3RU9A

Specific recognition of n-acetylated substrates and domain flexibility in wbgu: a udp-galnac 4-epimerase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
341
structure length
336
Chain Sequence
YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific recognition of N-acetylated substrates and domain flexibility in WbgU: a UDP-GalNAc 4-epimerase
rcsb
source organism Plesiomonas shigelloides
molecule tags Isomerase
molecule keywords WbgU
total genus 129
structure length 336
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ru9A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3ru9A02
2GN6A 1SB8A 1DAPA 4DXHA 3BXXA 4E33A 1DB3A 1V9LA 3ANMA 3RCBA 4DA9A 3ADOA 1ZMTA 1QLHA 3DHYA 4K28A 4CM4A 4HFJA 4B4UA 1SZJG 4EYEA 3MJCA 4E32A 1G1AA 4R54A 5G0SA 1QSGA 4TVOA 5JLAA 2Y0EA 2UUOA 2X6TA 5C37A 1DC4A 4O6VA 5I7FA 3ZHBA 1EBUA 2R00A 3DBRB 3BTUA 1BMDA 4DWVA 1NQAO 1L7DA 3ONFA 3D4NA 2X0RA 1PQWA 3GOHA 4QO7A 3ZCXA 1LX6A 1YDWA 1PJBA 2NTJA 4K26A 4J43A 4J7UA 3LDHA 5F3RA 3I23A 3PYMA 1HTBA 4N5NA 2HRZA 1KERA 4DGSA 3K8ZA 1PIWA 2WE8A 4TWRA 3BIOA 3IQDB 4XQ9A 3A06A 4ALJA 1NR1A 1FMCA 4IBOA 2E4AA 1UP4A 3IC5A 2J5KA 4FC7A 3QWHA 2I9PA 3T4EA 2FPIA 4HFMA 1DJNA 1I01A 2ZTMA 4BKOA 1SB9A 5KKCA 4J91A 4BO9A 5JMPA 4IJVA 1B26A 2GF2A 3D5TA 3FR8A 4WPGA 4XYEA 3OM9A 4R1UA 3WLFA 4EUHA 5IDXA 3ZV6A 5ILOA 3ZWVA 1QR6A 2BFMA 5KIAA 1OZAA 2Q50A 4MP3A 4W99A 2EERA 2EGHA 4H7PA 1Z82A 3D7LA 4NDNE 4R16A 2I99A 3HWRA 4NBVA 4PZCA 4IZHA 4WCDA 3ONDA 5JMWA 4JJFA 3CZMA 2XXJA 2GD1O 4DIFA 4IJWA 3D5QA 3F1KA 4P8RA 3ON5A 2IE0A 2BGKA 1SNYA 4RQTA 4EBFA 4NBTA 3DMYA 5L53A 1K3TA 4F3YA 5B4TA 3OJFA 2VWQA 1P1KA 1PR3A 1XA0A 3I6QA 4JROA 5A1TA 1UH5A 4CMCA 2VYVD 4E13A 1I30A 4OOFA 4YTEA 1M6WA 3RC1A 4BNFA 4CODB 3LT2A 4YJFA 4UVDA 4PN3A 4RORA 1LU9A 3QIVA 1E77A 3I83A 4WNIA 4A2CA 1VI2A 5ER6A 2VRCA 1FK8A 2ZJ1A 3GGPA 3KYDA 1C3VA 1HDRA 3NJ8A 2ZB3A 5T64A 5L7WA 1FDSA 5G4KB 1EVJA 1BXKA 1P1IA 1PS8A 2AEFA 4K6CA 3JQ7A 4PG4A 4I5FA 4IJKA 1Y81A 3O26A 1YS4A 4U0KA 5BNIA 4OO3A 4Q39A 4LGVA 1YVEI 1U28A 2GZ3A 3DHNA 4FFRA 1XCBA 1MFPA 4R9SA 5COQA 4NFHA 5IF3A 5C7IO 2VHYA 3EYWA 2JHFA 3HN7A 4I08A 2G76A 3OEYA 3PLRA 4RPHA 4GMGA 2PZKA 2IXBA 3AM5A 4N18A 3QA9A 3ITDA 1PGOA 3EC7A 2BFAA 1E6UA 1X7DA 2AG5A 4R3WA 5ITVA 2P4QA 5G0UA 1T4DA 4IY1A 4KDFA 2PGJA 2EG9A 4TKLA 4J4BA 3NDRA 3N74A 4EDFA 2XAAA 5G0TA 4HXYA 2Q3EA 3JQEA 3NTQA 3I5MA 2C20A 1U4SA 1YDEA 2BI8A 4G2NA 1GTMA 1P77A 5C7LO 4W82A 2O23A 4CUZA 4B4OA 2DUWA 3TFOA 4Y6PA 2NVUB 4CPDA 3PQFA 2RCYA 4BIIA 1K5HA 3INGA 3TZKA 3UH1A 4IXWA 3VZQA 3KB6A 5B37A 1O94A 4AJIA 1VL0A 4XB2A 1CQJA 5CAEA 1SEPA 1VSVA 3DZHA 3RFVA 2P5UA 4RZHA 4DQVA 1GCOA 2O4UX 2VUTA 4EW6A 3PWKA 2X7HA 1WNTA 3QQPA 4RVUA 3H5AA 4Z0TA 2NLOA 4BMSA 5DP1A 5JDIC 3KEOA 4KTVE 4N54A 1NTOA 3F46A 2IDZA 2EJWA 5I7SA 2C5AA 1IB6A 2A94A 5ADHA 3PIDA 3L0DA 4YAGA 1NFRA 3PQDA 1Y6JA 3CXRA 2O3QA 2J6IA 4PLGA 1LQTA 2EW2A 2R2GA 4PFJA 3ZU4A 1NFQA 2W8ZA 1YWGO 2WE7A 1JW9B 1E1MA 1QYWA 4PG7A 2GSDA 3DOCA 3RAJA 4MVJA 4M1QA 5T8KA 4DVJA 1A7AA 1J49A 3JV7A 3WOHA 3WYCA 4YT4A 1K6JA 2Z1MA 3FNFA 1DC3A 2DU8A 1T2FA 3R0IA 3V5NA 4DPKA 1OBFO 3RSHA 1I2CA 1VJ1A 3GT0A 1B2LA 4FGWA 4GVLA 2PZJA 3SC6A 5KVSA 4Y67A 1KOLA 5L4NA 4YVFA 5JSFA 3K92A 4PG8A 2X4GA 1GEEA 1RPNA 4WLNA 2C2YA 3BMNA 4IDCA 3BMOB 2PD6A 3AI3A 3FTNA 3KZVA 4ZJUA 1UJMA 5L3ZA 4QO8A 1NASA 1F8GA 4CV2A 4ESOA 4XJTA 1XQ6A 2JFHA 3PIIA 5L40A 2VHWA 1M75A 3KV3O 5F5LA 1DO8A 4CV3A 5HM8A 3KLPX 4DQXA 5G2OA 4ALNA 2CDBA 1JN0A 3GVIA 3PPIA 1XU9A 4PLZA 4HUJA 2DVMA 5JYEA 1ZSVA 1ZZEA 4BO8A 1A72A 2FMUA 4K6FA 1GUYA 1GD1O 1A7KA 1GUZA 1QV6A 4RCVA 3HJAA 3P2YA 5BT9A 2NV6A 4J0EA 5T8KC 1P44A 5A5FA 3TFQA 4J9VA 2NQTA 4J1SA 3QVTA 3GFGA 3HUDA 1J0XO 4J7CA 9LDBA 3PP8A 2H63A 1HETA 1C1DA 1PQUA 3P5SA 1PQPA 1B8PA 2I66A 4B7XA 4Q3CA 4WLUA 1CERA 2X5KO 5A03A 3KYCA 4YAJA 4J16A 5JFOA 3DZJA 2DFVA 4IDAA 4ND1A 3WGZA 3WTCA 3NUGA 4ZGWA 3C1TA 4Z3DA 3GG2A 3VH2A 3EDMA 2YQ4A 1E7MA 3JTMA 1QLJA 4GGOA 1O5IA 3IJPA 3IOYA 3DBLB 1JWAB 3PK0A 4ZQFA 4GLLA 1DIGA 2D0IA 2GN4A 3KYCB 1UZLA 2CFCA 3Q2IA 4B4WA 5F5NA 2G17A 3VPGA 4MIOA 3TSCA 5DNAA 5A4DA 1IZ9A 3V1UA 1WZEA 1UUFA 3OJEA 3ETDA 3ST7A 2GLXA 5JW6A 1NNUA 3KRTA 3KVOA 2O3UA 4RO0A 4JIGA 1HRDA 2Y67A 4L73A 1UDAA 1N8KA 4LCEA 2RHCA 2VHVA 1LDEA 1HXHA 3ZNPA 2CUKA 3B1KA 1U9JA 5EMHA 3UUWA 2VHXA 2NM0A 2FSSA 3E03A 4R41A 1DPGA 2Y0DA 4PIVA 1SO8A 3B6ZA 1O89A 2IRWA 1DIAA 1A9ZA 1I8TA 2AQ8A 1BXGA 1BXZA 2E37A 4P38A 4A7PA 3DMTA 1D3AA 1NQOA 1GPJA 1BVUA 4FDAA 4EEZA 2HK7A 1YQGA 5ILGA 3RROA 3KSUA 3U4DA 1IOLA 3H2SA 4CM1A 5CG1A 1CF2O 4DC1A 3NDIA 3R1IA 5BNTA 1E92A 2QRKA 1JVSA 4XIJA 2FPGA 5EN4A 5DZSA 1ZKMA 1TVEA 1V3TA 1OI7A 4ZHSA 3LC1O 3W8EA 1YQXA 2Q4EA 2GYYA 1ADCA 2X0IA 2X5JO 3RVDA 1ADGA 3BMNB 3ZNOA 4ND2A 3WMWA 5HBRA 1AE1A 1DJQA 4L75A 3F4LA 2FSVA 3H8VA 3L4SO 1W4ZA 3V1TC 5CDGA 1UZMA 1FDTA 1B16A 5TJ9A 3OJOA 4XA8A 5HRUA 4OYRA 3GVXA 4CR7A 1DOHA 1Q7BA 4MIYA 3RUCA 2C7VA 5CDYA 1T25A 5AXCA 1JTVA 1ZBQA 4GX1A 4KUEA 4UUNA 4U7WA 1E5QA 1EZ4A 3WBFA 3EVNA 5CDTA 1D7OA 2Y68A 4ILKA 4PLTA 5KCZA 1Z73A 3MZ0A 1FJHA 2EJVA 2WD7B 4NZ9A 4NG5A 2VRCD 5CHEA 3TL2A 3G3EA 3TOXA 4BO5A 2WMDA 4TVBA 3Q2KA 4XGNA 5THQA 3DAPA 2OFPA 1XHLA 3AOEC 2F00A 4MINA 5TQVA 4CQMA 1ZK2A 3G79A 4NBUA 1G6KA 2GO1A 4MDHA 4IQ0A 4XR9A 4BO2A 5HS4A 4BNGA 4PCVA 4AJOA 2O3RA 3HDYA 1ONOA 4CUKA 3VPFA 3ZNNA 4CQLB 2JL1A 2ZTLA 2V65A 1TT5A 4ITUA 1E7YA 1PWXA 1ZK4A 1DHRA 3PYXA 5GZ3A 4BUCA 3M2TA 4Q3AA 1HZJA 2DM6A 2YV2A 4NU6A 4RPKA 4JCOA 1D1SA 4EEXA 8ADHA 3WGHA 1NVMB 5IAAA 3DZIA 3JQ6A 4R4JA 4RLSA 4L76A 4R3NA 1AXGA 3GMDA 2CVQA 1HDCA 2Y05A 3RC2A 2B4RO 1WVGA 1ZUD1 1N2SA 4LSWA 4WLEA 1T1SA 2BF7A 2BFOA 4UVEA 3I9JA 5JAQA 4OSPA 4AJNA 3V2UA 3NT4A 4NJMA 5AQ1A 2PKQO 3N7UA 1EUZA 5KOIA 4RVHA 4GWKA 4KDEA 4GVXA 5A06A 2VNAA 1ADBA 4JP3A 1H2BA 5JNLA 3GZNB 3IUPA 3VZRA 4YEDA 3QVOA 3GQVA 3U5TA 3QVXA 5DOZA 1LC3A 3ASUA 5LC1A 4BNMA 5IDQA 4R69A 1E1NA 1ARZA 2JD1A 2O48X 7ADHA 1R37A 1B8UA 2NSDA 4CR6A 3GUCA 4YT2A 3Q1LA 2W90A 5H83A 1R6DA 3EHEA 4MP6A 4OL9A 3H5RA 1P1RA 3LZ6A 3CKYA 4D0RA 3WGTA 5CDUA 3HDJA 2CF6A 1XKQA 3ZU2A 3ZWCA 3UF0A 2JKVA 3SVTA 2DQ4A 4J1NA 1NX6A 2VHZA 3ZW9A 4B3JA 4KUHA 3ZWBA 3LVFO 2WD8A 3GVPA 3RUEA 5KVVA 4DREA 3FWZA 5B4UA 4CLOB 3S1LA 1ZK3A 4CLXA 1DC6A 4CMEC 3EGOA 4HKTA 3NKLA 4OKIA 1Q1NA 1XYGA 1O9BA 4MVJD 3DEYX 1F8FA 2VZ8A 3ENKA 1MC5A 1PU2A 1I24A 4R5HA 5G4KA 3ZU3A 1CDOA 4ALMA 4CM5A 3WWYA 1DIBA 3KYDB 5TJHA 3GA0A 2GERA 5FI3A 3DO5A 2Y1DA 1T2AA 1W73A 4CM3A 4AJHA 5IFLA 1I36A 3AUAA 4XIYA 4EJ6A 1DSSG 1E7QA 1GQQA 4O59O 3WGQA 1H9AA 4FQ8A 4AJPA 4Q9NA 4BNZA 3BHMA 4RF3A 2X9NA 3TL3A 1GFSA 4NBWA 4W6ZA 3TZHA 2D1YA 1ONNA 1ZK0A 4ONEA 4GLOA 5JS6A 3IMFA 3D1LA 1PL7A 1WMBA 2J5QA 3DQPA 4BV8A 1LBEA 5JYDA 1NVGA 4E4YA 4II2A 3GEDA 1HL3A 1C1XA 1YO6A 3PJDA 4GAEA 3LT0A 3CMMA 2EW8A 3K6JA 4BNUA 1ULSA 1HDOA 1F06A 5H81A 4AVYA 3BTOA 1GR0A 2PZLA 4LSMA 3Q9UA 2VOEA 4U0JA 3C3XA 4BKPA 4RJTA 3WJAA 3PJEA 2PNFA 1KIFA 3TRIA 2GN8A 3EY4A 3BMCB 3HSKA 1F14A 3H9EO 3OFSA 1YQDA 4RPLA 4YJGB 1SEVA 3PFFA 3NJ4A 1P3DA 4MVJG 3RWBA 3O8QA 2I65A 2VUUA 4KTTE 4MVJH 5L4LA 3ZHYA 1O95A 3DFUA 4GX0A 1YBVA 3Q3CA 1LSSA 1MB4A 5FYDA 4E2ZA 5U1PA 3IAHA 3ZV3A 2A4KA 4B8WA 2VRBA 3QWAA 5IN4A 4FGSA 2DTDA 3ZWMA 1Y9AA 2FR1A 1HWYA 3WIEA 1QV7A 4NFYA 4CLOA 5AYVA 1DXYA 3LQFA 1IY8A 1LRKA 1R0SA 2QZZA 5I9NA 4LW8A 3WX0A 1DFIA 4ALIA 4BGUA 2PFGA 3LC7O 2J3KA 4Y9DA 3NTOA 1GQYA 5L7YA 3ZWYA 3OEWA 1EDZA 1GEGA 1IPEA 2WDZA 1IHYA 1UP7A 1S7CA 4ZA2A 1LDYA 4PVCA 2V6FA 1CIVA 3S2FA 4E2XA 2VYND 2W2LA 4UULA 5JAZA 2Q4BA 3Q11A 5L95A 3D4OA 3IP1A 4TRNA 5BSFA 3ZWOA 3MWEB 2D59A 3CPSA 4FBGA 3RASA 3VC7A 1NM5A 4BL5A 4MO2A 1C1DB 1U8FO 1YRLA 1I33A 1IHXA 1W8DA 1SCUA 2E48A 4E5MA 3O03A 3PJGA 3EUWA 4TROA 2YV1A 3SBOA 4RZIA 3TDKA 3D3EA 1LSJA 1VKNA 2E82A 1R12A 3AJRA 3O4RA 3K30A 4CM6A 6LDHA 2OBNA 1YBAA 4I5GA 5MGBA 4YAKA 2DT5A 3AOEA 1PGJA 3DAFA 4OXYA 1ULUA 5A3JA 3SEFA 1A27A 5TIIA 4E5PA 4ZRNA 4BNIA 1E1KA 4LMRA 3BYZA 1U5AA 2EF1A 3K96A 3JCZA 3VDRA 3GN2A 1B3BA 3ONEA 2BHLA 4Q3DA 4XQCA 3ZWXA 4CMJA 1DIRA 3CTMA 4J2OA 5A5EA 3JD1A 3JD2A 4I5EA 1GYQA 3QY9A 3E1KA 4UVHA 2NWQA 3RUDA 1KS9A 1R0LA 3TPCA 2HMWA 4BQRA 4GBJA 1VL6A 1EVYA 4FPXA 2GR9A 2XF8A 4YWJA 3DB2A 1JKFA 1KY4A 1ENYA 4XX0A 3W4KA 2P9CA 4R5MA 1PL8A 4PZEA 1DC5A 1K0UA 1AN9A 4Z0HO 5KVQA 1E7RA 2OHXA 3C24A 1HKUA 2FZEA 3ABIA 3I9KA 4IIVA 4J4TA 1HYGA 1NHWA 1NPYA 4CQMB 3PYLA 4DQUA 2AEMA 2CNBA 3FR7A 1Q0LA 3W8FA 3WBBA 1CJCA 4Q3BA 2AW5A 1ISGA 1U1IA 1QMGA 3GNTA 2NU7A 3FTPA 3A28A 3I52A 1NAIA 1EQUA 2A9FA 2Y99A 3JYQA 4KZPA 3PRJA 4WUVA 3RJ5A 3FPCA 4B7UA 2LDBA 1KVQA 4JX8A 1YL7A 2P91A 3RQSA 5JPIA 1J6UA 1IULA 1R0KA 3KTDA 4RLHA 1P0CA 3AY7A 5COAA 4CMAA 3VZSA 1Z74A 3G0OA 3PJFA 4RF4A 2VTEA 5F1PA 3RBZA 4GX2A 4MKZA 2W2KA 4FR5A 1Y8QB 3NRCA 3DAGA 3GH3A 2RIRA 2WSBA 4OMUA 4BNNA 5AXBA 2B5VA 1B15A 1QORA 2Q49A 1H93A 4BNJA 5JY6A 5TNXA 1E3SA 3JYLA 4DYVA 4GH5A 3ROPA 3AFMA 2X0JA 1GZ3A 2GCGA 3BA1A 1JAYA 1XQ1A 1RM4A 5EQDA 1FDWA 5A02A 4UEJA 4BB5A 3KXDA 5JCJA 5L9AA 1MC4A 1LDBA 1DRUA 3KEQA 3DOOA 4A26A 3MJSA 1A4IA 4HFNA 2QRJA 3JQGB 5I9MA 4C4OA 3ICCA 1MXFA 3TZCA 4CMBA 2NU6A 4WASA 5B12A 1XWFA 4O1MA 3PDUA 4RVDA 3GFBA 1MV8A 4ZQEA 4QXMA 1B0AA 5ER9A 3AOGA 3W4JA 3INTA 4MVJE 4HBGA 3MJTA 3C7AA 1ISJA 3GN1A 4YB8A 5JDCC 3JQCA 1T26A 3RKRA 1V35A 2O4CA 5A9TA 1LXCA 3UXYA 2POQX 1OOEA 1EBFA 1H9BA 2P4HX 4EZBA 1GCUA 2JD0A 2DUUA 2JJYA 1NXQA 3GNQA 1EK5A 1XIVA 1ZMOA 4WE3A 3F47A 3U62A 4L74A 3TF5A 4RV9A 2OP1A 4GSKA 4A03A 2FN7A 3QJ5A 1U3WA 3LF2A 1N7HA 2BH9A 3OICA 1I2BA 3L77A 1GADO 4JN6B 4J6FA 1I3NA 4ND5A 3RUAA 4OM8A 5C5IA 4BV9A 5L45A 1E3WB 4MKXA 5IXYA 1HYEA 4WCFC 3VH3A 2QYTA 3EAGA 5TS3A 4QUKA 5U9CA 3G1UA 1L7EA 1SMKA 1H6BA 5JXWA 1X13A 2AQHA 2TMDA 3STHA 2Q2VA 3VDQA 2JD2A 2PWZA 4LN1A 4CLDA 4RGBA 2BGMA 4JP2A 1R66A 1HZZA 3IKVA 2WM3A 4YJHB 1X7HA 2PGDA 4TZTA 3ZWPA 2P2SA 4ROSA 3A14A 3PEFA 2O7SA 4RF2A 1WPQA 1V6AA 3E5RA 3WJ7A 5TX7A 5CDSA 4MVJM 4G5HA 4RVSA 1LSOA 1YL6A 3B1JA 1NFFA 2YJZA 3HDHA 4IIUA 4AJKA 4OGWA 4EJMA 1KVRA 3PHJA 2H6EA 2RAFA 1Y8RB 1V0JA 4CMGA 2Y1GA 4E0BA 2Y93A 3RBVA 4NNJA 1E6EA 4CM7A 4XJSA 1LLCA 2AE1A 1U4OA 1I3LA 1X15A 4GKBA 1WP4A 1PS9A 2Q1SA 5JDCA 3MTGA 4GQAA 4RDHA 3RC9A 4TSKA 3VH1A 3OJLA 3CUKA 2Z95A 4NHEA 2EWMA 1JLLA 1WW8A 4BNVA 2FP4A 3C7CB 1X1EA 3NEPX 3PWSA 1KY5A 3ENNA 4WK6A 1XEAA 4D43A 2YV3A 1HLDA 4XRGA 1UZNA 3GGGA 3EMKA 4F6CA 3GRKA 1UXGA 1ENPA 1YGYA 3QP9A 2UV8A 3IKTA 4BNXA 3KM0A 4I8XA 1GQ2A 1GYRA 5DF1A 3DTTA 3F6YA 4GX5A 1UXIA 4JBHA 4OSOA 3VHRA 4I9UA 2CF5A 4KWIA 3LSYA 4C7JA 5MDHA 2A35A 4FN4A 2EKPA 1PJSA 2J3IA 4GPD1 3DONA 1DRVA 3GHYA 2G82A 4DYDA 3HHPA 3D3WA 3E9QA 3ZN2A 2FR0A 5TF4A 3T4XA 2PKQP 2BD0A 1D4FA 1ID1A 3BZUA 2PGLA 3PWZA 3NGLA 2JFFA 5L7TA 1QG6A 4JLWA 3OQ1A 4CM9D 2HCTA 2IODA 1ISHA 3HZZA 4LVCA 3VPXA 2IZZA 3CINA 1WMAA 4NU5A 4XWYA 1MG0A 3OQBA 2EIHA 4FFPA 4XYBA 2DC1A 2YDXA 7MDHA 1HT0A 2HU2A 4DMLA 4M55A 4PG5A 2DTXA 3H3JA 2ZIZA 3L4BC 4J0FA 4XGIA 2NADA 4II3A 2B5WA 1BGVA 4K1LA 4EGFA 1TEHA 4QQRA 4DL9A 1GZ4A 1XELA 1LRJA 3QV1A 4WEQA 1U3TA 2AHRA 5DBIA 2D5CA 3WS7A 3GMSA 3WTBA 2GUGA 1HSZA 2RH8A 1E5LA 3JYPA 4W7IA 3CMCO 2NVBA 1DFHA 1T4BA 2PK3A 3WG9A 4R68A 4HY3A 4GI2A 1PL6A 2BMAA 3L9XA 3OIDA 4FJ1A 2QZ9A 3P7MA 3QWBA 1HE3A 1H6CA 4YQYA 1PJTA 4KQXA 1OAAA 3IUSA 5J23A 4ZVVA 1ZCJA 4OHUA 1PZFA 4LRTB 4L0QA 3PHIA 4XGKA 1WWKA 5A9RA 2JHGA 3PGXA 3UN1A 3RUFA 3AFNA 4J9UE 4BNLA 2BLLA 2H1SA 2PKRA 4BB6A 1N7GA 1G0OA 4AJ2A 2HUNA 3HADA 3ETEA 1KVUA 3DTYA 3QVSA 4FFMA 4PVDA 4IDGA 1LLDA 3ZU5A 2YY7A 3OJ0A 1E3EA 1DLIA 1X0XA 1PZEA 3IS3A 5G0VA 4I1IA 4M89A 5F21A 1NPDA 5EPOA 4CLEA 4TRJA 3WGOA 4FB5A 5K0ZA 3U0BA 1PR9A 5K9ZA 1DLJA 2C29D 2OORA 1QYXA 4IPTA 4BO0A 5FEUA 3JQBC 3UVEA 4I9NA 4ND4A 4AL4A 1VPDA 2ZJ0A 2OBYA 1BSVA 3JQAD 1ZJYA 4YJFB 3QLJA 4KWHA 4UEOA 3W1VA 1SC6A 4RVGA 4HNGA 1A4UA 1RM5A 5KTKA 1YONA 1XGKA 3F3SA 3FCOA 3RFXA 1NP3A 4NH4A 3QSGA 3TNLA 3GAFA 4YBZA 4BNTA 1JAXA 4XZ3A 2XPCA 5A9SA 1BHSA 3MCVA 4BKQA 1A71A 4YRBA 4WCFB 3QW2A 3I6IA 4XD2A 4PLFA 4S3MA 3RC7A 4JBGA 4M87A 5DCYA 4ZRMA 1OFGA 1V3UA 2VTDA 3I9LA 3MJ4A 5GZ6A 5K6AC 1MP0A 2DAPA 2AA3A 5JBIA 4A10A 1C14A 1FF9A 1N92A 1EE2A 1ML3A 1F0YA 2IZ0A 1B7GO 4L9RA 5A04A 1UDBA 1EFKA 3OIGA 1H0KA 1C1XB 3WICA 4E12A 4CV1A 3ROQA 1U3VA 3PVZA 1YH3A 3ANLA 4DLAA 2O3JA 2NTVA 4PGFA 2Y1CA 4F46A 3V8BA 4B79A 3O9ZA 2CSUA 3S8MA 1ISMA 1HSOA 3GPDG 3VVBA 1YB1A 1FDUA 3MEQA 3DDNA 2PH3A 4D7AA 4Y6RA 4NR0A 1N5DA 4IDBA 3W8DA 1YBMA 1ISFA 4P4LA 2HK9A 3NT5A 2QIOA 1Y1PA 3U4IA 1P1FA 3NGXA 4OXNA 3S55A 1J5PA 3CSDA 3WSVA 1JKIA 3IDSA 3PGJA 4Y6SA 3WIDA 5IZ4A 1B3RA 3I9NA 1DIHA 2FPPA 4O5OA 4ZQHA 5IN5A 4BNHA 3GNSA 4Q3NA 1E3WA 3C85A 5AOVA 3BHJA 3KETA 5B4VA 1HE5A 5JAIA 3QWFA 4B7CA 1NAHA 3UFXA 1T1RA 2R00C 2FOIA 3SX2A 2BRUA 4YAEA 4E5NA 1PJ3A 3HDQA 1YXMA 2ZYDA 4DUPA 4HADA 5IXSA 3U4HA 4FC6A 4F6LA 5HTOA 2OZPA 1PZHA 3HB4X 3T7EA 1I32A 8LDHA 1C0PA 3VOSA 1RWBA 4WOJA 3ZWAA 4YCAA 2VYNA 2W2LD 3BHIA 2DBVO 3TOZA 1N1GA 2Y1FA 2O3SA 3KSZO 5CFZA 3TQHA 3WQSB 1BDMA 5FI5A 2UYYA 5EESA 5IDYA 4DRYA 1Q7CA 4GWGA 2G1UA 3WDSA 1I10A 2EKLA 1Y7TA 2GGSA 1MUUA 3ROKA 1EEHA 2NQ8A 4LVUA 4B8ZA 4B3HA 3EVTA 4E21A 4D41A 1IZ0A 2NACA 1YL5A 4NJMB 3ZWNA 1NQTA 4JNKA 4D42A 4ZN6A 1RYDA 5TT1A 1V8BA 3S2IA 2LDXA 4EI2A 1WXDA 3I4CA 4A0SA 2NU8A 3H9UA 1EDOA 2QX7A 4XYGA 4NFSA 1GAEO 1I3KA 4L4SA 4D79A 1SPXA 2C5EA 3WWZA 4TRRA 1Z7EA 1GPDG 2IXAA 2OP0A 3GF4A 1C0KA 1HE4A 5ITWA 3OH8A 3OHSX 5G4LA 1HDZA 1WAMA 4BKRA 6ADHA 2ZTVA 2YDYA 5JO9A 3AU8A 1OMOA 2FZWA 4U8GA 2EXXA 3GVHA 5DP2A 5I9LA 4HV4A 1TT5B 1GUFA 4D45A 2JFGA 5JE8A 4YDRA 3D3WB 2ZQZA 3MWDB 4CR8A 4AJ4A 3RD5A 4RPJA 2GPTA 2VZ9A 4PLPA 4EUFA 3H4VA 4XRRA 1O8CA 5ENDA 3OF2A 5K6AA 2Q2QA 1E3LA 1ZNQO 4L4XA 5ENVA 4X54A 4ID9A 5T6BA 4UUPA 1UP6A 4CV0A 4E5YA 2OL4A 2YFHA 3PHHA 5HA5A 1YE3A 5JCXA 3S2EA 3PHGA 4IINA 2HLPA 3M2PA 4WGGA 3H6KA 4MVJF 3K73O 3JYOA 3BAZA 1EVZA 4AJJA 2YHIA 1M76A 3EZLA 5JY1A 1A5ZA 3OMLA 4RDIA 5EQFA 3RU7A 3MOIA 3RUIA 3IJRA 4HWKA 3WLEA 1H5QA 3OA2A 1PZGA 4MVJP 5LCXA 1U2DA 4IQGA 4YXFA 1GL3A 1ZJZA 2AEJA 5L51A 4U6SA 3GDGA 2RBEA 2GASA 4R1NA 4QSMA 3DL2A 2ZCUA 1E0DA 1UAGA 3OBBA 3EZYA 4R1TA 5CP8A 5IZCC 2X22A 3PLNA 4PLVA 1EVIA 5GMOA 3VPSA 3E48A 4BNKA 3QHAA 4CL3A 1A9YA 2DPHA 5COBA 1Y5RA 1HDGO 3DHEA 4MOWA 2AMFA 5DCWA 1QYDA 4W4TA 4PZDA 4FCCA 3FWNA 4B3IA 3B20A 3WR5A 1I2ZA 2A92A 4E2WA 3I9MA 1QKIA 1PSDA 4CLRA 5CEJA 4FJ0A 1ZEMA 4J4HA 2X9VA 2Y1EA 5CPBA 2OO5A 1M66A 2PA3A 4J49A 4DMMA 1PJCA 4WEOA 2I76A 3U3XA 4EJ0A 5DN9A 4DPLA 4OJNA 4CJXA 4IDFA 2I6TA 2O2YA 1KC1A 2AQKA 2DTEA 2ZB4A 2WYUA 3E9MA 3GAZA 2OXIA 3WB9A 4E6PA 4ZU3A 3UW3A 3ZI0A 1VSUA 4LMPA 2O3TA 4HX5A 5KKAA 1VJ0A 1AHIA 4KOAA 2VWPA 4DLLA 3HN2A 1TXGA 3DWFA 3RU9A 3DBLA 3C1AA 4IS3A 3L4BA 1HE2A 3U4CA 2WTBA 4MPDA 4J90A 3DBVO 3DBHB 2AG8A 4CUJA 2I67A 1NHGA 3JQBA 3DZKA 3I4FA 3UHAA 3ZH2A 4NIMA 4AJEA 2E49A 3FSRA 3ULKA 5BR7A 1AUPA 4QEDA 3AUSA 1PGQA 4DC0A 3GPIA 5EJ2A 3AW9A 1GY8A 1CRWG 1ZK1A 1OC2A 2IYPA 1FDVA 1BWSA 3JQ8A 3GEGA 4BO7A 3GUYA 2WYVA 2XOXA 3GVCA 1Y9EA 3BTSA 1MGOA 3FI9A 1UXKA 1Z75A 3ASVA 5T57A 3RKUA 5FFFA 4NMHA 2GDZA 1X0VA 2W4QA 4IM7A 4XQEA 1KVSA 2CDCA 2JAPA 5AVOA 4UUMA 1QYVA 2Q99A 1SBYA 4H3VA 3E5MA 4CLHA 3O8QB 3WSWA 2GZ1A 4J1TA 4NBRA 1LEHA 1LNQA 2QW8A 2B35A 1K2WA 3NT2A 5KWEA 1ZXBA 1M6HA 2IZ1A 3QVWA 2D4AA 1H6AA 3BMCA 3GRPA 1VLLA 3FF4A 1P74A 1ZFNA 5C7OO 3P2OA 1NR7A 1TA4A 5F1OA 2PLAA 3P19A 4S1VA 1X1TA 4BS9A 4GL4A 4L4RA 1ZH8A 3RBXA 1LA2A 1Q0HA 3VKVA 1T24A 4HFRA 4DIOA 3UKOA 3BMOA 4Q3EA 1C0LA 1PTJA 4EUEA 5TSDA 4E31A 2DBRA 1FXSA 4BO1A 1NQ5A 5GY7A 4CMHA 1P1HA 4XR4A 3CEAA 2H9IA 4TKMA 1H2HA 4WCFA 4CMIB 1W0CA 1LUAA 1K89A 4PLYA 2YQ5A 1RKXA 3AWDA 3ZDFA 4XYMA 4AFNA 5KJCA 5LDGA 2X23A 3JQFA 4A27A 3ANNA 4WNCA 3KSDO 1GDHA 3D64A 4BQPA 2AXQA 4IMRA 2HMTA 1Q2XA 2NUAA 1EUDA 1C0IA 4W9NA 3WGGA 2FWMX 3AUTA 5JAMA 2Z5LA 3H9GA 2UDPA 2VZ0A 2H5LA 4K9DA 1EK6A 2JCYA 1TI7A 2P9GA 1R4MA 2D8AA 5KJEA 2IEBA 1JWBB 5T5QA 4YACA 2B36A 3UCXA 3E8XA 2VNSA 2X58A 1O6ZA 2V6BA 3W4IA 2DKNA 2BKAA 4TZKA 1LJ8A 5EIOA 4PLWA 3H7AA 1KETA 3PHLA 4YRAA 4JJGA 5IJZA 4GSLA 3WQRA 3I3OA 3UCEA 3VTZA 1LI4A 4UREA 3DFZA 3GG9A 5DOVA 3ITKA 2DFDA 2O7QA 3UCFA 4CM8B 1PEDA 5C3MA 2VWHA 3QE3A 4M54A 4RL6A 1PGPA 2JAHA 2NNLD 3IP3A 3FBTA 3JQFC 4D46A 1NBOA 3E18A 2GZ2A 3ICPA 4MP8A 3TZQA 5I7VA 3K31A 1HLPA 2HAEA 1BVRA 1JVBA 2X86A 3B1FA 4TMFA 3KYBA 1YJ8A 5AXAA 3GR6A 3I9OA 1RM3A 4IGFA 5BSEA 3E82A 3K2BA 2FY8A 1QRRA 2Y0CA 3L6DA 5BNFA 4J7XA 1E1LA 3TN7A 1LQUA 3FPLA 3QRWA 2EP5A 1TLTA 3JSAA 4OAQA 5KNLA 2Y66A 2OGUA 3EW7A 3R6DA 4CL8A 2J3JA 5TT0A 1BDBA 1K6XA 3C7DB 3ETGA 1XU7A 4FOSA 1VJTA 4Z9YA 1LLUA 1P31A 1SOWA 3GGOA 4JK3A 2CZCA 1ISIA 1VL8A 2YHUA 4MIEA 3WFIA 4Z3KA 1PWZA 5KJ6A 2P5YA 4DLBA 3QWIA 2YW9A 3ZW8A 5A3VA 4YRDA 1QXSA 5ICMA 3HE3A 3HG7A 4CM8A 1IE3A 1SAYA 4URFA 3GEMA 3L6OO 4MKRA 1D8AA 3AM3A 5DCUA 3IIEA 3ZHXA 4CQLA 3GK3A 4FSHA 4IMPA 5T67A 3VTFA 4YPOA 1KEWA 1EFLA 3FHLA 1EUCA 3H9QA 4FW8A 1UXJA 2C59A 3JQ7B 4I9HA 3A4VA 4OQYA 4R51A 3O38A 3K5PA 3OIFA 4YAIA 4FD3A 1R4MB 3NYWA 1ZW1A 2I3GA 3OA0A 4R9RA 1ORRA 4IUYA 3PFWO 3UICA 5BQFA 5G0WA 3BTVA 2Q45A 4F45A 2EV9A 1PJQA 2VUSA 2BFPA 1Q7GA 1WDLA 4FFNA 5B1YA 2O50A 1UR5A 4JGBA 4PRKA 3D0OA 4FS3A 3H5NA 2HDHA 5DDIP 3KOUA 1HYHA 2QRLA 3AUUA 2HMUA 2ZQYA 1VE9A 3M1AA 2ZK7A 1XDWA 1XLTA 1PX0A 3A9WA 4CMEA 4XDYA 3SLKA 3SXPA 3UAGA 4BMVA 4N5MA 3OETA 4JXKA 2ZKLA 2HMVA 4GMFA 1Y8RA 3ADPA 4ND3A 4E2YA 1ONPA 3UOGA 3ZWWA 4H16A 2VCYA 3DZFA 1MA0A 4NQZA 2B4TO 2WYWA 5JO0A 1H6DA 5ES3A 3LC2O 1BG6A 4RPGA 3G49A 2YUTA 2EGGA 1H94A 4YJHA 4IJUA 1NYTA 4D3FA 4YT5A 4BOYA 2VQ3A 5DT9A 4BGVA 1BXGB 3ZHZA 2HJRA 1MXHA 2VYVA 3AK4A 5I8WA 1P33A 2HSDA 1DHTA 3MTJA 2G5CA 3Q0EA 2RH4A 2D2IA 4KQWA 4BNYA 4NK4A 3CIFA 2F1KA 3LF1A 1QP8A 1J4AA 3HQ4O 3U49A 4WJZA 2VN8A 1UAYA 3E6AA 4PG6A 4NK5A 3WYEA 4CQMD 4D3SA 3SJUA 2ILTA 5IG2A 2QQ5A 4J2HA 4XB1A 4IDDA 1LRLA 1VRWA 3B70A 2B69A 3OP4A 4UEKA 2VOJA 2YFQA 1F12A 1ENZA 9LDTA 5I7EA 5DBFA 1P45A 2X8LA 4OIMA 3PI7A 1LDGA 5IZCA 3F4BA 2B4QA 1AHHA 2SCUA 4XEHA 2X9GA 4E3ZA 2OOSA 4E30A 1R4NA 3F9IA 3PZBA 1WZIA 4L8VA 5KJFA 4QX6A 4FFOA 2B0JA 1L1FA 1D1TA 1X14A 3UGKA 3RJ9A 2UAGA 2O2SA 5EERA 3G17A 2HO5A 1DAOA 4E5KA 2IEDA 2PD3A 1EQ2A 4O63O 4AJLA 2WWRA 1MX3A 3FNGA 4OKNA 3R3JA 4WLOA 3DZBA 5CPFA 4WLFA 1ENOA 3SJ7A 4A73A 4P4NA 4G65A 3WMXA 1ZSYA 4NI5A 2X0NA 1DBVO 3G1TA 2Q2WA 3C1OA 4GGPA 2ZB8A 3JD4A 4WKGA 4UVIA 5IDWA 4ZD6A 3KHUA 4XQGA 2UVDA 4I5DA 1JKJA 2Q1TA 3OSUA 3M6IA 4JJIA 1R16A 4W9NC 2C0CA 2QG4A 3L07A 4ZQGA 4YT8A 1KC3A 4UAGA 2X1HA 4BGEA 4KP7A 3DC2A 3AY3A 1CQIA 3AY6A 1E7SA 2J8ZA 4IZIA 1MG5A 3S2GA 1TT7A 1E3IA 3BMQA 5THKA 2R6JA 3FRJA 3RI3A 3F5QA 3FD8A 1T2CA 1BRMA 1IYZA 2GN9A 4NPCA 3ORFA 3LLVA 5H82A 3WNQA 3C8MA 2W2KB 1MLDA 1P9LA 1LC0A 3MOGA 4P22A 3PDJA 4BHTA 1DEHA 2QHXA 3FNHA 4OOEA 4YQZA 2WEKA 5ICSA 1JU9A 3RIHA 3VKUA 1DDOA 1LSUA 2NTNA 3AI2A 3VVCA 3FN4A 3JQAB 4BVAA 1M67A 1N9GA 2ZCVA 4IS2A 1I0ZA 3HNPA 3ZZNA 1RJWA 5U4QA 1NVTA 3V2GA 3VPHA 1Z45A 2DBQA 3H9JA 4INAA 3VH4A 3RFTA 3TJRA 1GV1A 4NJOA 1KVTA 2WD7A 4M8SA 4MJLA 2J5RA 1E3JA 4YR9A 3LU1A 3OQ6A 4DTIA 3AM4A 4IGEA 2V6MA 2HK8A 2BGLA 3H3FA 1P1JA 4P4GA 5KJ1A 1GU7A 4PLCA 4XKJA 4J1QA 1I3MA 3I1JA 2EKQA 1ZXLA 1EMDA 4CMIA 4N7RA 1KYQA 3WFJA 4Y8VA 4QECA 4C7KA 3CE6A 3PQEA 1YOVB 1ADFA 1PJ4A 2Q1WA 3JD0A 3K2EA 4AJ1A 2IYOA 3WGYA 2HRBA 2NVWA 4HNHA 4YA6A 4BGIA 5TLSA 2B83A 3KUXA 2DBZA 2CVZA 1HEUA 2DPGA 3L6EA 3TWOA 4TRMA 1EE9A 3AI1A 2VWGA 4RVFA 4AICA 4B4VA 2Q1UA 2W98A 4PRLA 1YKFA 5TC4A 2ZYGA 1HDXA 5GZ1A 2BI7A 1Q0QA 2OMEA 3FNEA 5HS6A 2Q46A 5L4SA 3W6ZA 1IUKA 3GDFA 1KEVA 1S6YA 3DOJA 2JCVA 3HFSA 4O0LA 1ZSNA 1N1EA 4DBVO 1VM6A 2I3AA 3GZ4A 1W6UA 4JQCA 1PJLA 4WLVA 3ZNQA 5EL0A 1RYEA 1BW9A 2ZYAA 3COSA 2HQ1A 2D5AA 4FIZA 4R01A 4DPMA 3V2HA 4WOKA 3GC6A 1QYCA 4QT0A 1NWHA 1NWCA 1DRWA 4BO3A 1VC2A 3LK7A 4MVJI 3E9NA 4KUGA 1LDMA 4W7HA 3WYBA 3JQDA 3SC4A 1YJQA 5AXDA 4U6QA 2J3HA 1CWUA 3LT1A 3JQ8B 4EITA 1G0NA 3EK2A 4J3FA 1T2EA 3ZGYA 1ZVMA 3INRA 1R15A 1LTHR 3Q9NA 2CVOA 1U7HA 3MJVA 4G81A 4OXKA 2VT3A 4Z9XA 3AU9A 4RQUA 1R4NB 1KEUA 2P9EA 5A05A 4HP8A 1O0SA 2PR2A 4KMSA 4UVGA 4RF5A 3R3SA 3H65A 2I5PO 5LDHA 3DBHA 3A1NA 4GKVA 1GYPA 2C54A 4Z0PA 5BSGA 2EHDA 1WDMA 3X2FA 4U5QA 3M1LA 3W6UA 1KBZA 2JCXA 1K6IA 1B8VA 3VZPA 3JQ9C 5JC8A 5TGDA 3CZRA 2HMSA 1P0FA 2ZB7A 3HB5X 3ZV4A 3LYLA 2TMGA 4QTZA 1XG5A 4BO6A 5FWNA 1IPFA 1PJ2A 2AQIA 1U7TA 2CMDA 2PH5A 1B14A 4FFLA 1PGNA 1U8XX 4BNWA 4YJDA 3GLQA 2CD9A 1UDCA 1RM0A 3L9WA 5F1KA 4FOOA 5EINA 1AXEA 3KLMX 5TRTA 2PD4A 4D3DA 3GY0A 1JA9A 3LLSA 3NAQA 4CLRB 2C2XA 1GV0A 2UUPA 1BW9B 1WLYA 1JQBA 2E6UX 2PZMA 3V1YA 4R1SA 3JQGA 2GRAA 1CYDA 4LCJA 4M49A 5CEEA 1HF3A 3PXXA 5I8ZA 1M2WA 3SLGA 1JDJA 4IXTA 1U3UA 4YJGA 1AGNA 3DR3A 3WQQA 3X2EA 3U09A 2QYSA 1Z6ZA 4PLHA 4XCVA 3K9QO 4CM9A 3JYNA 3JQ9A 4WECA 4JBIA 3CH6A 3IL2A 5BSHA 4ZQBA 3JD3A 2Z1NA 1CEQA 1UXHA 3WGIA 4DBZA 4BKUA 4D44A 4Z9FA 5CEFA 5KVCA 2ZATA 1F17A 4FJ2A 3WXBA 4DIBA 2YZ7A 2ET6A 5JDIA 2GNAA 3KO8A 3ZV5A 2C82A 2XXBA 1Y8QA 1Z7BA 2CY0A 2RHRA 3PZRA 1YOVA 3HFGA 4OH1A 1U2GA 1YB5A 2AE2A 2D3TA 4Z6KA 2PY6A 1I5RA 5A9SB 4ALLA 1IL0A 2WJPA 4BMNA 1VKOA 2NU9A 2FR8A 3Q6IA 2VT2A 4LK3A 3NDJA 1E6WA 2YHIB 4XDZA 1LLQA 4IQ8A 3N58A 5FF9A 2PV7A 3NX4A 4M86A 2PTGA 4YYZA 2EP7A 4LRSB 1NPTO 1X7GA 2BELA 2HKIA 4QFCA 3DMTC 3ROMA 1KEPA 4BO4A 5JC1A 3PTZA 1TB4A 2X5OA 1ZIDA 4UUOA 4ZICA 3WNVA 1N9GB 1YB4A 2B37A 1T2DA 3JQAA 3GDOA 4D0SA 3H2ZA 2V7PA 1GZ6A 1DFGA 1XSEA 4H15A 4A5OA 2OUIA 1WDKA 3DXFA 1PS0A 3TZ6A 1BTOA 1XR3A 4ALKA 3U9LA 3T7CA 4N5LA 4XYLA 1V3VA 5DULA 2C7GA 1Y5MA 2FRDA 3DBRA 2P68A 1SOVA 2CDAA 4Y98A 3BMQB 5DBGA 2YYYA 2DLDA 3OECA 4AG3A 5CG2A 1MFZA 3MJEA 4IDEA 2EEZA 3NTRA 4OQZA 4CM4B 5HWSA 1E7WA 3FBGA 3NV9A 3F1LA 2V6GA 3F5SA 5JCJD 3D4PA 1ZO8A 2ZTUA 1OC4A 1HDYA 2G0TA 1U5CA 2HJSA 3VAZA 2C07A 2NVUA 4LISA 1CETA 2FHSA 3GZNA 3LT4A 4CMKA 3DZGA 3RUHA 1ZEJA 2Y1OA 3GHHA 4QFDA 1LDNA 3KBOA 4TQGA
chains in the Genus database with same CATH superfamily
1SB8A 2XUZA 3CWZA 3IBTA 2VHTA 2EFCB 4UNIA 4X3PA 3R74A 2DUJA 4E33A 3HRHA 1JLHA 4TXLA 1PAUA 3HBAA 1SUAA 4US2R 1WXWA 4B4UA 1CUCA 1Y1LA 3A32A 4QPJC 4RIGA 3HDVA 5D8DA 1N8SA 4E3WA 4FM9A 4CKZA 3QE9Y 3JASA 1DIOB 1QSGA 4BQQA 2Y27A 1XYVA 4TVOA 4ENUA 4YYEA 1C7ZA 1BRTA 2RGBA 4CKCB 4XD7A 1DC4A 3EGXB 4B6QA 3WRXC 3ABQB 4HATA 4M22A 3ZHBA 1EBUA 2R00A 3BTUA 4Z53A 4KGZA 4EYSA 1Z25A 1L7DA 4J29A 2X0RA 3LIPA 4EMTA 2IW3A 1IN1A 1BIFA 1DEAA 5BN4B 2JBWA 1JX6A 2R25B 4FMDF 1PJBA 3QVLA 3WY9A 5KTYA 3IIKA 3QPVA 3NNNA 3DEKA 3EXAA 3OZGA 3NIDB 4J7UA 1A76A 1ESZA 2E18A 3UIEA 2GESA 3I23A 1FP1D 3PYMA 2BGUA 1HTBA 1GTVA 3NM4A 4AS3A 1ZMRA 1VDMA 2MTBA 2QTLA 2HRZA 1ZNWA 4DGSA 1O95D 4DN6A 3O4JA 1X7XB 3AF0A 3PGA1 3ABSB 4LZNA 3EY9A 4YRQA 1L4UA 4TWRA 3QKRB 3DCYA 4DWJA 5FNVF 1GKUB 4XQ9A 3L0YA 2DWCA 1QH8B 3A06A 3FB1A 1FMJA 3T3MB 4LHXA 1GNQA 3AMVA 1FMCA 2VBGA 3RU2A 3F7MA 1UP4A 1J24A 3IC5A 2QS9A 3VBEA 3FHOA 4C05A 4RYDA 4YUZA 5KYUA 2B7CA 2K7FA 1SHUX 4EG7A 1V4BA 4P3XA 5BYJA 3T4EA 3ZVLA 4Q02A 3V7UA 1SKMA 3CX8A 4V3CA 1Z68A 1V2HE 1S4MA 1POXA 2PLNA 3H9QA 3M6LA 1Z5NA 2WG2A 3RODA 3AF2A 4J91A 1MEJA 1UWVA 3B51X 1QHNA 3OTWA 4FGJA 5CVUA 1VXOA 2V7QA 4X6UA 1HPLA 4X1IA 3ZIAA 1SVWA 3OM9A 2BF4A 4R1UA 1CQWA 1O94C 4HOYA 5FQNA 2JLXA 3ZWVA 5KIAA 1IXRC 4TS4A 4UXHA 2Q50A 2VDLB 4Y6LA 3AV0B 2WIKA 1V8OA 1NRJB 3FKSA 3UHJA 2CBZA 3AEZA 4H7PA 3ZE9A 2I22A 6REQA 3D7LA 3PIRA 3TIIA 2I99A 1S8NA 4TXHA 1WHTB 4LQCA 4FDLA 1IOWA 4JT2A 5IMBA 4HNVA 1U2ZA 3RYHB 1WHTA 2HU5A 2WWIA 1SRQA 3ONDA 4ZEOA 5KTTA 1YJBA 3CUUA 3CZMA 4DDHA 2GN2A 2A30A 3OIWA 3OURA 1B1CA 3R3WA 3F1KA 4P8RA 1P8AA 1G5HA 3FCAA 1E2PA 1EJ6A 2IE0A 2V8BA 3Q5GA 4UDYX 4WNAB 2BGKA 1SNYA 3ENQA 3G23A 5AUQA 2G6TA 1QTIA 3DMYA 1K3TA 4L15A 5FL7A 4F3YA 3M4YA 2GFHA 4DG8A 3B1VA 3BQMB 4S1NA 4KQEA 5B7PA 2CXHA 1SHKA 1RAIA 3GEBA 4LJ6A 1SD2A 3DUWA 3IEIA 4ZHQF 3KQNA 5A1TA 4CMCA 4P3PA 1KJQA 1RACA 4ZVNA 5TXGA 4O8ZA 5JYBA 1ZN2A 2O05A 4BNFA 2NUTA 4MK4A 2ZG6A 2HBRA 2AC7A 1BDIA 1N2BA 1LU9A 2G6BA 4RORA 3UMCA 4EYGA 4X1OA 5F2KA 2RARA 4A2CA 4BVFA 4EL5A 4JC0A 3AIOA 4IR7A 3HJHA 1C3VA 1QH8A 3RIEA 1R00A 1YHNA 2EATA 2XKJE 2ZB3A 1UBSB 3IUJA 5L7WA 2FX2A 3KC2A 4OI0A 1BXKA 4AY2A 3TD9A 4GG1A 4C5CA 3H2GA 3RF6A 4YMLA 1G6HA 4QYIB 4K6CA 2GT1A 2ZRQA 2C1EA 1T8TA 3DOUA 7YASA 4IJKA 4M0UA 3S28A 3RADC 3DLAA 1SCBA 3FPBA 3PE6A 5BNIA 1BHQ1 1CS0A 1M34E 2H5JA 5DNVA 1GXSB 4LGVA 1NIPA 1U28A 1WIWA 1S1MA 5BN4A 1G2PA 1MFPA 3EIWA 5A5VA 4V1CB 1NNI1 1E8DA 3P5BA 1JEYA 3EYWA 1FSPA 4TN1A 4RPHA 5HNKA 3PLRA 2EIXA 4GMGA 3AM5A 3FCEA 4N18A 3DPSA 4G4JA 1JR3A 1GLGA 4LOAA 1T2VA 2XYHA 2VP2A 3EC7A 2QRGA 2WDPA 2PS3A 2FQXA 3RVNA 2R8RA 4X64B 5B1DA 2Q5OA 1FMLA 1Z38A 3Q3VA 4ER3A 1RAHA 5JRDS 1HEIA 1RYFA 4PAWA 2IH2A 1BH2A 3ZD8A 2P9JA 1FLNA 1Z08A 2PGJA 2R6GA 4GNKA 1HL7A 4F3KA 1LGYA 4J4BA 3DP7A 3N8KA 1ACJA 2RHHA 1DO0A 3NDRA 3KSBC 4JI1B 1KFJB 1X1DA 4EDFA 2OV4A 2GYUA 2Q3EA 3S7TA 3THXA 1S8OA 3LUGA 1U4SA 1INLA 1YDEA 1G7TA 1G18A 2YYZA 1GSHA 1GTMA 1W6RA 1HLFA 2QRVB 1F51E 4IH4A 1X8LA 2NXWA 3B1YA 4ZOCA 4CF6A 4CHGA 1GUBA 1DKUA 4CUZA 2JIRA 4F93B 1YTLA 2RE8A 4YMVA 3TFOA 4PSAA 4EPVA 2OZVA 4ZYTA 4CPDA 3PQFA 4MQMA 3AVPA 4AN1A 1KP9A 2WJGA 3INGA 4CTJA 4NL4H 1TM4E 3FFWA 4AUEA 2XKBA 3JPYA 2QM7A 1AK2A 3E58A 1NQWA 4JOQA 4TUYB 1O94A 1G5IA 3B2EA 4XB2A 3SQDA 1U9ZA 3WQHA 3I04M 3TLCA 1VSVA 5EUBA 2P5UA 1YQTA 1QQAA 1GCOA 3CRNA 2O4UX 3E5NA 4G4GA 2ZROA 4PGAA 4IWXA 3T5BA 1ZUHA 1HBJA 4LNUA 3B6JA 4PSCA 4RIEA 3WDKA 2BEKA 2X7HA 1IBLB 3H5AA 3H0CA 2B82A 3HCPA 4UBIA 2I29A 3KEOA 4MROA 5AHRA 1I2MA 5F3DA 1ULTA 4N54A 1NTOA 3EDCA 5BN5B 4S1TA 3ESYA 1U8EA 5HZKA 1EFRA 2EJWA 1G21B 3M4JA 2OGWA 1CZNA 5ADHA 3ZGLA 2NP7A 1AXRA 4J8PA 4D9IA 3TLGB 4Y2XA 4JLNA 4QYTA 1KTIA 2X8WA 3PQDA 4WBNA 2CEAA 4WACA 4DHEA 2V7TA 3MWGA 2FUEA 1UBUS 4PFJA 3BGDA 4FHDA 4B6JA 3LFHA 2WE7A 4FCWA 1QYWA 4B5LA 2GSDA 4BE4A 1OX6A 4M1QA 2XMPA 1I1QB 2JAQA 3RANA 1CZLA 4B3CA 3WOHA 1QHSA 1YZTA 2IPAB 4PX2A 1K7FB 4O4JA 5I45A 4OP1A 1K6JA 2Z1MA 2VR1A 4DIDA 3EVFA 3FNFA 4RJJA 4LFAB 2H08A 1QRUA 1DC3A 1Z2PX 5F51A 3LBNA 1DJLA 3V5NA 5ICFA 4HLDA 4U02A 1M2VB 1C8KA 2EOAA 2GB4A 4IX9A 5DNCA 1E0JA 3TTSA 4MS1A 2PZJA 5CJJA 5LWQA 2QQEA 5K3FB 3BRWD 5KVSA 1YF3A 1HR0B 4KAJA 3UPUA 2BC9A 1CZRA 4TSFD 1EINA 1WXGA 3UAWA 5FYQA 3S1AB 2QQFA 3U4MA 1D2RA 4IMIB 4B71A 2QVGA 3B48A 3UT5B 4M4SA 3C8HA 4P80A 3EIFA 4PFKA 2R7KA 3ONWA 3USZA 4NYJR 4YAFA 5KC8A 3S81A 1HI9A 3OU6A 4WLNA 5CB4F 2ZR8A 4IDCA 1N7JA 4EG8A 2P2LA 5JROA 2PD6A 3FTNA 5F76A 1G8MA 1D1PA 4F1KA 2V3VA 4UBJA 2JEOA 2FHPA 4HDSA 3VO1A 4BFLA 1NASA 1TGYA 2AJ8A 4QWMA 1EX1A 1VHWA 5BW6B 4CV2A 4ESOA 4TS1A 1E9VA 1BQ3A 2E4YA 1TJNA 2PKCA 3FCUB 3DEIA 3PPYA 4L5CA 4LJAA 4E1AA 3P45A 4EHDA 4NRDA 5L40A 3UJDA 1UAAA 4OI2A 3SVLA 2GEUA 1EX9A 3KLPX 1KFKB 4ALNA 4HK4A 2QROA 4OA5A 4P4SA 4BHHB 4PLZA 1DKNA 4IMJB 4TLBA 1RCUA 1ZZEA 4BO8A 1H2FA 4EL0A 1SHZA 1OYOA 3IODA 1GD1O 1QV6A 4RCVA 3K9HA 1IPHA 1OFIA 2XNKA 3P2YA 1NYQA 2NPOA 4OGFA 4S2EA 1BEEA 2CEKA 4J0EA 2ENUA 3EH1A 1P44A 2JGLA 2ASEA 1QMPA 1YZNA 5F9FA 4J1SA 5KNBA 3EG9B 1JS1X 3HUDA 1J0XO 4NONA 3A8TA 3LWNA 2QB5A 5T4FA 3TEJA 4DIMA 3WKDA 3PP8A 2EJTA 4DCTA 1K63A 1WU8A 4X3OA 1ODTC 3P5SA 1PQPA 3RVBA 3OQIB 1B8PA 3R5TA 3P9NA 4Z9BA 1W87A 2X7JA 4B7XA 4F04A 1R10A 1U0HC 4ID3A 3QE0A 3R7FA 1CERA 4CKWB 4E4RA 5JAOA 2B6NA 3KAJA 5JEEA 3KYCA 4ZODA 1XJCA 4YAJA 4J16A 1SC1A 3D3KA 1DJPA 2DFVA 2WSSA 4B6FA 2XQKA 2HCFA 3B82A 3WAGA 2H1FA 3GG2A 2VK2A 4QU9A 5AI8A 2WHRA 2G71A 2P2YA 3JTMA 1QLJA 4OHCA 2A2ZA 1O5IA 2ZE6A 5ECWA 1JWAB 3IV7A 4ZQFA 3EE6A 4H2DA 1S7GA 1UZLA 2CFCA 3Q2IA 5UKDA 1OLSA 3ZD9A 1EH5A 4BU0A 3GJYA 2KLHA 1DTWA 3SCZA 5LYJB 2R84A 2VBCA 5LFAA 3CU5A 4TS3A 3C5WP 3COVA 1WZEA 3V1UA 3OJEA 3ETDA 2P1DA 3GW8A 4UBNA 3ST7A 1FB5A 3R9KA 1RXSA 1IEWA 3FDXA 2O3UA 3KRTA 3OUTA 4RO0A 1LD3A 4GEKA 3OMWA 5LA6A 1PVDA 4B3FX 2Y67A 4L8GA 1UDAA 5JADA 2AZXA 4LCEA 2RHCA 2HSGA 4MKIA 4PAQA 3AHDA 2CUKA 4M98A 5K8TA 2CZGA 4JZYA 3UUWA 5K3AA 4R41A 2FSSA 4NBKA 1DPGA 4P08A 1AZWA 4ZEWA 4PIVA 3WBJA 2D7JA 4Q7QA 2E5FA 4US1R 2IRWA 1A9XA 4EQ6B 1XC7A 4DDUA 1BXZA 2PIAA 1LNSA 3O83A 4F9TA 3VO2A 1PYDA 5E7JA 2EX0A 3ES9A 1TUBB 1H8ED 4L4ZA 2FG6C 2HK7A 1N32B 5ILGA 3RROA 3K0CC 3U4DA 3H2SA 1MO5A 2ZBEA 1K7SN 1TZKA 1PWEA 4P36A 1E92A 1JVSA 1QZ3A 5HKKA 1CJSA 1C9JA 1KMHA 2R79A 1ZKMA 1U3DA 3UMYA 2DJ5A 4IIXA 1DXOA 3F67A 4JA2A 3LC1O 1T13A 3OKAA 1K8RA 3NHPA 1R5NA 1WPXA 2F59A 2GYYA 1ADCA 3RVDA 1ADGA 1MABA 1Q3TA 3D3JA 4ND2A 3WMWA 4DOMA 1AE1A 3ND5A 3V1TC 1HRKA 2FSVA 1IU9A 2IOFA 1W4ZA 2PM8A 3FFAA 3G1WA 3H8VA 3L6UA 5IW8A 5TJ9A 3MMPA 3LXXA 3OJOA 4TL9A 1K68A 4OYRA 5ALKA 5DMXA 1MGPA 1U3GA 2EG5A 3P20A 3RUCA 4LOKA 2I6XA 4GM0A 1OV6A 5AXCA 5KOJB 2IXFA 1T0JB 1ZBQA 2G5GX 1W88A 2KMLA 1CR2A 3KYJB 4U7WA 4BQFA 1MOSA 4HZUB 2JLSA 3BZBA 1RIIA 2JZOA 1CV2A 1ZAKA 3JRWA 4ILKA 3CN7A 3DDHA 3MZ0A 3NRJA 4UHJA 2H5EA 2EJVA 2WD7B 1G4AE 4KKVA 3EXIB 3SP1A 3TL2A 1L4KA 3G3EA 1OYVA 3V80A 3WWOA 4YUAA 1KO7A 3BF8A 1XCLA 1B6RA 4L08A 4XGNA 1N75A 3HKCB 5KREA 3DAPA 2OFPA 1H66A 1XHLA 3AOEC 5TQVA 2IHYA 3ORHA 1ZK2A 3VR4A 3G79A 3ZTTA 1BJRE 2J9YB 3CW9A 4NBUA 1G6KA 2GO1A 3V3KA 3CNEA 4C6HA 2W2TA 5DM4A 1S02A 4IXNA 5HS4A 1QHHA 4PCVA 3E8MA 4AJOA 3HDYA 1G4UR 2FZ4A 1XRMA 4Q4LA 2Q5LA 3IKMB 1Y7IA 4LEIA 2OO7A 3HKBB 1JKXA 1M0SA 1TT5A 3KQHA 4HTAA 3DA8A 2FKNA 4KXLA 2MHCA 1I1OA 2ZLBA 3JQPA 1NBEA 4LX8A 1I9CA 1PNRA 4QRIA 3VKGA 3IOEA 1Z07A 4RTOA 3M2TA 1YQQA 3P9YA 4Z0NA 4H6VA 1BCSA 5CK4A 3VR3D 4RPKA 4JCOA 4TVKA 2MT9A 3WGHA 1AM4D 3BQNB 1U2DC 1JFTA 4EF4A 4R4JA 2J0UB 5AESA 2ZRMA 5K2OA 4P6VF 1CTQA 1C0EA 2FQ1A 2Y05A 2FX5A 4G97A 1JEDA 5C9ZA 4PCAA 4WLEA 2OQIA 4C2UA 1T8PA 4TKVA 3T15A 2BF7A 3PX7A 2XQJA 2GZHA 2D1QA 2BE7A 4FCTA 4MW9A 1BC5A 1BROA 2XCIA 4OSPA 4UVEA 4NJMA 5ARBA 3ELUA 4FNOA 5DGXA 4RVHA 4GWKA 2E4UA 4ZI3A 4BFVA 1ADBA 2PXXA 4JP3A 5JNLA 2P77A 5DBHX 4U63A 2RK3A 3IUPA 5AVQA 3MXOA 5EA2A 3HY3A 4TLCA 4YEDA 3QVOA 2GEJA 5DOZA 5IDQA 1WPGA 7ADHA 3HYNA 1R37A 2VAXA 3H04A 1PDWA 5SZJA 5AVWA 1X92A 2R6HA 4DWOA 4YT2A 1OT5A 3Q1LA 1GKIA 1R6DA 3EHEA 4MP6A 1DWOA 5FUYA 1FFDA 3UWPA 3LZ6A 1P1RA 5DHUA 5CDUA 1K7YA 3ZQ4A 3GT4A 1QLWA 4PQYA 1SZCA 2CF6A 3U56A 3SR0A 2ECQA 1EFDN 1ZAYA 3GCDA 2GI4A 3QNWA 2JKVA 4RC9A 5AKHA 2G04A 3NFYA 1Z0SA 1NC1A 2XB2A 4HPXB 2XWSA 3ZW9A 2GK7A 1XQYA 3L7LA 4YR7A 3D2CA 4H3HB 4IZ6A 3V4LA 1PJ8A 4YGYA 5EE3A 3TK1A 1H42A 3LVFO 2Y77A 3GVPA 3H18A 1T2UA 5H5JA 3FSEA 4RKFA 4QXAA 3RUEA 2ONYA 6Q21A 1WD7A 2EYQA 2XE8A 4P7GA 5HQTA 4LKOA 4PHGA 4AKTA 1ZK3A 4CLXA 5K2MA 4CMEC 5JTUA 3EGOA 5AWFC 3DNMA 4ARAA 2JGDA 1Q1NA 2CUNA 1XYGA 2D1RA 1D9ZA 1F8FA 1RKBA 3I9V6 5G4KA 1CDOA 1DXHA 4QKQA 2KS6A 4ARVA 3NOOA 3LUCA 3KYDB 2ECFA 4ZT2A 1JFVA 3AJ9A 3PC8A 5FI3A 4CM3A 2J67A 1UC4B 3DMNA 5JPDA 4AJHA 2LTAA 3KX2A 4CKBA 4KRFA 3RABA 1SU7A 3TAUA 1FJGB 3FNQA 4TLEA 1WCYA 2I7VA 1TLFA 4FSXA 3A6LA 3HVKA 2WAOA 4H3KB 4MNTA 3WGQA 2H5IA 2G07A 1H9AA 1K8QA 2AF3C 3B9BA 4ZDIA 3BIWA 2L82A 5E4JA 4AJPA 3BHMA 1N77A 4IJSA 4IKEA 4M0KA 4RMNA 1TF2A 2GD2A 4YV2A 3OCJA 3WA6A 1ONNA 2CHUA 3R23A 4QVIA 5AW9A 2J5QA 2LUOA 2G28A 3BK2A 5JYDA 4PR0A 3K0BA 4IDUB 4E4YA 5CXUA 4QARA 2DFKB 1DC8A 2X8JA 1UK6A 1NJGA 5HR5A 1NBMA 2XDAA 4IFIA 3SJAA 2CFRA 4FYHA 4GC5A 1IHPA 3R7WA 2Q3FA 2WJ4A 1PBNA 2AOUB 3M6WA 4AVYA 2WUWE 3ZQUA 4BQNA 4BWVA 2D5LA 5EZYF 2A7XA 1AV7A 1FFHA 1SKYE 1I14A 2P6OA 4BKPA 1QM5A 4M0CA 4BVGA 2C4WA 3GJRA 1Z36A 2PNFA 1RVDA 4ES6A 5JEDA 5EPUA 2GN8A 3EY4A 3H9EO 1YQDA 4RPLA 4INJA 1QTNA 3TBHA 4HL6A 3N2YA 5AVXA 5KQMA 2F1RA 3EEFA 3GCXA 4I4LA 3PEVA 2GNPA 4ZCPA 5B36A 1R0CA 5ADWA 1P3DA 1PP4A 3B52X 4MVJG 4C5BA 3PQ2A 1CUBA 1Y4DE 3TX2A 2ZI7A 1F4LA 3MQFA 3E9EA 1G38A 3TOSA 3UXMA 1XNJA 1OFHA 2XB9A 4JUFA 3RYFA 4EJSB 4GX0A 5AW4A 4GXTA 4K87A 1M7BA 1WXQA 5D00A 3I8OA 1ZH4A 2X2FA 3CW2A 4RA6B 3ZV3A 4B2LA 4HB2A 4B8WA 4F4CA 4UU8A 3EDRA 2DTDA 1Y9AA 1HV8A 3IH5A 1ACMA 1N1MA 3Q3JB 3RVJA 1LBIA 1V71A 2FR1A 4OP2A 2P2NA 5BN1A 1B23P 3CR3C 3CR7A 3H2YA 1X19A 3BILA 4G37A 3W6PA 1BWQA 4NOKA 4OAPA 4D5EA 4XVUA 4Q15A 1LRKA 4QWWA 1JHXA 5AW2A 3U19A 2QZZA 5I9NA 1LF5A 4PTZA 4AO6A 4X8MA 1OGYA 1NBWB 3ZWYA 1LJLA 3O2QB 3OEWA 2JJ2A 3N2NA 5FIUA 4HB0A 5FQOA 1T1JA 1IHYA 4RA9B 3UXHA 1S7CA 4S0XA 3STUA 4TV9A 4F11A 1CIVA 1JQKA 1UPXA 4KACA 3S2FA 1Z4PX 3LAWA 1E61A 4UPDA 1L5GB 5IEJA 1GWNA 1H3NA 4KQFA 5C3UA 3PQ8A 4L8YA 2WFLB 4JI2B 3D6MA 4RHTA 4GI3A 3NAZA 1WCIB 1JEQB 4ZWNA 2WAMA 4HS9A 2BV3A 2DH6A 4U2KA 1NM5A 2BGGA 5JISA 4BB6A 2OWDA 2M32A 2JW5A 5G1OA 3DNFA 1VIDA 3DHWC 4KIGA 4R2LA 3QI2A 3WLAA 1WA5A 3BPSA 1SCUA 5HDQA 3U37A 1JHMA 3O03A 1QGUA 5K4GA 1CX9B 2YV1A 3NHSA 4KXVA 1JZSA 3LTNC 2E82A 1TZMA 1F8YA 4TXJA 3K30A 5MGNA 1KYXA 1E64A 2G9QA 3WZ2A 1VTKA 2DT5A 3AOEA 1PGJA 4ZQCB 3W6NA 3NVDA 5J2TB 3WGLA 2YHAA 3FAZA 4BAZA 2SKEA 4J07A 3A1UA 4ZRNA 2YS6A 4BNIA 2VJQA 4LNAA 4LMRA 1RWWA 3FOZA 2H16A 3J7TA 1U5AA 3T38A 2UXBB 2ILVA 5IAKA 1X7ZA 3CTPA 4FS8A 4Q7KA 3GN2A 4S1WA 1KIMA 4TTRA 2BHLA 4LY3A 5KNDH 3ZWXA 1FC0A 1PUJA 1SGWA 2ZU0C 3KKNA 1DIRA 1D8TA 3C4VA 4EGQA 5HKKD 2YHBA 4OF4A 1JG3A 1MZVA 2OCIA 2ECKA 3QY9A 5CLQA 4UBOA 1E94E 4LXIA 4UVHA 3VZDA 4KYIB 3TPCA 1T1IA 2HMWA 3ICVA 4GBJA 4FPXA 4Q7MB 4B6PA 1PR6A 5IMSA 1AUOA 1S96A 4AWXA 1JKFA 2C4NA 2LVBA 4EABA 3CZ5A 4I14A 4MVWA 5HJ2A 4EQZA 3VPDA 1U5BB 5G3ZA 1PT7A 1R3DA 4LSGA 3EEQA 2JJ1D 4IUDS 3ZK7A 1W9HA 3IQFA 1OFUA 2PL3A 1AN9A 2A3NA 5JAHA 3LRXA 1KDZA 2A6PA 2K4MA 3PKIA 4OHRA 5KVQA 2EAUA 2O7VA 4BWFB 1IOZA 4UCWA 2J07A 1EVEA 1PV4A 2FZEA 1P2TA 2SICE 3ABIA 2XWJI 3IO5A 5FUBA 3I9KA 4IIVA 1KK0A 1Y6RA 4MARA 4EWLA 3B3FA 1DMSA 1NPYA 1WB6A 3PX3A 4DSTA 4HYTA 2CNBA 2HF8A 1IUNA 1Q0LA 1QBGA 4FE4A 4HF7A 3W8FA 3WBBA 1ISGA 1U1IA 1QMGA 2AYZA 2W6JD 3FTPA 1VFNA 3I52A 3KPJA 5REQA 2J4FA 2A9FA 5DNUA 3UM9A 1M1XB 3GEIA 4MQ5A 5JNWA 1RRMA 1RYHA 2LDBA 2EYUA 3HB1A 1IRIA 3DYVA 4CTMA 5B57C 1WXHA 4F9GA 1JR6A 3KQPA 4NV3A 2IGBA 3VR2A 4E94A 4PC3A 1U94A 2NW6A 1RBZA 1JIUA 3MILA 1G8PA 2Y92A 4PU0A 3HYCA 5COAA 2PR7A 1H2YA 1OX5A 2E4WA 3RSFA 2VHJA 5F23A 3CLSC 1YS1X 2VTEA 1PNOA 5F1PA 1CLEA 4YRGA 5BW5A 2W2KA 4FR5A 2PGIA 3PXCX 2VQEB 1ORHA 2J1LA 3FMIA 4RELA 1ZC4A 2JBAA 2VQSA 2WSBA 3C98A 5AXBA 2WU8A 3FWYA 4EA7A 4TPKA 3CW8X 4BPRA 2A9RA 3K70C 3RK0A 5G1PA 1GZ3A 3HXLA 3BA1A 2JAUA 5DI9A 3S44A 3SYKA 5TMPA 1RM4A 1SCQA 5D86A 4UEJA 4EW2A 1NW7A 4HGYA 5IJ9B 3RJTA 4TMVA 5LZ8A 3RW9A 5HRCA 3ZDRA 4YCNA 3R9XA 1MC4A 3WI7A 3KEQA 2A8YA 3DL0A 1SG6A 2XZTA 2O2ZA 2YOFA 1A4IA 4UTOA 1QJ4A 2LV8A 4RKRA 3JQGB 4DMUB 1BVYF 4JBNA 4LUCA 2UUBB 4C4OA 2P9HA 3NWEA 3WWCA 5HOEA 3AXTA 1ZNXA 4ISBA 4CMBA 4E08A 4AI6A 3TQIA 4ZYVA 1XWFA 1JLMA 3PDUA 5AW0A 3A6DA 3TOCA 2WLTA 5CHYA 2J09A 2R1ZA 3P52A 3GFBA 3PL1A 3BDIA 2HCBA 3LS2A 4HNQA 4YMGA 1H8HD 1RWVA 3S70A 5ALTA 2IPXA 3TJMA 2Q4OA 1JSLA 1T0PA 3D43A 4MVJE 1KZ1A 1MV5A 4F92B 1DT5A 3GN1A 2F9FA 4YB8A 5EQTA 3MS7A 2QSYA 1M5RA 4Q1AA 3PCTA 3LQYA 3QLEA 5AVUA 4R8VA 3BRSA 3KLOA 4ZJPA 2B1IA 5A9TA 4BPBA 1HO3A 3FPJA 2I78A 4KQ6A 2EJUA 4NECA 4RKQA 3QUCA 4C3VA 2JD0A 3K3PA 3UJ7A 4FZ5A 4IIDA 3KQWA 1KPHA 4BUZA 4BJ3A 5LP1A 4JNGA 1XIVA 4AQYB 4L74A 4GI5A 2H7YA 1ZJJA 2CWWA 3OU7A 3K0FB 3O8BA 1U3WA 1QIMA 1FOEB 1P5HA 1IJFA 1LV7A 4AROA 1I2BA 2H18A 3LNCA 3L77A 3EVZA 4FR2A 4N6OA 3T9DA 2B9VA 3DAYA 3D8UA 3B53X 4IFBA 4P3YA 2ODBA 1UEJA 5FR1A 4NCNA 1ESEA 2R0QC 1KMCA 1F9AA 1I3NA 3AVWA 4ND5A 1ISRA 1IY9A 2I1QA 2PWAA 4Z51A 2ROQA 1CJUC 3SYMA 5L45A 1FYWA 1DJMA 2ICAA 3RS2A 1KI7A 4HH3C 5IXYA 1HYEA 3GJ3A 2BJWA 4L6CA 3G2KA 2GEVA 4ER0A 1PYOA 1RZUA 1FS4A 1P9WA 3DV2A 3GRFA 4FCVA 4BEWA 4PC2A 3MT8A 1IN6A 2NZWA 2PCLA 4XWTA 1PV2A 1TAGA 9ABPA 1IM8A 4ESVA 1RE0A 2Q2VA 3RAFC 2JD2A 5KDOA 2QTMA 4GXRA 4OM7A 3VYUB 4R3UC 2AG6A 1RAEA 2GFQA 4F9EA 1CZKA 2R5WA 3R5HA 5ISMA 1EFCA 1R66A 2R1VA 4KYUA 3R9XB 4F2PA 4YJHB 2PGDA 3OPQA 3FPAA 4UJ3A 1UDRA 2H06A 2P2SA 3D31A 3HGQA 5BY2A 2QU8A 3NP9A 1K4MA 4G5RA 4B2PA 4CE6A 5DEOA 3ND6A 4RMGA 3KKZA 2Z2JA 4O2BF 3IUBA 1WSAA 4P93A 3WJ7A 1GNRA 3IESA 3IQXA 5TX7A 2ZREA 5DM60 4DFDA 1JGTA 1LSOA 3B1JA 4ZO8A 2YJZA 3HDHA 3TEMA 5MHTA 2OR3A 4EJMA 5H3HA 4D96A 1HYQA 1KVRA 3PHJA 2H6EA 2PGAA 1VYUA 2RAFA 4R2XA 1GO2A 3SM9A 4DLSA 1E2DA 4MX8A 1V0JA 2ERXA 1Y34E 2JBAB 1MKYA 1Z0IA 1CKEA 1XMQB 3RBVA 4NNJA 4PBSA 3TZEA 1E6EA 1L6IA 1Q1QA 4KRYA 1F7UA 4XJSA 3AEUA 3RWOA 2GF0A 1U4OA 2AE1A 3UPDA 2FW8A 4CCYA 3QTLA 4PC7A 1X15A 2WSSD 4FU0A 4GKBA 4QXOA 5LM3A 2ZUEA 3ANTA 4OG2A 3EPJA 3MTGA 2EKDA 1U90A 4FGLA 2IS4A 1Z16A 5CT9A 3VPAA 1VZ3A 5IKPA 3CUKA 1R8QA 2Z95A 4BNVA 4ESEA 5IF9A 5MF6A 4P3OA 1YJ5A 3E7PA 1Z5PA 4PTYA 2OFOA 4UHDA 4WK6A 1KY5A 4D43A 2D00A 2YV3A 3KCQA 1J06A 3VU9A 1HLDA 4XRGA 1UZNA 5CCDA 3DBOB 5AD1A 2NUPB 3TLBA 4IICA 4NESA 2ID8A 5C7OO 3CUWA 3R3HA 1NW4A 1ENPA 1P81A 1YGYA 3QP9A 2FUG1 3W5AA 2WAAA 3D6FA 4GL2A 1YIAA 4CVNA 4I8XA 1GYRA 5DF1A 3DTTA 3SZMA 2HJHA 4GZMA 3F90A 1E60A 1Q21A 2QV7A 3P2JA 3GPCA 3K2QA 1U4NA 2HUPA 2WICA 3LZCA 4ZZ2A 3COJA 3R40A 5CLLA 3CYFA 2EKPA 2EX1A 3PGMA 1FTSA 3ECSA 3FOCA 3GHYA 5GONA 5EIAA 3MWDA 3E9QA 3MWKA 2FR0A 3K9GA 4ODIA 2PKQP 4GU5A 4HWRA 1KDTA 3PWZA 5F64A 1RWKA 2JFFA 1QG6A 2FWIA 3T1OA 4JLWA 3GJTA 3OQ1A 5L7TA 3ER8A 3VR5A 1QFZA 3BICA 1LFDB 3MTEA 3PNBA 2IZZA 2P2CA 2ZIUB 1KMQA 3ZQ6A 3OQHA 4RE5A 3ONNA 1MG0A 3DAOA 3DVQX 4PINA 4G5QA 1RCTE 4LZZA 1D4AA 4I1OA 3TQSA 3IMEA 2YDXA 4XIGS 1XQ9A 2HU2A 5D7BA 2FQQA 5KTNA 3H3JA 4J0FA 3WGUA 1MOPA 1JHZA 2BSAA 4LJYA 1MAAA 2JIPA 4IYRA 4MWOA 4II3A 2G9ZA 4LE1A 1BGVA 4OQFA 4BTLA 5HQJA 4DSUA 4JLVA 1X7WA 1TEHA 1R8JA 3ED1A 1LRJA 3HY6A 3QV1A 1K66A 1E4OA 4RZ2A 4WEQA 3WYAA 1W85A 1EAMA 1D6NA 4PCLA 4UDOA 1HG1A 4UOQA 4YN3A 3WS7A 2XHEA 2O8FA 3CJRA 3CUVA 4CNQA 3LKZA 1K5PA 1CY4A 2INGX 1Y3DE 4JUBA 5CR9A 3QF4A 1FE8A 1LW6E 2OLKA 3CMCO 3DKVA 3FUUA 4IHJA 4LDNA 5HJ5A 3WO0A 1O6GA 1F5SA 1PL6A 4M8LA 2QZ9A 3INYA 3P7MA 3QWBA 1EXMA 1F2UA 3DT8A 2H4JA 4AZSA 5SYAA 1MX9A 3QA3E 4ZVVA 1SQ0A 2KX7A 3TKAA 2Q3BA 4P83A 5DO9A 3HCDA 5KYWA 1YZGA 5ICGA 1MNQA 3KQUA 4L0QA 4FUTA 5D3KA 1VMAA 1V7PC 1YZLA 1UKZA 1CY1A 2HCJB 1A9QA 1GGKA 4ABTA 1C3OA 2R8EA 3I12A 3D6JA 3H86A 4J9UE 1Z4NA 4I4TF 2VF2A 3QLVA 1JQ5A 1N7GA 1W75A 1YKGA 2O2GA 1G0OA 3DDCA 3HR8A 1AKWA 3OF3A 4PO8A 4LF5B 2HUNA 1RAAA 3NPAA 1ZD4A 3H7IA 3QVSA 4FFMA 2Q5EA 4TLMB 3GEPA 1ND5A 3ZU5A 1TQ8A 1UPBA 2A0XA 2XLBA 2P9YA 4I1IA 5I7WA 2XTZA 4NNOA 3WGOA 3JWIA 3JVDA 5JMOA 4F91B 2FR8C 2DR0A 4RTMA 2G5PA 5I5EA 4NICA 3S5UA 4BVJA 2IU6A 4U39A 5KQLA 1CZOA 1DLJA 1T36B 3BJRA 2NO0A 1KGSA 4IPTA 3JQBC 4OHXA 3ZZ1A 5FEUA 4G07A 3OPVA 4I9NA 2J4DA 2ZAIA 4I7EA 4ND4A 4Q9JA 1F60A 5DB4A 5IAJA 2O8DB 1VPDA 5B2EA 1PDOA 4YRPA 2ZJ0A 3KQYA 3SXUB 2C92A 1ZJYA 2DR3A 3L40A 2B2CA 4YJFB 2NZJA 1FSZA 1SC6A 2Z2IA 3AKCA 4JLBA 5DXFA 2HMAA 2HX1A 2ZRHA 2WNHA 3DF7A 1C3EA 3F3SA 3FCOA 3VPCA 1ZGZA 1QCDA 3ETLA 5KKNB 3NO4A 1YIDA 4FNAA 4RPIA 3TMAA 4QAQA 3RIMA 4BNTA 2DSTA 2R6CA 4KYVA 2YRXA 2XCRB 3AIIA 1F2TA 1NU8A 4IF6A 4M76B 3WIVA 4IQ4A 1BHSA 4KXQA 5HK9A 1A71A 4MYHA 4O1HA 2O5CA 3QW2A 1MIHA 1UK9A 4S3MA 3PC2A 4NZPA 1VHLA 4R98A 4DV0B 3T4UA 1XD9A 3IJEB 2HWKA 1OFGA 3I9LA 3SZRA 3AHFA 1NVXQ 5K6AC 1RMYA 2QL9A 2AA3A 3OM1A 2FLWA 4REMA 4MMZB 1FF9A 4C08A 2ZS7A 3LXUX 5BYAA 2F8MA 3N0TA 2DHDA 5HDBB 5IUJC 4N3BA 2DLNA 1NZJA 5A04A 3Q3IA 1KRXA 2FVXA 2O1SA 4E12A 4RBNA 3R44A 4CV1A 1NDUA 3GAAA 4WXHA 3ROQA 4A6EA 5K4HA 1YH3A 2JFXA 3CLTC 4W8HA 3TE7A 2ZVQX 2QAJA 4X94A 1I94B 4IDUA 2RGAA 4KO1S 2Y1CA 3QXCA 1K7EB 3C70A 4F46A 5ICCA 4KOEC 3N2KB 1O8BA 2HRQA 2OZKA 2C1XA 3GPDG 4YLEA 5EZ5A 2BFFA 3B6KA 1YB1A 3MEQA 3VVBA 5DXJA 2VA9A 2OM2A 2AF4C 1XZBA 4JVSB 3T7IA 4OXXA 3HVRA 3K1ZA 4P4LA 1D4ZA 2VPPA 3NT5A 1CQXA 3RC3A 2BTQA 1Y1PA 5KUTA 4H27A 3H6GA 2F3TA 2VDOB 4DA0A 2R85A 3NGXA 3CR8A 5AO9A 3B78A 3B1ZA 3EBOA 3CSDA 1R5BA 2YJGA 1JKIA 1GOTA 1KP3A 2ZULA 3IDSA 4I8IA 5DLDA 3VI4B 4IUBS 1OZGA 1N2IA 2QXUA 1DIHA 2FPPA 4PR3A 1E2QA 4MVXA 5B1EA 1MOZA 3GNSA 2PJZA 1L7RA 4IV5A 2MSNA 3ECAA 1D4OA 2JPDA 1EM8A 4EYKA 2PL5A 1NVUQ 1EUCB 3OZXA 5CW2A 1X80A 3KTAA 1IXYA 2VS1A 4L8WB 3L7NA 1GHTA 1UINA 1Z7WA 4FYIA 3H87A 4PYKA 4XUCA 5EHGA 5L3SB 3LO8A 4IDPA 1SN7A 1TKCA 2WJVA 3IILA 3ZQJA 3HDQA 2E85A 4GR5A 5FOSA 4HADA 2G5TA 4UE6A 5IXSA 3DVAB 5CVDA 3NYRA 1YNSA 1RQPA 2OZPA 2CV0A 2JJ2D 4AYXA 5EJFA 3DSRA 3T7EA 3IE2A 3K0CA 1BQEA 3SICE 3TB4A 5AM3A 1IFXA 1M2JA 2A1TR 4JDUA 3VOSA 5KCZA 4WOJA 3EX7C 4HQ6A 3HL4A 1M72A 4LJ7A 4LZLA 2JFUA 4YCAA 3ZHVA 2A3RA 3DGEC 1N1GA 1TM3E 2HU7A 2WV9A 1VGQA 2FRXA 3KSZO 3LFTA 5CFZA 1RKUA 2ZSIA 3ZU6A 1L3CA 3J7AC 2JGIA 1OWOA 4FKZA 4KQ9A 5K8JB 4I50A 4UNNA 5EHNA 5J2UB 3DVLA 2I4IA 4GWGA 4EFKA 2MU1A 3B5JA 4PSVA 5HIMA 3WDSA 3E35A 1I10A 2QTHA 3DV9A 4IVQA 4KK4A 4DJEC 1TK3A 3C3WA 1MUUA 1MJNA 2IPNA 3CUYA 3B6IA 4LVUA 4B8ZA 3F71A 1C3JA 3PQ4A 3ZH9B 4ZV4A 5KYTA 2HF2A 2ZWPA 4E21A 3TQFA 4D41A 3I72A 2WUVA 3EGIA 1FY2A 4NJMB 3ZWNA 1NQTA 2B0CA 1QYRA 1X9HA 3H8JA 1KJWA 5CLIA 1X8XA 3GA5A 2FFQA 4ZOLA 3LLUA 1WB5A 3UHFA 1C41A 3HB0A 2IBSA 3O93A 4XPZA 1ESNA 1SRRA 3UY4A 1GGEA 3OPNA 2ZW9A 3B9QA 3H9UA 3ZCPA 1ZVVA 1U0FA 1SPBS 2EP8A 1DQPA 1GAEO 1I3KA 3O3NB 4L4SA 4I1PA 4D79A 1KXZA 3WWZA 4EP1A 6AT1A 3AP3A 2CLIB 1P2BA 4Q48A 2IXAA 3GF4A 4ZARA 1R1DA 4DE5A 4FT2A 4R7GA 5G4LA 1FFBA 1BD4A 4BKRA 6ADHA 3OUZA 5JO9A 5CRIA 5FBLB 2QWXA 2IFTA 2UZ1B 4L9WA 1W2WB 4NMMA 5DP2A 1YU9A 1ORTA 3QOYA 1TT5B 2CJXA 4D45A 2W0MA 2POCA 4EPXA 3T94A 3RRZA 1DKOA 1T1GA 1STOA 4RPJA 2WC1A 4PLPA 5EYPA 4CT5A 1CB0A 4D3XA 1L7AA 4EUFA 4XRRA 3ZE2B 3SS7X 2PX2A 3P2IA 4PZUA 1OHHA 1IQ0A 1QIDA 2WMYA 3FTFA 1XLWA 2WTUA 1PWYE 2WNSA 3H97A 4LFBB 2H4ZA 1VCIA 1PR5A 1E3LA 1JSRA 1UMDA 1ZNQO 3JZDA 4RJ2A 3JWPA 5J2TA 1B6TA 1ICEA 1SA0B 3QZUA 2AUNA 1JG6A 4KX5A 4R0NA 2ZBRA 3KZOA 4IDOA 4ID9A 1PWHA 4HWSA 4CV0A 1FU4A 5F4ZA 2OL4A 3A2MA 3AWIA 2VXYA 2OGZA 4A4DA