NEQA 4Z54A 1WG8A 1QCDA 3QNWA 2BUAA 2E4XA 1VSTA 2PANA 4EY5A 1W52X 1PF7E 2R1VB 3P0IA 2QI9F 5JNWA 3N3BC 4JBLA 1KOGA 3THSA 3G82C 1YD7A 2HJ9A 3GN1A 4AJJA 2HK8A 1VPLA 4RLQA 2VF2A 3QMVA 1CUSA 2E4UA 2R5NA 2QKYA 2DWCA 3PT5A 1EX1A 3QTTA 2WB4A 2C4UA 3KJEA 3NKVA 4YRTA 4ETMA 3K9CA 4B5LA 5BV8A 3BH6A 3HVRA 2AFIE 4DYDA 4G25A 1YZTA 4F85A 5TPZA 1JBKA 3EQ6A 3JAKB 1EG2A 1EFCA 1RW4A 1ADCA 5IAGA 1ORRA 1NSTA 2IIPA 3JZFA 4PR3A 4OH7A 3WNCA 1DELA 1NURA 3MQ2A 3QG1A 3RDPA 3SHFA 3NIDB 2IXBA 2VRCD 1KKUA 1N6HA 4HLUC 3T0GA 1QFMA 5L7YA 2GLXA 1YA6A 2HRBA 3I04M 1VYUA 1B8PA 3TZKA 1EGHA 1O0SA 4GKJB 3GWGA 2R4UA 4K46A 5BW5A 1EQUA 2JB9A 1HE1C 1PR4A 4CCAA 4LHSA 5AK4A 2WHPA 3HB1A 4TKLA 2OPBA 3K0KA 4HTFB 4LFCB 1C3XA 2BEWB 421PA 4ZCMA 2DUMA 1FP6A 2P1ZA 5HF9A 1K66A 3VU0A 4BFZA 4F06A 4FFPA 4WZBA 2BTOA 4HWOA 4X97A 5T4BA 5CB6A 1ZBQA 1VLQA 2ECOA 4PO8A 4YJ3F 1QLJA 4BB0A 2IDKA 4KAJA 1J23A 4J16A 2P6UA 2DQYA 3RABA 3QLUC 1ZS9A 4EARA 4PE5B 3TLCA 4LCBA 1XL1A 3TBKA 3LKVA 3EXEB 5HG0A 3FHTA 4NNPA 2ZBEA 4N40A 2DG2A 3DZCA 2B4KA 2O5CA 2NPIA 4DAEA 2B1QA 1M74A 3FIUA 1H4QA 1BYUA 5BMVB 3U44A 5BSKA 3S2FA 1P7VA 4RIHA 1DC4A 1MVOA 3FR8A 2WSIA 3K5PA 1B3BA 4D9MA 5HZGA 3R9XB 3R0VA 3OFJA 2O8FB 2W37A 3TQSA 4GMGA 1XDWA 1RWNA 3OWHA 5HM8A 1XNRB 4ZIRA 2NUAB 2X4LA 1Q7RA 1IAVA 1QFYA 2XA2A 2BI4A 2PYIA 3HXLA 1ISJA 1Z2CA 2BT4A 4YAKA 1ORWA 2EXXA 3AR8A 4LY9A 1GFIA 2H9YA 3BAZA 1XAGA 4FNGA 4IG9A 5HFNA 3SNKA 2QGNA 3V4OA 3FYCA 4L73A 5DN9A 5KQMA 4KRFA 5ALUA 4ZOEA 4B74A 3TCXB 2W2QA 3Q6IA 4JCCA 4PRKA 4G85A 1AVTA 4HH1A 2YYSA 4ND8A 5CJ2A 5E6UB 1Z82A 2KX7A 3O21A 2AUNA 4EG6A 3VC3A 5BWOA 3K8QA 1K06A 2F9FA 3AB8A 3JY6A 3RJ5A 1T4CA 3WL8A 1PFUA 3N8HA 1ZR2A 2D1RA 4E6PA 3DB2A 3G49A 3ND6A 2O7RA 3TR0A 3SYTA 4RJTA 1WULS 2OC4A 1FP7A 3EVCA 2QPLA 4EDHA 1USIA 2JFGA 2WPDD 2YJTD 2X42A 3EZXA 3FWZA 1AK2A 2HNAA 5K1ZA 1GZ3A 2ZYVX 1IUOA 5TF4A 2EQAA 4O0LA 3KFXA 5CD1A 3BJZA 2C5SA 1FDTA 2HQOA 1ZU4A 3NAGA 3NHMA 3TAHA 2QRPA 3BIJA 4M9XA 2FPGB 1VJDA 5GGXA 1E1KA 3EFEA 3VU8A 3DOJA 1QORA 1HPLA 3I09A 2H0RA 4M8LA 4X5OA 5FULA 3DTYA 4HBGA 1ULZA 3ZWAA 1G4AE 4Y6SA 2ZZKA 2BH9A 3AETB 5B5SA 4K1LA 5LZ4A 3HJBA 2LRHA 3DV9A 3EQ7A 1CTQA 1K6JA 2O59A 4ZJYA 2H8GA 3ZNOA 1FFSA 5CT8A 3F3KA 3B7WA 1G64A 3EFHA 1N4DA 4JD5A 2TYSB 2QVYX 3MJDA 4PAWA 4NBLA 1Q1GA 3SXPA 1KI2A 2DWOA 4M0FA 5KQRA 4CQMA 3LHIA 1A04A 1T15A 3F6CA 2ZRKA 2Y1CA 3I32A 3FMIA 3OM9A 5TGTA 2X5KO 2HRQA 3KL4A 1XJWA 4AAYA 3DD5A 3MT8A 1M67A 2CXXA 5M2QA 1NRJB 4LA4A 3DHYA 1ODJA 2EFDB 4Q7QA 4YMSA 1QQ5A 5MN4A 1Z5OA 3AEUA 3DMHA 4GR4A 1CETA 1RQGA 5F5LA 4FILA 3MMZA 3PC8C 2GBLC 4PBSA 1YZNA 3L41A 4LI0A 2H4ZA 4RPCA 3SHVA 5A4FS 2B30A 1OH5A 4D3ZA 1IBRA 1XZBA 1GZVA 2CLMB 2VRCA 2NM0A 3QJ5A 3RU9A 5K03A 1LK0A 1RZUA 1DO0A 1XB2A 4KODA 3AUXA 3AR3A 5D3MA 4Z4QA 5K6AC 2C9OA 2X19A 3OOYA 2GI4A 5A0VA 1WSDA 3FGPA 1B0PA 3NTLA 4MGHA 3Q6NA 2EJCA 2O2IA 3L7OA 2FEKA 3OT1B 1OX6A 1E2KA 4EVQA 2QRGA 1YS9A 4IJ6A 1N2XA 1K8ZB 2O6HA 3PEVA 3S55A 1QM5A 5C8ZA 2ORWA 4ZYYA 4KAXA 4GD3Q 2NSDA 3NG1A 2PS0A 1K2VN 3QJYA 4IHJA 1BH2A 5CH5A 3S27A 1UQRA 1U7UA 3S8EA 2CL6X 3IQZA 2FLKA 5AKJA 3AINA 4LHZA 2ZQ5A 2CLLB 2X8JA 3M6XA 1KEPA 3N76A 1KAQA 1JB1A 3SQMA 2ABWA 4MA4A 2NSHA 4P6VF 4LNUB 4HDAA 3FF4A 1XLWA 2VG8A 4M9UA 2OFPA 5IZ4A 4KQFA 5F9MA 1B2RA 2FSVA 1E5XA 4JHXA 2FSHA 5DYWA 1JHYA 3JQGB 2PN1A 3G8YA 2ZJ6A 1HTWA 3T1VA 3U4IA 4AY5A 5H83A 3ADCA 5C8DA 2HQSA 2WVHA 3QXJA 1GVNB 1BA3A 2A5YB 4BQNA 2GN2A 1U7PA 2BL4A 2WWFA 3UK1A 1MB3A 3IO3A 3RT9A 2HUPA 3L3BA 4BQEA 2H4JA 2WIAA 5J43A 1CJSA 1UXOA 5TARA 1NP3A 4YDHB 1FP4A 2WQ7A 3G0CA 2FF5A 4E13A 4I5GA 4MV1A 1RMQA 2PX2A 6CHYA 2ZWIA 3QKSB 1XDUA 2CJPA 1T35A 5JNSA 1Z6AA 1RCFA 1Y7LA 1HWYA 2QDKA 2PRIA 1W34A 4Z0HO 3OC0A 2OAQ1 4XJSA 1PL6A 3DCNA 4EW2A 3H9JA 2AG1A 2XB4A 3Q8WA 4TXLA 4N7JA 3AFOA 2WPDA 2AOUB 4WNAB 1BZYA 3IAM1 5TEWA 3QWFA 4EKGA 2HTEA 2XKBA 2WSYB 3LCJA 4Q7LA 1H2RS 2C1XA 2MHCA 2Q0XA 4F4IA 4I1YA 4QATA 1Y37A 1L7QA 3FZGA 4YJHA 2XVAA 4C4RA 2AXQA 3TO5A 3KAQA 4MSUA 1LW7A 4DIUA 2FK7A 3IV7A 2QVGA 3A25A 2NXEA 4GX1A 2OL4A 1N7HA 3HCPA 1I4OA 2ADMA 1WP9A 3CEPB 3CM0A 4FFRA 3OEHD 4HDNA 2J9RA 3MTDA 4QFMA 2DFNA 5E6SA 3RUIA 3WLPA 1BJTA 3ZY2A 4WFIA 1QZZA 2VXCA 5FORA 1G98A 2AEFA 4H59A 4RPIA 1OR8A 5A05A 4E5NA 5CBPB 2NZ8A 3DE5X 3TG8A 5ELMA 5GJBA 3CZMA 5KS2A 2VIIA 1QAMA 4ZCTA 2ZW9A 1H2YA 3M4NA 1VSVA 5F1YA 1E9EA 2VCYA 5FUBA 3KXDA 4CETA 2Q62A 5FV7A 3M49A 2D06A 2PMEA 2QK4A 1OT5A 2G8LA 5KWJA 3A1UA 3ONFA 4ZI7A 2P9QA 1V3TA 3ZDBA 3HDVA 3DVQX 2FFRA 2FY8A 3QPUA 2PUWA 5B3JA 4UOQA 2P0YA 4ND6A 3CH5A 1SH7A 1KYYA 1SUAA 2VTKA 3TMAA 3KOZA 4KWCA 2BGIA 4HL6A 2W00A 1DAGA 1JR3E 1QJCA 3C3EA 4P7JA 4ZO6A 2GHTA 1H2EA 1H6CA 1C4XA 3PNSA 3HVKA 2E6UX 2JFWA 1BWSA 1V26A 1ZCJA 1RNLA 3ZVMA 1NUSA 4HMOA 1FSSA 1CY0A 4TTTS 4AZVA 2BTQA 4ESOA 1SXJB 3UG7A 3SJZA 4U7DA 1GSHA 1PP4A 4YRGA 2CKDA 4RH0A 3FCAA 4P5PA 3H2KA 5BNTA 2R6HA 2ZTVA 3OZVA 2EATA 4JOBA 4HWTA 4WN9A 4DIDA 4BO3A 2PS1A 4EP1A 2WOJA 5HZKA 3MEQA 1ENOA 1V5WA 7MHTA 1JDBC 4BMVA 3K3PA 1ACMA 4YIKA 4A5SA 1Q0QA 2GBGA 2WJIA 3VSBA 3REOA 1GGFA 3A9TA 3SFZA 4IWYA 4OIMA 4RLFA 1POXA 4WCFA 2GZRA 4LECA 3IQFA 1NU6A 1XZCA 5HKAA 2C57A 4ND2A 4HNSA 4O4LB 4AMYA 1NUAA 1O0CA 4AZ0B 5EHGA 2WWGA 2P8SA 1J42A 5JH7A 1LLUA 1QVZA 5BV7A 1FJHA 2IW3A 3QWHA 5KU1A 1CIJA 4YRRA 4W1QA 3AHFA 1A7JA 1AKYA 4BKOA 2Q2VA 3SC4A 3B5IA 2NO1A 1E3QA 1TCUA 4U5QA 4IDOA 2IU6A 4OU5A 2DQKA 3EEOA 2R1VA 5BPFA 2QG4A 4UEQA 1DXHA 3B1WA 3RUCA 4HMPA 4BLUA 1JB9A 4P82A 3AHCA 5KEIA 1ZQ9A 4GXRA 3NETA 1RQRA 4BASA 4PF1A 5IVIA 2AR7A 3PWTA 2V7UA 1IUPA 4M3NA 4P7BA 3G88A 4B6RA 4FP9A 3RS8A 2JGDB 1SIOA 1X3LA 1YR8A 3F1KA 4Q34A 4L5YA 4WEQA 5I7RA 3JAKA 1TJYA 2F43B 2IOHA 1SRQA 3DGFC 3DHNA 2V65A 4IFEA 4PQFA 2PL9A 3F2IA 3HABA 3ZW9A 2FNAA 3D5EA 1AMOA 1L5YA 4OFBA 4R71A 1PFYA 1I2AA 2JIMA 3W8DA 3ITKA 3ABIA 2FRDC 2C4TA 4IRUB 2IPMA 1MFPA 4IHJF 1JIKA 5J2UB 5FA6A 2XHZA 4COOA 3GLGE 1D2HA 2VN8A 4X66B 1RRPA 5SY9A 1QX4A 3AP1A 2V5VA 1VHJA 4D46A 4HTFA 2BEWA 3UJ6A 2PGJA 2OOKA 3MS7A 2Q3BA 1YR7A 3I1IA 2VSNA 4RVUA 4D92A 4AMGA 4BFTA 2Z95A 3GUZA 2Q5HA 5DEIA 3RVOA 2QL5A 1B15A 3CMCO 1FOEB 1KR2A 2WAAA 1PJSA 5EIEA 3QU7A 4BEJA 1P9WA 1XHEA 4TV9B 5HOQA 2WKPA 3F9RA 4IOLA 2CJFA 2CMGA 3DLAA 2CBZA 3OEHA 4O6VA 3BWBA 3CCFA 4LV5B 3EXEA 5EIBC 3WWEA 4A2QA 1ZM4A 4AMBA 5FTJA 2P3LA 3UMYA 5I9NA 1QZ3A 3ETLA 4I8XA 5IMSA 1M2VB 4Y2UA 4IVNA 1W1UA 3CRVA 1TZBA 1TJNA 5BMVA 2Y1OA 3KPWA 4I1PA 2ZI6A 2H4FA 1FS6A 1QYXA 1DJOA 1TC2A 2HA7A 3EGOA 4JVMA 2Y8EA 1YI0A 3C6YA 4X45A 4MGIR 5F1PA 3KKQA 2O8FA 5AI4A 5DSZA 3R7LA 1GZDA 1PJTA 5JMPA 4B47A 1KYTA 2NUAA 3JZIA 4CPDA 2RHCA 4Y9DA 1X7YB 1R0SA 3D5TA 2JPDA 4FN4A 4Q66C 2XVXA 4QPZA 2ILTA 1QGAA 3D7SA 3OJLA 4NMXB 3VNAA 1NNI1 4DR2B 3VU9A 1FNBA 1C7FA 3W5SA 2CWDA 4KXNA 1U7ZA 2VJMA 2XXBA 2YJNA 2ZJFA 3SIXA 5E6UA 2IBTA 1HNWB 3L2OB 3TQOA 2GQ0A 2OBMA 4EHAA 1LI4A 2E0IA 2IKSA 3FI9A 1ISFA 3IUYA 4IQFA 3QLTA 3LGAA 4Q4LA 4BMOB 2QUKA 4PS0A 3D0KA 1XQ1A 2WF6A 3Q7SA 4LXYA 4C6HA 5EMKA 1Y4DE 1XF9A 5A7HA 1KJIA 2BGNA 3HKCB 4BBJA 2VUSA 1IQ0A 3LCRA 2YFQA 3LUPA 2GEBA 1IZ9A 1T9KA 4L07A 5IABA 1OGYA 3PC6A 3H42B 2G4VA 2VWHA 4WY2A 4CFSA 2C8LA 4CRWB 2O7SA 4EUFA 4RKRA 5FLEX 3NJRA 2H7YA 1JDNA 2ZBFA 3GQBB 4Z9AA 1TB4A 2OK7A 3OU6A 5LJIA 1NXSA 1QP0A 3U7GA 1QBKC 2XUJA 2OGWA 1HNNA 2QTCA 4A6EA 4LXGA 5IKPA 1PS0A 4NY1A 4N5IX 3VYVA 3PNPA 1S2IA 2HWYA 2FOXA 3D6HA 5CB4F 2VQ3A 3OZFA 4RDCA 1DB3A 1KZ1A 1B1AA 5ALQA 1VMIA 2C9CA 3EH2A 2QMOA 2ATEA 2IW1A 5B55A 1LTQA 4WA8A 4MW2A 1IRIA 1QQ7A 1U7WA 1C50A 1G0OA 1KVTA 2GM9A 3SBXA 2GZ1A 3ENWA 3IJ5A 4D57A 4TMFA 2ONYA 3RC3A 3CN7A 4XI9A 3U7HB 1E8MA 1TTHA 1LNSA 3EXG1 3V8QA 2HCBA 1XVIA 4WY8A 2O23A 2DUWA 1SKBA 1TYZA 3D3EA 3UC9A 1X9GA 1VFPA 3PDJA 1N2OA 3MAJA 4M22A 4HRYA 3BB1A 2RK6A 4EKIA 3CU5A 4ZD6A 2P90A 2JEYA 3EC1A 3EHEA 1SXJD 2RHGB 3K0AA 4G6ZA 5ARDA 1UJ6A 5KPJA 1UOQA 2GNAA 2XCRB 3TIFA 2PZJA 4YALA 2I03A 4II2A 3FTEA 3DV2A 1WUJS 5KNBD 2X58A 1FRQA 1IBLB 1H5QA 1P3JA 2G9UA 4MDHA 4P3PA 2A9QA 2QQEA 1O77A 2JCYA 3N6XA 1E5VA 1JQ5A 1PT6A 3C3AA 4UUQA 3A2LA 2JJMA 3LTEA 2RGBA 4E1BA 2J5QA 1QRSA 2YW2A 3O9ZA 1G2OA 1K4MA 4RA9A 5I48A 2J4DA 2TMDA 5FBZA 4X54A 4WK2B 4O1HA 4LNUA 5P8WA 2I62A 4UHBA 2D1SA 5K4GA 3WLOA 1ZO8A 2NT4A 1UBCA 1O08A 4LQLA 4Q9HA 5K6RA 1ESDA 2OY0A 3ILHA 4D7AA 1IULA 2ZJ4A 2JHCA 3JQGA 4UUAA 5LQRA 2GXQA 2VT2A 2D1FA 3FYSA 4MEAA 1QIEA 3KJNA 3JD1A 1CJTC 1TM3E 2NVBA 3QXCA 5F51A 3OJXA 4KIWA 4L08A 2XUZA 5EVJA 4FMBB 2J3JA 2Z30A 3D6MA 3L7NA 3R9IA 1PR6A 3KOYA 4PY2A 2ZRFA 1MNQA 2GF0A 4LG1A 3UXMA 3CSUA 4G0OA 4I14A 4EY8A 2O7NA 1DGQA 3RVRA 2F55A 3QKSA 3HH8A 1Y9JA 3HXTA 1OWMA 4Z9FA 1USGA 4ZA2A 3MELA 4TS4A 5CDGA 4WXYB 1I7NA 1FUUA 1P8JA 4ZEWA 4KFTA 2A14A 3MJEA 5EJIA 1R3DA 3FDXA 5JDCC 4WNAA 5JAHA 1AU9A 2XOEA 3AGQA 4UQLA 4RGVA 3QRWA 1JQLB 3VU1A 3OD1A 4BLQA 4V02A 2FGKA 1FTNA 2Q7OE 4LDZA 1KY5A 1CIVA 2O3JA 4FFNA 2REXB 4YJKA 3S2ZA 2AZ4A 4ENPA 4DDMA 1E3DA 4KZPA 4CT5A 1JSRA 4DPLA 1IXYA 1PWEA 3L84A 2FSFA 1G1MA 3GN2A 4DJAA 3OBBA 3HUFA 1NL3A 1AV7A 2PYZA 4MZXA 2Z6QA 4C1NA 2Q5JA 1A96A 1NIPA 4K05A 4MLZA 5BMVF 4M8NE 3OOWA 2YOFA 3I6QA 1AD2A 4XFJA 1C1XB 1TX4B 4F12A 3PGMA 4WXHA 2FR1A 1OI3A 5KBYA 4OAPA 1R4ZA 4UM9B 5DIZA 3EJ6A 4Y6RA 4WT7A 4ILKA 5LYJB 3TK1A 3QFCA 1GZHB 5IT4A 3NB0A 2LV8A 1P1KA 5CBPA 1IZ0A 4NC9A 1GDDA 4U7HA 4WVFA 4L22A 1D6NA 1YUNA 2GF2A 5F9HA 2NAFA 3OJOA 5L8VA 3EXHC 3QFRA 4ENWA 1XQYA 2ZRNA 3KT0A 3TL6A 4R41A 4FW8A 4I46A 2O50A 2IY8A 4E21A 5JI2E 2Y93A 2CW5A 2IQ5A 4TKVA 1KHHA 4M0KA 2AG8A 4HI0E 2XMBA 2V7WA 4X1OA 4YCMA 2YW9A 1VFNA 4NLLA 4AJ2A 4BNWA 1W47A 1AGXA 5BR1A 1J99A 3FMVA 3A6GA 3AUUA 3ZLUA 1CBUA 1KDTA 2VT7A 2XH8A 1RIFA 3HHEA 1NMEA 4AJ4A 2PKYX 1V8DA 1KFJB 2E5FA 5JROA 1NXVA 2O48X 1SXJA 4RC9A 1IWBB 1LS1A 2QJWA 4GLLA 4AX4A 5IFKA 5M34A 1Q7GA 1RRVA 4PAMA 1LF5A 5KNBA 4N6NA 5KU7A 3RM3A 3PZBA 3SOPA 1UM8A 3WB9A 3VX3A 2QXTA 5EJ7A 3NYWA 4FGUA 3W8FA 3AF6A 1B14A 3W78A 2AZMA 3L9WA 3MJ4A 3COSA 2O2CA 1MNAA 2P9GA 4G5YA 3HJRA 1KORA 3V2GA 4S35A 1WW2A 3JXEA 4IGFA 1CNMA 1NW8A 2GPBA 1UJCA 3AVQA 3UK2A 4RETA 4QD3A 4O4LA 1JWLA 2JNWA 2X0KA 5H7XA 3WIDA 4AZ0A 4EUKA 5L3VA 5CIYA 2W93A 4TXMA 4H2DA 3BQ9A 4CF4A 3HJCA 1KVSA 5ERGB 4W5QA 1RTTA 2HNBA 4Q82A 2IHVA 1SB8A 4A1FA 1RI3A 1Q95A 4V0OA 4X84A 1UWLA 2LP4Y 1XTQA 3G1WA 3PCRB 4HSGA 3WK6A 3IYLW 3QUBA 2XF2A 1D2EA 4L0MA 2O7QA 1NXOA 4YLGA 4ZALA 2NXNA 3DMNA 4MLCA 3RVNA 4EKDA 2H1LA 1U94A 4YLEA 3K6JA 3ECAA 1TZ2A 2NYVA 1FC0A 2X9LA 2ZI7A 4HZIA 4AS3A 5HRCA 4A2WA 5MN6A 3ZTWA 2VPIA 2ONCA 4QDUA 2KLHA 5B37A 1XLTC 3SY8A 2JGDA 3G7NA 4RNDB 1PLLA 1EB9A 3H9GA 3KU4A 4RF3A 5KQLA 1FMFA 1EXNA 3CRW1 3IFSA 3QWBA 2GJAA 1V2HE 2JLSA 3I3SR 1YJCA 4ZQCB 2IYZA 2P5TB 4E14A 1UZLA 2GBFA 3P4UA 1GLGA 1ETUA 3DPSA 4J7CA 4L5IA 4FHGA 5DM4A 4NMMA 1Y3FE 1M6HA 1NUHA 3W5CA 2F1RA 2AV6A 1ORTA 1SU8A 3DB1A 1VKJA 3VUEA 5CDHA 1BU5A 4BFUA 4HR7A 5J2UA 2ZUDA 2ECPA 5J58A 1VP3A 4JP5A 3OCYA 4CF3A 2W6OA 2VK8A 1OIXA 1EK2A 5LJLA 4TRNA 4TMWA 1GPYA