3RUDA

Alternative analogs as viable substrates of udp-hexose 4-epimerases
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
341
structure length
336
Chain Sequence
YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternative analogs as viable substrates of UDP-hexose 4-epimerases
rcsb
source organism Plesiomonas shigelloides
molecule tags Isomerase
molecule keywords WbgU
total genus 131
structure length 336
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rudA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3rudA02
4QSMA 3DC2A 2QRKA 1XA0A 1ZUD1 3CTMA 5JC8A 1ZSVA 1LUAA 2VNAA 4IPTA 2NQTA 3CPSA 3FWZA 3P5SA 1U7HA 2O2SA 4TROA 3ABIA 4R54A 4YACA 2NVWA 3PLNA 5GZ3A 6ADHA 3RBZA 4D3SA 5KOIA 4BO5A 3WYBA 1YOVB 4CMHA 1OC2A 2IZ1A 1X1EA 3AU9A 1DAOA 1RJWA 2J3JA 4EBFA 1I3NA 2ZB3A 3DZIA 5G4LA 2PGJA 3OJFA 1MP0A 3PYLA 3C1TA 2EHDA 2R6JA 4M49A 1X15A 2EGGA 1ZNQO 2FHSA 2JCXA 1OBFO 1DPGA 2EEZA 3ULKA 4AJIA 1O5IA 2EJWA 2Q50A 3Q3CA 4RF4A 1YBMA 1JKFA 3PQEA 5JDCC 3K5PA 3PHHA 3Q9UA 1TA4A 4I5GA 4U0JA 1GDHA 1R6DA 1NM5A 1C0KA 3ICCA 3CKYA 4XKJA 3VH3A 4CUZA 3EW7A 5JMWA 1E1LA 2FZEA 4BKUA 1LDNA 1TT7A 2FOIA 1DAPA 2AW5A 2O7QA 3S1LA 4R9SA 4CV2A 3E9MA 3LYLA 2QQ5A 4PZCA 4U8GA 2IRWA 2D59A 2ET6A 3UGKA 4NG5A 3U4CA 3W4KA 5T5QA 2Q1SA 4PIVA 4F45A 1HE2A 1H2HA 4PRLA 4CMEC 1W0CA 3L4BC 1NFFA 2AEJA 4MVJI 5HTOA 5G0VA 3FCOA 1W8DA 4RPLA 1YB4A 1O9BA 4XZ3A 4DYVA 3QSGA 4CM6A 3LF2A 3WX0A 4AJLA 4J9VA 4EZBA 5TGDA 5TS3A 3GQVA 1D3AA 1HZZA 4L74A 3VH1A 3FSRA 5ICSA 1YXMA 2Y0EA 1V6AA 1CDOA 4CR8A 3MJCA 5B1YA 1CQJA 2EW8A 2GR9A 4Q3BA 5IDWA 4R01A 2EKQA 4FW8A 4NBUA 3IP1A 5EQFA 2VHXA 3L0DA 4PLWA 1H6AA 5JAMA 1VJ1A 2A94A 2YHIA 2JHFA 3EHEA 2Y66A 1NP3A 4NQZA 4B4VA 4CLEA 2X58A 4G81A 2OO5A 4NK4A 5DCYA 3OJLA 2ZQZA 5A3JA 4I9HA 4BO9A 1C0PA 3ZNQA 2I3AA 5U4QA 2VRCA 2Z1MA 2I66A 3U4IA 2C82A 4NIMA 4ALLA 3E5RA 4EW6A 4PG8A 2Y0CA 1X13A 3WGIA 1U8FO 3A1NA 1IZ0A 3ITDA 3ZHYA 1JAXA 1P9LA 3JV7A 1DSSG 2OUIA 1O6ZA 1GZ6A 4OXKA 5JDIA 3UKOA 2YV2A 2DTXA 3PJFA 4AICA 1Y6JA 4YR9A 4MPDA 1XSEA 3PYMA 3VVBA 2X0JA 1TVEA 2POQX 2DPHA 4WE3A 1D1SA 2FWMX 3LT4A 5BSEA 1Y8QB 3KETA 4IZIA 1ZW1A 2CVOA 2G5CA 4Y9DA 1K2WA 1E3LA 3DBRA 4CLOA 4HADA 3V1TC 1XU9A 4OQYA 2P9CA 4FCCA 5ILOA 3SC4A 3JQFA 4CMAA 2PWZA 3BHMA 4LRTB 4N54A 1P31A 1D7OA 5KVSA 5ICMA 1JU9A 3DXFA 1ZJZA 3I9LA 3I9MA 1EFLA 3MOGA 3GF4A 3ZNPA 2H6EA 4WASA 4LRSB 1Z82A 1IPFA 4GWKA 4B7UA 5KVQA 4D41A 3OQ6A 3ROQA 2BELA 4J1SA 4X54A 4WLEA 4ESOA 3V1UA 2DU8A 3WBBA 5AYVA 3D5TA 1UXKA 3QVOA 4NU6A 1J0XO 1BXGB 4IBOA 5EPOA 3GVPA 3WB9A 1N9GA 2AG8A 1EVIA 3A06A 4LCEA 4BKQA 4O5OA 2RAFA 2RHCA 4CLRA 3AI3A 3R3SA 4NU5A 1DC3A 1TLTA 3GC6A 4LISA 1T2FA 1HYHA 3DFZA 1RM0A 2B4TO 3GHYA 1SC6A 3HDYA 4FOSA 4LSMA 4WJZA 2C20A 3JD3A 4IQ0A 5IZ4A 1YVEI 1Z74A 4D0SA 1K6XA 3B20A 1OFGA 3GMSA 1UZLA 3JQAD 1K3TA 3PP8A 1BRMA 2BRUA 2JD0A 3LQFA 3R0IA 3BYZA 1YRLA 4DWVA 2VYNA 3PHGA 4XRGA 5KJEA 1BVUA 4FQ8A 4F6CA 1QR6A 3JQFC 4PZEA 2PKQP 1PJTA 4CR6A 3P2YA 2HMTA 1B8VA 1GQ2A 4PVDA 3D4NA 4YJFB 1CRWG 2ZK7A 3MJTA 3PQFA 5BNTA 3K92A 3JTMA 1PS8A 4AJ1A 3D1LA 1NFRA 1NX6A 2D5AA 3OA0A 4TVBA 2Q2VA 3L4SO 4ZVVA 3FR7A 3INGA 2EG9A 3ZWCA 1A7AA 4GMFA 4UVEA 3QWFA 2JD2A 3NTQA 4LCJA 4HUJA 3DQPA 1C14A 4ZQBA 4FFMA 3HN2A 4Z0PA 4A03A 2J5KA 5CDGA 1VL6A 2WDZA 2BFMA 4UVDA 4MKZA 3ZU4A 3H5NA 5BT9A 4NDNE 3GY0A 4Y6RA 5I8ZA 4OJNA 2NVUA 4YCAA 4HFNA 4Z9YA 4GI2A 3F3SA 1GUFA 2EV9A 3Q6IA 3PHLA 3JCZA 3E18A 3KUXA 3G17A 4EUFA 5IDQA 3GUCA 2WWRA 3DWFA 2GO1A 1HLDA 3NDJA 3Q0EA 3ZWMA 1U4SA 4O0LA 4XYGA 1B15A 3VOSA 5B4TA 5MGBA 2DBVO 4YRDA 4BNTA 4GQAA 1JTVA 4TRMA 3ASUA 1DIAA 2BFOA 4ZA2A 4KDFA 3D5QA 1OZAA 4WCDA 3RUHA 3STHA 1UDAA 2DTDA 5C5IA 3GEGA 1AXGA 1T2DA 4FS3A 2ZYGA 3KEQA 4R9RA 4UUPA 4QTZA 1HDYA 3QLJA 1DJQA 3LVFO 1X1TA 1GZ4A 4DMMA 1Q0LA 1CWUA 1U5CA 4LVCA 2WYVA 4A26A 3UH1A 1NAIA 3GNTA 1O94A 4R4JA 4J43A 1GY8A 3TZ6A 4F3YA 3IAHA 2Q4BA 3FBTA 2VUUA 1ZK3A 2NM0A 3L9WA 1R15A 1OMOA 4XA8A 1ZMTA 4AG3A 1CYDA 1ZMOA 4NJMA 3FPLA 2WE8A 3M1AA 1ZK2A 4MKXA 3OICA 4B8ZA 2O3SA 3S2FA 3DMYA 1MX3A 2JKVA 1RWBA 1NPTO 2O3RA 4JROA 3ZDFA 3D4OA 3I9JA 1NVTA 2CF6A 5CEEA 1EE9A 5JE8A 1LSJA 5AXBA 3A9WA 4KTVE 3UUWA 3IKTA 1LLCA 3QQPA 3BMCB 4PLTA 5I9LA 1HRDA 4P38A 3PK0A 2HCTA 5THKA 4BKOA 9LDTA 1K5HA 4GKVA 3KYDB 5G0TA 1GEEA 5JO9A 4BO8A 1I3LA 1SEVA 4BIIA 4NH4A 4Y6PA 2ZQYA 1BXZA 5F5NA 2OBYA 2CY0A 3HSKA 4CMBA 1UXJA 1HL3A 1D4FA 3IS3A 3ZU5A 2GSDA 2X86A 4PLHA 4IDAA 2VUTA 3TFQA 3D7LA 5CEFA 2HK7A 1IL0A 1Y9EA 2ZB7A 1E3WA 3F5QA 2O23A 1VC2A 2EW2A 4ZN6A 5IAAA 1WAMA 1WP4A 4GSKA 1BHSA 1PJLA 5JY1A 2CF5A 3GVCA 3RKRA 3QE3A 4WLVA 4RVUA 1E7RA 1R37A 4FJ2A 3LC7O 5LCXA 2PKQO 1I30A 3CMCO 4W6ZA 4JBHA 5CEJA 4K6FA 4YRBA 1AE1A 5BSFA 1B2LA 1LQTA 4N5LA 1V3TA 2Y1OA 1PWXA 4A27A 4AJ2A 3H9UA 3KB6A 1XKQA 2WEKA 5ENVA 4CM4A 4D46A 1XG5A 2X7HA 4M55A 2QRLA 4CPDA 2EGHA 1LC3A 3ZWXA 2Q2QA 7ADHA 3Q11A 2CMDA 1G1AA 3GG9A 5TRTA 1N2SA 1RPNA 3GR6A 5F21A 4CM9D 4RORA 2XXJA 1PJQA 1NFQA 3VDRA 1E1MA 2UUPA 5A3VA 1SAYA 4B4WA 1K6IA 2BGKA 3DDNA 4GLLA 4J16A 1PJ2A 2DUUA 3EVTA 2XXBA 3AUUA 2G1UA 2X1HA 5C7LO 4CL3A 3C85A 4U0KA 1GPJA 2Q2WA 1OI7A 4BVAA 4EEXA 1GTMA 2BI7A 1MG5A 2Q99A 4BKRA 1MXFA 4PFJA 3GFGA 3VH4A 1ENPA 5IXYA 3K73O 2AMFA 4UVGA 5DCWA 4JJFA 2G17A 3C24A 1E7MA 2YUTA 4A0SA 2AEFA 3DOCA 4JK3A 2D8AA 2E82A 2VHWA 3MWEB 4UUMA 1YDEA 5A9SA 3ZZNA 3GAZA 3AOGA 1U5AA 2WYUA 1BG6A 3G0OA 2O3QA 2VHZA 4RJTA 2WE7A 4TMFA 4EJ0A 4BO7A 2PH3A 4DQVA 3SXPA 3OM9A 3GH3A 1KIFA 1NASA 2X0RA 3K31A 5CDUA 1BWSA 5G4KB 1HXHA 1Z7BA 4IINA 4MP8A 2PZLA 1I36A 4S3MA 3WWYA 1EDOA 4G2NA 1HDOA 1YE3A 4L76A 2YW9A 1UAYA 4CV0A 3BMOA 1YQXA 1SBYA 2FZWA 4YAEA 3FN4A 4AFNA 2O3UA 4K26A 5AOVA 3U0BA 5JY6A 5KKCA 2QRJA 2EKPA 4CV3A 3NT2A 3ZCXA 3OIDA 4NPCA 4WEOA 3VTZA 4YJDA 1DFHA 2BFPA 3GNQA 4OO3A 2GASA 3WIDA 3X2EA 4G65A 4YJHB 5JMPA 2Z5LA 3PXXA 3O4RA 3C3XA 3EYWA 5CG2A 1UJMA 1UDCA 1AHHA 2JD1A 4CMIB 2VRBA 4FFRA 1PGOA 1HSZA 1ML3A 2HSDA 3WYCA 5HA5A 3W6UA 1ADCA 1VJ0A 2X0NA 3ZU3A 4GKBA 1R66A 1ADBA 4DUPA 4Q39A 4YJGB 3O26A 3FNGA 4JJIA 4PRKA 5K6AC 4XQEA 1YJQA 5I7EA 3MJ4A 4PG4A 3TFOA 2HQ1A 2P91A 3HFSA 1Q7CA 4AJ4A 5GZ6A 3U09A 3ETEA 2XAAA 3ZI0A 3ZWPA 1ZEMA 1FXSA 1I2BA 1V35A 2B35A 2EWMA 2P9GA 1JN0A 1ZBQA 3AOEC 2VTEA 3L6OO 1J5PA 1VLLA 5G4KA 4XQ9A 1FDSA 3EDMA 4H15A 1KYQA 4D79A 1PGJA 2ZJ0A 1SMKA 2IYPA 2X5JO 1YONA 4XJTA 2PR2A 4YEDA 5CG1A 4H3VA 1YL6A 2OFPA 2VYVA 3WNQA 4BO0A 1BW9A 4ID9A 3KZVA 5I9MA 5A9SB 4B8WA 2BMAA 2EP7A 2VUSA 3QWBA 4D3FA 3GGOA 4BNZA 4RV9A 3QIVA 1T25A 4XYEA 2VYVD 2ZTMA 3FTNA 3S2EA 5A5FA 1YB1A 2AA3A 4G5HA 1NPDA 1Y5RA 5FFFA 1E1NA 1FJHA 4D0RA 1HKUA 3HZZA 4KWIA 3W4IA 4CMKA 2IEDA 5U1PA 1N5DA 3HG7A 3ONEA 3MJEA 4IIUA 5COAA 3RC7A 2X9VA 1T1SA 2JFHA 4PG6A 1QYWA 1WDMA 4I9NA 4CMIA 1RKXA 4L4RA 3OHSX 3TQHA 2PGDA 2W4QA 1NR1A 4K6CA 3HB4X 4QX6A 4DBZA 3PIDA 3TDKA 1TT5B 4J4HA 3ZN2A 1BVRA 1DFIA 2I9PA 2ZJ1A 1LSUA 4TVOA 1EK6A 3O38A 2YV1A 3UCEA 5A9TA 2VWQA 4B3JA 4M87A 4YYZA 4PN3A 3JQCA 3WIEA 1C0LA 4Y8VA 2Y05A 1Z7EA 1X0VA 5EESA 2VYND 4IDDA 3RJ5A 2FR0A 5L53A 4UUOA 1VSVA 4IS3A 4IM7A 5JBIA 1QRRA 3ANMA 1V8BA 2W90A 5EIOA 3N7UA 3F1LA 3JQAA 4JCOA 1SCUA 1VJTA 1ZK1A 2HU2A 4JNKA 4U6QA 3WSVA 5TIIA 1VI2A 3H65A 1EVZA 3PHIA 4HV4A 4WOJA 5IDYA 1YJ8A 3RUAA 1DBVO 2VHVA 2EXXA 2HKIA 2UV8A 3D3EA 1H6BA 5EN4A 2ZYDA 3QVXA 2D5CA 5FWNA 3WWZA 2B83A 3DZJA 4QO7A 1Y8RB 1PZHA 3B70A 3HWRA 3ONFA 4DLBA 3HADA 1H6CA 3F5SA 1HDCA 4MDHA 2DKNA 3ZWOA 3QRWA 4CQMA 3JD1A 2P9EA 1DIHA 2C5AA 3FBGA 3HQ4O 3AI2A 3VZRA 2OOSA 5DULA 2GNAA 1DLIA 1U4OA 3AY3A 1W6UA 3E6AA 4BO4A 3D3WB 2BLLA 4B7XA 4DRYA 1DC4A 2OZPA 3KV3O 3RBXA 5GMOA 3PDUA 3NT5A 2HRZA 1I01A 4W9NC 2V6GA 3A28A 4XB2A 4MO2A 4YAGA 3GLQA 2PKRA 4R5MA 1ZFNA 3OIFA 4NNJA 1PL8A 1GQYA 4E6PA 5CFZA 3PIIA 4DPMA 3ZH2A 2RH8A 1N9GB 1B16A 3GA0A 2V6FA 3V2GA 3IIEA 3D3WA 4ROSA 3SC6A 3KYDA 1N8KA 3DAFA 1FDTA 4IMRA 4IQ8A 4WNCA 4CMGA 5A5EA 4XJSA 3H2ZA 1IB6A 4IDCA 4N18A 5JO0A 4E3ZA 4FJ0A 4CV1A 2X23A 3OMLA 1CIVA 1ADGA 4DL9A 5IG2A 3IOYA 3KBOA 4A5OA 3NRCA 3PFFA 3EMKA 3OJ0A 1LXCA 3VH2A 5DDIP 2DQ4A 2PNFA 1T2EA 4IDBA 5H82A 3HDJA 4HXYA 1Z73A 4ZHSA 1F8FA 3M1LA 1KVUA 1VRWA 3FNHA 3DFUA 4GVXA 1LJ8A 1GUZA 2X6TA 2FMUA 1X7GA 5KWEA 1V3VA 1A9ZA 3HDQA 4EUEA 2YJZA 1P45A 1EUZA 1ID1A 1ZSNA 2GCGA 2X9GA 1C1DB 2CVZA 2HRBA 2VN8A 1GCOA 4Q9NA 3M2TA 1DC5A 3F46A 3BA1A 2PGLA 3T4XA 5DP2A 3EY4A 1EBFA 4JGBA 3H2SA 3KSZO 3DBHB 4NI5A 5JXWA 4OGWA 1N1GA 2R00C 3HB5X 5CAEA 4Z9FA 1UP6A 3I52A 4WUVA 2W98A 5ILGA 3V8BA 1A72A 4D45A 5IZCA 5IFLA 2V7PA 3K6JA 1T26A 2JL1A 2O48X 3DEYX 4OXNA 2AQHA 4EJMA 4OOEA 1B8UA 5CPFA 4Q3DA 3IC5A 4OKNA 1P0CA 5F1PA 1GL3A 2G82A 2NACA 2HO5A 1B3BA 1TT5A 2Q49A 5DNAA 5T8KC 1EMDA 1DRVA 3JD2A 4YVFA 1XEAA 1R0LA 2XPCA 4R16A 4XQGA 4BHTA 4XDZA 4DVJA 4N5NA 1HLPA 1QV7A 4CM5A 3MJSA 3GG2A 4QO8A 2C07A 3Q1LA 3SVTA 2IXAA 1XGKA 3GMDA 4IZHA 3RROA 2Y99A 4JLWA 1FDVA 5JCXA 5JAIA 1FDWA 4WLOA 4YQZA 3N74A 1Z45A 4GMGA 4XR4A 1R0SA 2A35A 4PGFA 4CQMD 3E9QA 5T57A 4BV8A 4URFA 1PJ4A 1HT0A 3I6QA 1ZZEA 4GGPA 3WDSA 4RF5A 1ENZA 2UYYA 3G79A 1TXGA 5JYDA 3NDIA 4E5MA 1GV0A 3QVTA 4KTTE 1MGOA 3GDFA 3M2PA 4RDIA 1ZXBA 4UEJA 3FNFA 4WLUA 1T24A 2B36A 3B6ZA 4YT8A 3L77A 2BI8A 3M6IA 3RFVA 4IXWA 4L75A 3LLVA 1ULUA 3JQBA 2VOJA 1DO8A 3PZRA 2GF2A 3CINA 3ICPA 4H7PA 3WFIA 2EKLA 2C7GA 2Y1EA 3CSDA 3KO8A 6LDHA 3T4EA 2E37A 1HF3A 2YY7A 2P4QA 3D64A 2WMDA 2VCYA 1QORA 4CQMB 5TNXA 4R3NA 2B0JA 3WQRA 1LLDA 4ND2A 3V5NA 3BHJA 1DRUA 3OFSA 1BTOA 3JQBC 4DQUA 2RHRA 4W99A 1I32A 1T2CA 4B4OA 4J1TA 4BMVA 2HMWA 3F6YA 4BNUA 1E3SA 2G76A 5DF1A 3H9QA 2A92A 3B1JA 3H4VA 4CLRB 4DC1A 2PZKA 5F1OA 4MKRA 2W2KA 4BO2A 2PK3A 3VHRA 5BSGA 3AM3A 1EUCA 2WJPA 5HWSA 2Y1FA 4EJ6A 4R41A 4CM1A 2NU9A 4NFYA 4D7AA 4BNYA 1GFSA 1KVQA 2HJRA 4YJFA 3EGOA 5DBIA 3PWZA 1SOVA 3ZWAA 1DOHA 1B14A 4DTIA 3JQGA 2UUOA 1F0YA 4BNLA 3C8MA 3GN2A 4XX0A 2AG5A 1S6YA 2GN8A 3ZV3A 5A05A 4DC0A 5L4SA 1I8TA 4TQGA 3RBVA 5DZSA 1Y8RA 3SLKA 2DPGA 2PD6A 2QW8A 4TZKA 1IY8A 2Q45A 2HK8A 5ER9A 1U9JA 3AJRA 2B5VA 1ISMA 4A73A 5EMHA 2I6TA 4IXTA 2AEMA 2VTDA 3R6DA 3ZW8A 3JD0A 1H0KA 4LSWA 2OXIA 4E0BA 3ENKA 5GY7A 5HS6A 4BV9A 5I7VA 5DBFA 1XHLA 4KZPA 4XR9A 4J7CA 1MC5A 4YDRA 1M67A 5BQFA 3KOUA 3PEFA 3HE3A 5FI3A 1AXEA 1DHRA 1O0SA 1MG0A 1YBVA 3ORFA 4RVSA 1GCUA 4KWHA 3ZWWA 5L7TA 1JWAB 2CDBA 1YBAA 5DN9A 2IDZA 1Y7TA 1SZJG 4PLCA 1P1RA 2AE1A 1KC3A 1W73A 4UEKA 4S1VA 1KC1A 1MFZA 4CM8B 4E2WA 4IDGA 3ZU2A 3S2GA 2NSDA 5JC1A 3W6ZA 5G0SA 3MZ0A 3JQ8B 4M8SA 4ND1A 3U5TA 3DAPA 4W7IA 3FNEA 5A9RA 4PLGA 4YAKA 3GAFA 4I9UA 4NFHA 3RC1A 3U9LA 1ZSYA 3QVSA 1T2AA 4GVLA 3TRIA 1M76A 4HFMA 3ZNNA 4J3FA 3JD4A 1HE3A 3RU9A 1R0KA 1B26A 1E3IA 3FI9A 3G49A 3OJOA 4F46A 2DT5A 1UZNA 4E2ZA 4FPXA 4BO6A 1ULSA 1LRLA 4EI2A 4Q3NA 3OA2A 1KEWA 3BHIA 3ROKA 1JWBB 4AJNA 2ILTA 1UAGA 3RUIA 4I5DA 2BH9A 1LEHA 2EF1A 5EERA 3ANNA 2H5LA 4M54A 4RZIA 1ONNA 3UICA 1XQ6A 2GLXA 2HDHA 5I7SA 1WMBA 2DBZA 2Y1CA 3GVXA 5IJZA 4HP8A 2ZTLA 3DBRB 1C3VA 4CLOB 5F1KA 3WQQA 1ZK4A 5ITVA 4FFOA 1I2ZA 1AHIA 1PL7A 2QYSA 3C1OA 4E5NA 2JAPA 2ZYAA 3S2IA 2FR8A 3W8EA 4DA9A 4RCVA 3EZYA 3ZV4A 4ZGWA 3I83A 3DZGA 3R3JA 2W2LA 2WD8A 3EZLA 4XGIA 4DPKA 3O03A 2FP4A 3RCBA 3I23A 1NHWA 1Q7BA 1ZCJA 1NQOA 2DM6A 3ETGA 4R68A 3V1YA 2OL4A 2OORA 1YO6A 5HBRA 3SJ7A 2O3JA 2JCVA 1D1TA 1ONPA 1JLLA 3B1FA 3TL3A 4ITUA 5KKAA 5TF4A 1LNQA 4AL4A 4FFNA 3LF1A 4C7KA 2CNBA 1X7DA 1NQTA 4D43A 1GADO 1SPXA 1YKFA 4AJJA 3CXRA 4OAQA 2J5QA 3ON5A 4NBRA 3TOXA 4RVGA 2AXQA 1NVMB 2HMSA 4M89A 2DLDA 3WGGA 3MWDB 4CM9A 2VZ9A 3DR3A 4BGVA 3WJ7A 1Q1NA 5ER6A 4ZQEA 1M2WA 4TWRA 5DP1A 1EVYA 5TC4A 1NHGA 3VZSA 1W4ZA 3I5MA 3ZV5A 1XQ1A 2WYWA 4TSKA 3COSA 5B4UA 1Q0HA 2XOXA 4HFRA 3WR5A 1CEQA 3H9EO 4L8VA 5TQVA 1ADFA 1PX0A 2C2XA 3W8DA 2GN6A 4P22A 5A02A 3Q2IA 2EP5A 3F47A 4BS9A 3U4DA 3BMOB 3BTOA 1KERA 3Q9NA 5BR7A 4FC6A 5L95A 1G0OA 1PJCA 1UP7A 2C29D 5A4DA 5C7IO 4XYMA 2RCYA 3FF4A 1QYXA 2DFDA 2D2IA 2C5EA 1FF9A 4AVYA 1J4AA 5TJ9A 2VQ3A 5JPIA 5TSDA 3JQDA 5G2OA 3U4HA 1PZFA 3E8XA 5TLSA 2RH4A 3NUGA 2NQ8A 1FDUA 2P68A 4FGSA 4RVHA 5T67A 3ANLA 1KBZA 4CM4B 3PLRA 3RC9A 1BDBA 5JW6A 4II3A 3SEFA 4BKPA 4DLLA 1A71A 1UXHA 3GRPA 5JYEA 4E31A 3DTTA 1PTJA 3BXXA 1PQPA 2GN4A 4CQLB 4BGIA 1GEGA 1RM5A 2QZ9A 3QVWA 4KUHA 1QKIA 2X9NA 4HFJA 3NAQA 4GPD1 3GEMA 4CLXA 3LT1A 4JQCA 1KEUA 1V3UA 3LK7A 4BB6A 1FMCA 2VNSA 2Q1WA 4KMSA 3EAGA 1OOEA 4PLVA 1EK5A 1BW9B 2FRDA 1M75A 4A2CA 2JFGA 5U9CA 3C7CB 1BGVA 4J4TA 1MLDA 1SEPA 2YYYA 3UF0A 1IPEA 3H8VA 3EVNA 1SB8A 3UW3A 2IXBA 3W4JA 2OP0A 3QY9A 5IN5A 2EJVA 4IIVA 4DREA 1YH3A 4R1UA 3O8QB 2J3HA 1E0DA 1H2BA 3FPCA 5CDYA 5L3ZA 2OP1A 4M1QA 4Z0TA 3RUDA 3IQDB 2O4CA 3H5AA 1UP4A 2D0IA 1KY5A 1YDWA 3GPIA 3VPFA 2B37A 2ZIZA 4DQXA 1PR3A 2FSVA 4Q3EA 2YDXA 1E5LA 1QYVA 3HN7A 3A4VA 2Y67A 1MXHA 1ISHA 5EL0A 3AWDA 3WICA 2YHUA 3DTYA 1NQ5A 5CDSA 3WGHA 2ZATA 1U1IA 3NJ8A 4DLAA 3HHPA 4BNHA 4QFCA 1Q0QA 1U2GA 2GZ3A 1EFKA 3RASA 4TRNA 2O4UX 3JQ9A 1E3EA 3GZNB 5C3MA 1XLTA 1B3RA 3DHEA 1VE9A 4KQXA 2HK9A 3DB2A 3L9XA 4OSPA 3WMWA 1UXGA 1SB9A 2OGUA 3RD5A 1NNUA 8ADHA 3N58A 5C37A 3H3FA 4P4GA 1UR5A 2Q4EA 4CM7A 4NBWA 3CZMA 3GVIA 4YJHA 4BO1A 3GOHA 3IUSA 4XEHA 4IY1A 1XWFA 3NGLA 4BNMA 5GZ1A 5KNLA 4K9DA 1BSVA 4I8XA 3TZQA 3UFXA 3P19A 3BTVA 1VL8A 1YL5A 4UEOA 4IJUA 4WOKA 3GEDA 4U7WA 4LW8A 2QX7A 1E77A 2QYTA 4HY3A 5TX7A 3RSHA 4UAGA 1AGNA 2I76A 3TWOA 1H6DA 3E9NA 3DHNA 4E5KA 3UCFA 2LDXA 2NV6A 3ROPA 5EINA 3WFJA 1RM4A 4AJEA 1QMGA 1UXIA 5AXAA 3FHLA 1KETA 5I8WA 5KIAA 4FGWA 3NJ4A 1K6JA 2X22A 1M6WA 1ARZA 4CR7A 4E30A 3OP4A 3O9ZA 5H81A 4KUGA 4BNNA 4XRRA 4NJMB 4Z0HO 2DBQA 1WMAA 4GSLA 5AQ1A 3TN7A 1DXYA 3E03A 3QP9A 1EVJA 2GDZA 4FFPA 3GDOA 3K96A 3PHJA 1YOVA 4YT4A 4IDEA 4XGKA 4ZQGA 1VPDA 3PFWO 4PG5A 9LDBA 3NTOA 1BMDA 4LVUA 1RYDA 2I99A 4DBVO 4EDFA 3WMXA 1HDZA 2Y1DA 1WPQA 2CDCA 2PH5A 1X0XA 1I3MA 2NU7A 5FF9A 2JCYA 1NBOA 2H9IA 5CHEA 4Z6KA 4IJKA 2O50A 3HDHA 4BNIA 4YT2A 1RYEA 3GN1A 4KQWA 3TOZA 2QZZA 2PD3A 5JAZA 3UCXA 3KLPX 1ISGA 4MVJP 4DXHA 3JQ8A 1TB4A 1LI4A 1HDGO 2X4GA 5I7FA 3K8ZA 3BAZA 5ES3A 1J6UA 1KS9A 4OQZA 3OIGA 5L40A 4HBGA 2I3GA 3OEYA 1I24A 4FJ1A 2Z1NA 5LDGA 3RUFA 3WLFA 1QYCA 2NVBA 2DUWA 2Y93A 3AUAA 4DIBA 1N7HA 4DIOA 5L45A 1GUYA 3KTDA 5KJ6A 3WGTA 3GGGA 1QYDA 3GGPA 3JYNA 1PU2A 1TEHA 1U28A 4EITA 1NYTA 3VKVA 1DIGA 4OMUA 1LBEA 4KUEA 4GX0A 3OBBA 2D3TA 2EERA 2NVUB 4YTEA 2NNLD 1B0AA 4FFLA 4MVJD 2HMVA 5JCJA 1LRJA 3KM0A 4J91A 5IN4A 5AVOA 3EUWA 3JQEA 4BNWA 3GVHA 3NX4A 1GYRA 2V6BA 3FWNA 4E33A 1PZGA 4ONEA 4XCVA 2EIHA 3BTSA 1LU9A 4MIEA 2UAGA 3CEAA 3AFMA 3KEOA 1B7GO 1GPDG 4RVDA 4CMEA 1LRKA 3VPHA 1IUKA 2BKAA 1LDGA 3AUTA 1H93A 4ZQHA 3INTA 4XYBA 1PS9A 2GGSA 4JP2A 5COBA 4RZHA 3ONDA 2Y0DA 2ZTVA 3DZBA 1H9AA 4XWYA 3SX2A 3ZWYA 4UULA 3ST7A 3L6DA 1BXGA 1HETA 3ZHXA 1E1KA 4IDFA 1UUFA 2GERA 3U62A 3WYEA 4EUHA 2CSUA 4RGBA 2O2YA 2RBEA 1E7WA 3DONA 3HFGA 5L4LA 4R3WA 5KVVA 1ZH8A 1Y9AA 2GRAA 3IDSA 1HSOA 2HUNA 2Z95A 4J0EA 4TRRA 4GX1A 3WJAA 3TZCA 2X5OA 1ISIA 3IL2A 3PI7A 1XYGA 4B4UA 2AE2A 1DC6A 4FSHA 4NMHA 4WCFB 1E92A 2P4HX 4NHEA 5KJCA 4C4OA 1DB3A 2FY8A 2C54A 1GYPA 4OH1A 3I4CA 3AY6A 4FOOA 1L7EA 1PWZA 1ZVMA 4CJXA 4E2XA 3E82A 3G1TA 5ADHA 3PJEA 2QG4A 4DIFA 4P8RA 2OBNA 3V2UA 1HYEA 2WM3A 1WNTA 4AJOA 1O95A 1XDWA 1A5ZA 3KYBA 3A14A 3RVDA 3K2BA 4UVHA 1X7HA 2PY6A 1EQ2A 1I33A 2QIOA 4MINA 4YRAA 2AHRA 4PLPA 4IGFA 4E32A 1SNYA 3NT4A 4RDHA 4KOAA 1LQUA 5G0WA 5F5LA 3WGQA 3PPIA 2FN7A 3I4FA 4OXYA 1Z6ZA 4UVIA 3WBFA 4YT5A 4BQPA 2IZ0A 4FDAA 5JNLA 3K2EA 3KSDO 4RPKA 4UUNA 3LC2O 4XIYA 4ZICA 4ALNA 5ITWA 1L7DA 1N7GA 3NEPX 4WCFC 4C7JA 3VC7A 5G0UA 5K0ZA 1I0ZA 3I1JA 5H83A 4BGUA 4J90A 4U6SA 3OQBA 4Q3AA 1CERA 1JQBA 1LLQA 1JAYA 4PG7A 1BDMA 5K6AA 1DIBA 1WWKA 5L51A 3ZV6A 5TT1A 1E7SA 1F8GA 4BOYA 4CLDA 5C7OO 2F00A 4BNXA 8LDHA 3TSCA 3PGXA 2P2SA 1YQDA 3JQ7B 2HMUA 1H5QA 2NADA 4LK3A 3OJEA 1Y5MA 1CJCA 4L0QA 1E6UA 4GAEA 4CM3A 5FI5A 3OQ1A 4MIOA 5DOVA 4CLHA 4D3DA 1TI7A 2QHXA 1ZEJA 2A4KA 3OECA 2GUGA 3LLSA 4B3IA 1GD1O 1DIRA 1T4BA 3BMQB 3KHUA 3TJRA 4BL5A 5BSHA 2NUAA 2WD7A 3LU1A 3EC7A 1CETA 4II2A 4Z3KA 4YXFA 2WTBA 1YL7A 4I5EA 1IZ9A 5CP8A 1E5QA 2B4QA 1MA0A 3GPDG 1YS4A 4EEZA 3ITKA 3H9GA 3DBHA 2JAHA 4P4LA 5LDHA 3NKLA 4D44A 1F14A 4XDYA 3H6KA 4CL8A 3ETDA 3QW2A 1PJ3A 1R12A 3MOIA 3OEWA 5DT9A 4EGFA 4HWKA 3AK4A 2FPPA 3GRKA 4ZU3A 1AN9A 4J9UE 4MP6A 4RL6A 1ISFA 2JFFA 3KVOA 2J3KA 3NYWA 3AW9A 1P3DA 4JP3A 2CZCA 1I2CA 3U3XA 4A10A 3I3OA 4W9NA 1NWHA 3X2FA 4W82A 3RUCA 4OYRA 4BNVA 4E21A 2FPIA 5F3RA 5T64A 5JAQA 3IJRA 2B5WA 4RO0A 1KOLA 3MJVA 3ENNA 4J7XA 1ENOA 3DOOA 2G0TA 4NFSA 4J1QA 3TZKA 1EEHA 3H9JA 4MP3A 3VZPA 1P0FA 4YPOA 4QEDA 4J49A 1LDEA 1IHXA 1HTBA 1HEUA 1HE5A 2GYYA 2PD4A 4ZQFA 2J8ZA 4R1TA 2I5PO 3CIFA 3JYOA 4RF3A 3TL2A 1UH5A 1LX6A 4GLOA 4MVJF 2OMEA 1WDKA 3NTRA 1T4DA 2B69A 1Q7GA 5BNFA 5T6BA 5L7WA 2GPTA 2GZ1A 3LDHA 4CM8A 1JDJA 5JS6A 2Q1TA 5EJ2A 1HE4A 4ZD6A 5B37A 2R00A 4TKLA 3CZRA 4AJKA 1PGNA 3BMQA 1ZIDA 1U7TA 3LC1O 2OHXA 3CE6A 4AJHA 3JQ6A 2YQ4A 1FK8A 3ROMA 3ZHZA 1JVBA 1E6EA 3SBOA 2Q1UA 3E1KA 4I1IA 4MVJE 1P77A 3C7DB 3BMNB 4K1LA 4YB8A 1ZXLA 1QP8A 3OETA 3LT0A 3RFTA 3PGJA 1A27A 1QV6A 4PCVA 5THQA 2CD9A 3DMTC 4CODB 4L9RA 3DMTA 2ZB4A 3FR8A 1JVSA 4O59O 1O89A 4BNKA 4DGSA 5JFOA 4GWGA 4JXKA 3SJUA 1WVGA 3KLMX 4P4NA 1ZKMA 1PSDA 4BB5A 3WNVA 4FBGA 2V6MA 4BUCA 1GAEO 2TMDA 2C7VA 5HRUA 2PA3A 1IE3A 3MTJA 1MC4A 2CUKA 4L4SA 3WGYA 4ND3A 1LSOA 4B3HA 5EQDA 3FTPA 3ZW9A 3JYLA 4BGEA 3HUDA 4R69A 3DZHA 1P1HA 4K28A 2WSBA 1QG6A 3QV1A 5A1TA 4I5FA 2NTNA 1N1EA 4Q3CA 3HJAA 2DFVA 2VHYA 2V65A 2BFAA 4MVJM 1C1XA 1E7QA 4MJLA 2W2KB 3V2HA 3U49A 4MVJG 1ENYA 3L07A 4TKMA 2B4RO 3INRA 4WECA 5A03A 4B79A 4KP7A 3BZUA 1U3VA 3IUPA 4GGOA 5FYDA 4OOFA 4BO3A 5B4VA 3QA9A 1HDXA 4FIZA 4RLHA 3RFXA 2NWQA 3RAJA 3B1KA 1GV1A 3W1VA 4R5HA 3WOHA 2YFQA 4XGNA 1NQAO 4R51A 1EQUA 2CVQA 1LDYA 2ZCVA 3JSAA 1ZJYA 3WXBA 3HNPA 3NDRA 4PZDA 2YHIB 5T8KA 1Y8QA 2JJYA 4OSOA 1IOLA 2A9FA 3WLEA 4IS2A 1SO8A 2H1SA 4YQYA 5KTKA 3FRJA 4OIMA 3NGXA 4LN1A 1NTOA 4W7HA 1E3WB 3PJDA 3SLGA 4J7UA 2J6IA 3WS7A 3ADOA 3AM4A 3IJPA 4MIYA 3WGZA 4QECA 3RJ9A 4BNGA 1MV8A 4DMLA 5IZCC 4Z3DA 3ZWBA 3PTZA 3I9OA 4JN6B 5J23A 3WTCA 3UN1A 1T1RA 3BTUA 4MOWA 1DRWA 4PLZA 4QQRA 2I67A 2VZ8A 1GU7A 3ZGYA 2PZJA 5MDHA 5JSFA 1DFGA 3QHAA 4GX5A 1P44A 1XU7A 1NR7A 1PIWA 4J6FA 4RQTA 1HWYA 1NPYA 4RVFA 2XF8A 1YB5A 3ADPA 3JQ7A 2YZ7A 5JDIC 2WD7B 4B7CA 2X8LA 4ZRNA 4YJGA 3PZBA 4QFDA 3RQSA 3TPCA 5JDCA 2Y68A 1JKIA 1A4UA 1QLHA 1DHTA 3ZNOA 4DYDA 1LTHR 3E48A 1P1JA 4TZTA 3LT2A 4ILKA 3KSUA 3NV9A 2C0CA 1JW9B 2VRCD 1VM6A 4IMPA 1LLUA 2PV7A 5I9NA 3QWIA 4GX2A 4IJVA 3VKUA 3CH6A 2ZB8A 2BF7A 3MCVA 2HAEA 1QLJA 3WGOA 1KEPA 3DAGA 1YWGO 1GR0A 1MB4A 5IDXA 1GQQA 1V9LA 4JBGA 4HKTA 2YV3A 3VPXA 4FB5A 3L4BA 2IEBA 3D0OA 4I08A 3DZFA 3KXDA 4BQRA 2PZMA 3GUYA 3QJ5A 4RPJA 3MTGA 4WGGA 4IJWA 4WPGA 3GHHA 1A7KA 3H3JA 1PL6A 1PGPA 3S8MA 1E6WA 1F12A 3RKUA 3CUKA 1NVGA 1PS0A 3MEQA 2E48A 1C0IA 5KJ1A 1Y81A 2ZTUA 1QSGA 1GYQA 1HZJA 1P1IA 4CMCA 3WG9A 2VT2A 1M66A 3OSUA 3G1UA 4ALMA 2P5UA 5L4NA 4Y98A 1L1FA 4RPHA 4HNGA 1I5RA 3GZNA 3F9IA 1WXDA 4JBIA 4ZJUA 2E6UX 1LSSA 1VKNA 1WW8A 2YQ5A 5A04A 5IF3A 1BXKA 4E12A 4KDEA 4N7RA 1G6KA 2TMGA 2DVMA 2BHLA 3JYPA 4CUJA 2H63A 4WLNA 1I3KA 1PGQA 1YGYA 3RI3A 3AM5A 1LDMA 3JYQA 3C1AA 4L4XA 1A4IA 3JQGB 5L7YA 4CUKA 3EK2A 3S55A 4OM8A 1NAHA 1U2DA 3AI1A 1P1KA 5CDTA 4ALIA 4ZRMA 1PZEA 3KYCB 1IULA 4RLSA 2NU8A 5KVCA 1PQWA 4TRJA 3K30A 2D4AA 2I65A 1KEVA 1LC0A 2YDYA 1MFPA 1UDBA 1R16A 2AQIA 3F4LA 5COQA 3AFNA 3D4PA 4QUKA 1NXQA 2O7SA 4GBJA 2BGLA 4JJGA 4CMJA 4J1NA 5K9ZA 4ND4A 2P5YA 4XQCA 2FPGA 4R1SA 3UAGA 1ORRA 1V0JA 1MUUA 4WEQA 4WKGA 5BNIA 1U8XX 3C7AA 4N5MA 4XYLA 4NBVA 4FD3A 4A7PA 1E7YA 3WSWA 3AOEA 4WCFA 4D42A 3PDJA 3WTBA 5L9AA 3FD8A 1QXSA 3ASVA 4O6VA 3PWSA 3WQSB 4W4TA 1B8PA 5DBGA 1E3JA 1UZMA 3RIHA 5IXSA 3JQAB 3H5RA 2IODA 3T7EA 3O8QA 1R4MA 1ZK0A 1XIVA 2CFCA 5JLAA 1AUPA 1S7CA 1K89A 2NU6A 1K0UA 1RM3A 1DLJA 2C59A 4Z9XA 1P74A 3QWAA 3L6EA 3UXYA 3PVZA 2ZCUA 1N92A 4YWJA 1P1FA 2HLPA 1HDRA 1IHYA 2HJSA 2BD0A 2GZ2A 1VKOA 2YFHA 3DL2A 2W8ZA 5HS4A 2UVDA 4E5YA 2BGMA 2E49A 4LMPA 4NZ9A 3VPSA 4L73A 4GH5A 4U5QA 3BMCA 3GZ4A 3VDQA 2R2GA 2PTGA 3AUSA 4OKIA 4BNFA 1H94A 2Y1GA 3QWHA 5KCZA 1I10A 4HX5A 4J2OA 4RF2A 1GZ3A 3AU8A 2DC1A 3Q2KA 1OAAA 4ALKA 2X5KO 2NTVA 3F1KA 5TJHA 5CPBA 4IGEA 3ZWNA 2FSSA 3DZKA 4F6LA 4INAA 4Y67A 2DTEA 2E4AA 2X0IA 3R1IA 1R4NB 2RIRA 3ZHBA 1X14A 5AXCA 1EUDA 1PEDA 1Z75A 4UREA 2AQ8A 2W2LD 2IYOA 4FN4A 4O63O 3PQDA 1KVTA 3CMMA 1DDOA 4WNIA 2J5RA 3KRTA 3IKVA 2VWHA 3H7AA 2GN9A 3RWBA 1KY4A 3DBLB 3VPGA 4ALJA 4E13A 3IMFA 5TT0A 3BMNA 1EDZA 1LA2A 1U3TA 4WK6A 3TF5A 1XR3A 3LSYA 5HM8A 3AY7A 4YAIA 2C2YA 5A06A 5JCJD 4HNHA 2D1YA 5FEUA 4MVJA 1PR9A 4GL4A 2DBRA 4JIGA 3I9NA 1DJNA 2SCUA 1F06A 3DBLA 4AJPA 2NTJA 1XCBA 1DEHA 1C1DA 4H16A 4RPGA 4E5PA 2CDAA 2PLAA 1O8CA 4NBTA 4BMSA 1F17A 3ZWVA 1YQGA 1R4NA 4E2YA 4PLFA 1U3UA 5AXDA 3I9KA 2VWGA 1A9YA 1U3WA 1EZ4A 5B12A 4DPLA 3TNLA 3VTFA 1JA9A 1P33A 1H9BA 2IE0A 3RUEA 1LDBA 3I6IA 2UDPA 3W8FA 1NWCA 4J4BA 4XB1A 1OC4A 3GK3A 1WZIA 1VSUA 3PRJA 2AQKA 1KVRA 4NR0A 3OH8A 2F1KA 1EE2A 1ISJA 4QT0A 5ENDA 3DOJA 1CF2O 2PFGA 4JX8A 4QXMA 2IZZA 2O3TA 3T7CA 3VAZA 1EBUA 1WDLA 4WLFA 2GD1O 4FR5A 3F4BA 4FC7A 2VWPA 1C1XB 4YAJA 3DBVO 3GDGA 4J2HA 4MVJH 3RC2A 5DCUA 4OHUA 1ZO8A 1R4MB 3UVEA 4Y6SA 1IYZA 3P2OA 5KJFA 5DOZA 2Q3EA 2JHGA 3E5MA 3GT0A 1PQUA 4PVCA 3IP3A 1XELA 1D8AA 3GNSA 2VZ0A 3PWKA 5LC1A 3LZ6A 1HYGA 4M86A 1PJBA 2VOEA 3DO5A 2ZKLA 3BIOA 4XIJA 1ONOA 4IQGA 7MDHA 3VZQA 4CQLA 1M6HA 1Q2XA 1VL0A 4YBZA 4NJOA 3G3EA 4IUYA 3RU7A 3GFBA 1JKJA 3PYXA 3UHAA 4XD2A 1SOWA 3K9QO 4LMRA 3P7MA 4PLYA 3DHYA 4ND5A 4R1NA 1Y1PA 2DAPA 1J49A 2Q46A 2VT3A 4E4YA 3PJGA 1G0NA 4J0FA 1WLYA 3UOGA 4EYEA 2LDBA 1PJSA 3OF2A 1KVSA 3TZHA 4YA6A 2J3IA 4LGVA 4RQUA 3VVCA 4NK5A 4O1MA 3KYCA 4BMNA 1CQIA 4OL9A 4BNJA 1WZEA 3JQ9C 2NLOA 2FR1A
chains in the Genus database with same CATH superfamily
4QSMA 4ENQA 3AR8A 2CL5A 3EIXA 3QLVC 2OBBA 5T41A 3UGQA 1B43A 1UMKA 1A9QA 2TYSB 5CB4B 1GG9A 1OT3A 4AUKA 1B8OA 2OZLA 3CPSA 3FWZA 3P5SA 1NBHA 3PDHA 4I50B 2B1IA 1U7HA 2A2ZA 1QV9A 3JR3A 5KC9A 2HSGA 3L82B 3VHLB 3SXUB 1Y8CA 4QLBA 5JJBA 3FOFC 2ZUFA 3DV9A 4YACA 8MHTA 4BFWA 2P41A 5CYOA 2ORVA 2SNIE 4JVNA 3U56A 1YOVB 4K9NA 3A10A 1SVLA 4JYMA 4YJ3F 5JVDF 1U5BA 3TSAA 1YQ9A 1X1EA 4EBBA 3H5VA 4Q1EA 1DAOA 4KXNA 1A3CA 3F0TA 4EBFA 2Q6OA 3DZIA 4FDLA 3G85A 1XTKA 1C7IA 3V1KA 1T2UA 1MP0A 5KOYA 4HVAA 2R6JA 5H8WA 3KPVA 1QFSA 2CHUA 2ESRA 2EGGA 3B5IA 2FHSA 3PQ2A 2P6PA 3LCUA 2ZE6A 4J1TC 4AJIA 3EVZA 4CL0A 1CZKA 1OI3A 5AICA 5FEMA 1QQ6A 5CBPB 5C1OA 1VKJA 3Q3CA 1V37A 2GEBA 4G41A 2XTNA 1QDEA 4MUMA 5I4CA 1Z3CA 4G0NA 4PZ9A 4QL3A 4WKOA 4EJFA 2D54A 5DHRA 3ICCA 3U9SA 4AS3A 1GQOA 4UBJA 3CKYA 1UM9B 4XKJA 3SBXA 2I4LA 4CUZA 4E03A 3T6KA 1E1LA 3LTEA 3OO0A 4Z5XA 1G98A 2W6CX 2G5GX 5EKSA 2JH3A 4UNNA 2FN8A 4OQEA 5KTTA 4R9SA 4CV2A 3WRXA 3E9MA 3U6KA 2JCGA 3BFJA 1L8LA 4DEXA 2PMFA 2RGGA 3PFBA 3T7DA 1OLOA 2ZRNA 3I45A 5IVKA 4A36A 1SWWA 1U1EA 3O3NB 4YMWA 3H97A 4IO1A 2Q1SA 3WE7A 1IJFA 2X41A 4CMEC 4PRLA 5I5EA 4BVHA 4FCTA 1W0CA 3K3PA 4YO7A 2C57A 4E09A 4MVJI 2WWYA 2HBRA 4DYVA 2BFCB 1L4MA 1Z2DA 3E5NA 1XZEA 3QLVA 2O8FA 1FBNA 3LF2A 3MBOA 1KU0A 3TLGB 3WX0A 3VZBA 4AJLA 4DOMA 4EZBA 4WVFA 2FE1A 3CB2A 1D3AA 1HZZA 3VH1A 5ICSA 3AR9A 1A9PA 4G63A 2WU8A 2Y0EA 2P8JA 3C3WA 3UK7A 5JOQA 5B1YA 4ZOEA 2XB4A 2EW8A 2IYAA 4H6VA 4Q3BA 5CH3A 5T3UA 4DW8A 2YHAA 4EI8A 2ZSUA 3VNUA 3TZEA 1VSBA 2EKQA 3CLVA 4OHOA 2PQMA 4NBUA 3SE7A 1M0TA 2A9OA 1P2DA 3FXAA 1NP7A 3AV0B 2Q5CA 3L0DA 1A69A 1PYGA 4FQ7A 3HKBA 2R4TA 4H1UA 1GPYA 1N2JA 2OC9A 1YS1X 1Y7PA 3DV0A 2V1XA 4TVSA 1K7YA 1AQYA 1W5TA 2OO5A 4MV3A 4UDNA 4PR3A 1C0PA 1Y48E 2AXPA 3ZNQA 4LKRA 1BH2A 1RJDA 1J22A 2Z1MA 1BQEA 1O95D 5F4BA 3V1MA 4FFSA 1FDOA 3SZOA 1P73A 1Y3BE 4R9NA 1KP3A 1X13A 4ESHA 5F9HA 4URWR 3CE9A 1N1DA 4I1SA 1I94B 2BGUA 3S29A 4FMCF 1G7RA 3AJDA 3JVDA 4L15A 5ISMA 1GTVA 1GZ6A 5LXTF 3ODPA 1PD1A 2W0MA 3UKOA 1RXVA 4KO2S 2C78A 2XGGA 3CPJB 4H31A 4Q82A 4AICA 4Z7JA 4EGJA 4IWYA 4KOEC 3AONB 3PYMA 5BN5A 1P7PA 3VVBA 3DLBA 1BGXT 3O8CA 4AROA 1QP7A 4E2FA 1QJCA 2FWMX 2B1RA 3AP3A 4MRPA 1SH7A 2Z9BA 5BSEA 2MSEB 1H4VB 3QXSA 1QQ5A 2ZBEA 2CVOA 3VO2A 1R4AA 2HCFA 3DBRA 2C92A 2FJPA 3H2YA 4E07A 1HC7A 4HAWA 3BWXA 5LU8A 2O06A 3K0CA 1M2OB 5HOQA 1NIJA 2ES4A 3DG9A 1CUXA 1NF9A 4Q00A 4ZT5A 1LBIA 4PYRA 5DGIA 3HUFA 3M4XA 4LRTB 3N76A 4MPPA 5BQOA 3ZG6A 5TMPA 1MAWA 3DOIA 4OMFG 3FLAA 2CJYA 3I9LA 3LOPA 3GF4A 4G5GA 4KE8A 4QYIA 2ZAOA 3ZNPA 5JXJA 4WASA 1KA9H 5EZQA 3NHSA 2IYXA 13PKA 3T3HA 1GO2A 5AWFC 4D41A 3R3YA 4MUXA 1PLJA 2BELA 3TQSA 5BWNA 1FRQA 1X1SA 3OTHA 4RA9A 5B6IA 1OH6A 3GV0A 1Q3HA 2O05A 1NKVA 4DCNA 2D1TA 1G16A 1YGPA 3IV7A 4W8HA 5AYVA 3N0TA 5TVKA 3ZEAA 1ZD9A 2EFDB 3N53A 1NXTA 1N2CE 1K63A 6YASA 4R9VA 1N9GA 3UA3A 4P5EA 3FJ1A 3BD7A 1NN3A 1XLWA 4L7VA 1QPZA 2R6CA 3AHFA 5ECWA 3ZJUA 4LFCB 4PX2A 1R50A 1TLTA 5AI5A 3WYFA 4LGMA 1U2TA 1Z35A 1P8JA 2DBYA 3GJQA 3RFFA 3TXYA 1M6YA 2BUCA 4LVNA 4CG1A 4WJZA 2NZWA 3GHYA 2YWJA 3M0EA 3ROGA 3RW9A 5I9TA 5IC6A 2QTNA 4EMTA 5IZ4A 5JH7F 5F9FA 2IEZA 4FNAA 1YVEI 3R44A 1WSAA 5F64A 3VO8A 2J0UB 5LMZA 1K6XA 2KJQA 1ZI6A 2QI9F 3L3BA 4LJ8A 2ACWA 3R40A 5BVGB 1A5AB 3UAWA 5CTAA 1TEZA 1BRMA 2BRUA 2JD0A 1MB2A 4QVKA 5D2CA 1TK3A 1F5NA 1XEXA 1YRLA 4RPCA 2W83A 2FQ1A 4TLAA 4FXOA 2VYNA 4Q12A 4UZFA 2G4VA 5KJEA 1R6XA 4OREX 4AYTA 2RI6A 3U37A 4F6CA 721PA 1QR6A 5JLJA 4PZEA 1OX4B 3RLIA 3D54D 3OZ7A 1YCGA 2IHUA 3KFLA 2APJA 1TQ4A 4JUIA 5MN4A 5CX4A 2GYWA 5FYQA 4Q47A 1CUCA 3D4NA 4YN3A 1CRWG 2I1WA 3QX3A 4N76A 4C7MA 2K7FA 2MSCB 1E79D 4G1CA 3I6YA 2DH6A 2XE6A 2XNDA 1BHO1 4WZZA 3S81A 3GLGE 2J9ZB 4DGQA 1PS8A 3E8MA 1PJZA 4MR7B 4FCVA 3N87A 5K8VA 1XD2A 2YNMA 3BOSA 2XBLA 1FTYA 1NFRA 4QWMA 4DQKA 3L4SO 1JQ5A 4MUEA 2RGEA 4ZVVA 3RKSA 1BFUA 1FUIA 4LY9A 5IM4F 4TT3A 3WLNA 4AU1A 3O8OA 4UVEA 1KYXA 2R0QC 3QWFA 2JD2A 3NTQA 4LCJA 4HUJA 4ZQBA 4A03A 4CFSA 3DT6A 1SG0A 5DLPA 4MWDA 2QK4A 3QX7A 1QHHA 1AKVA 5BWLA 5JXHA 4BLSA 4OHWA 3GXOA 1DQYA 1XRSB 3RB8A 2EBWA 5DVZA 4R1LA 1KK0A 1X9GA 3L06A 2MSLA 4OJNA 2GBCA 3C39A 4Z9YA 1F3OA 3LBYA 2G07A 1OB5A 3OPNA 2CXUA 4D96A 3JQRA 5I45A 1UPCA 3UNXA 1UBUS 3OWHA 4UARA 5DE3A 3DTNA 5CR9A 1GZHB 2AJDA 4RU1A 5CVEA 3ROZA 3PXGA 3RWOA 5MGBA 4TRMA 3I9V6 1OAOA 1Y3AA 1TM4E 1ESEA 3EEYA 3MIIA 5EKUA 4QDTA 3UOWA 4EVRA 1XWIA 2P4UA 4FDMA 1JJBA 3K8OE 4LMAA 2AB0A 2B1JA 2CL0X 2JVJA 3FA2A 1OIWA 1DMRA 2DTDA 1AXGA 4J0KA 1YSCA 4QU0A 4FS3A 3TL6A 2OAGA 2YWBA 4CN9A 4A82A 5DPMA 4MR8B 4LHZA 4ZI7F 4LZAA 1HDYA 2W2XA 3QKIA 1QC5A 1R7RA 7ABPA 3L05A 3QLJA 1EGHA 2PX3A 4CIVA 2YZNA 5HUHA 2GEKA 1T29A 2DG2A 2O8CA 1SVOA 2QAGB 3TDNA 4BLTA 2ZG6A 4DMMA 1J0BA 1UEXC 2QB5A 4MA4A 1U5CA 2OQRA 2CK3D 4IJ5A 1VDMA 4LVCA 4MKFA 5ARDA 4V2IA 4A26A 1NAIA 1EJ6A 3CX7A 1T9CA 3VR2D 4H18A 4R0VA 4J43A 2Z4SA 3IODA 2CB0A 4QASA 4EPVA 1ZGZA 2Q4BA 3AJAA 3U2QA 2ZJYA 2XMDA 3PU6A 3NDBB 1RWVA 3FDXA 2Q4RA 4V2UA 1M3SA 4XA8A 1EX7A 5JZ9A 3IAAA 4LV5B 3B2EA 4HK4A 5KAMA 3N8HA 1CYDA 1ZMOA 5EWMB 1ZUIA 3WLSA 5FL7D 3DLHA 4LMBA 3M1AA 4JGIA 1ZK2A 3SC2B 2OCPA 4MS4B 1Z8NA 4B8ZA 2QPLA 5KYTA 5HKKA 1BMFA 1ILEA 4JYBA 1HMPA 2BDEA 1RD4A 3OP1A 1A9XA 1T34A 3ZBPA 1NPTO 2O3RA 3E1GA 4JHLA 4Q21A 3L7KA 3TI7A 4AXXA 4OP2A 2YZ2A 1KMIY 4M9SA 3RODA 4YV2A 1SKMA 2JJ2D 5CEEA 5JE8A 2PX4A 3EOZA 3T9AA 1N33B 2W6JD 3BEOA 4NECA 3W79A 3M5DA 4HVCA 3UWKA 4JVOA 2QR2A 1CUJA 3R7FA 2ADOA 1NONA 3GCXA 1PUJA 1YJAA 2X0FA 3DF9A 3DDHA 1QQBA 3QQPA 2P3LA 5AHRA 1VLQA 1FLAA 4PLTA 4OB8A 4PIMA 2D7CA 3KLOA 1OHHD 2O5RA 1E1RD 2ZI6A 4P38A 5THKA 1SZCA 1QDUA 1Y82A 2GVZC 1E9EA 1LF5A 1IN5A 1CVLA 2C03A 2ID9A 4G0XA 2C9ZA 5AMXA 3TD9A 3KYDB 2PXCA 5HPYB 5F23A 3WO1A 4LK2A 5ALGA 1GZUA 1VPEA 2H29A 3FE2A 3NOOA 1EH5A 4M9RA 1XZNA 4PPFA 1XDGA 1NF2A 1SEVA 4NF2A 3N05A 3AVVA 3AVYA 4NH4A 1RZ3A 2CFRA 4GRDA 2ZQYA 5E2IA 1BXZA 4KH1A 4ASUA 1UXJA 1D4FA 4EI7A 1WSWA 2XTJA 2ZYVX 4H7IA 2GSDA 2X86A 1SXJE 3DDOA 3AF1A 2NU6B 3R2JA 4L57A 4WN9A 3RNOA 4DARA 4ZHQF 1SRQA 3V7NA 1NOJA 2PXHA 1TYDE 1IMJA 3ZIDA 1R88A 3F5QA 4J0CA 4PQEA 3SZ3A 4Q4AA 3PNMA 2E4XA 5AK4A 3ZNNA 3ZDQA 2YY6A 3GCGA 1NW6A 3R6WA 3WLOA 4GE0A 1OVGA 1BHSA 2Y27A 4W5TA 2YVLA 4QDUA 4UM5A 2CF5A 4AN1A 1EGQA 3GVCA 4GPZA 4U4AA 3QPWA 3RKRA 2WFAA 4FJ2A 2R66A 3K7EA 3NKVA 3CMCO 2ZI9A 4W6ZA 4JBHA 5DN6A 1EVKA 4K6FA 3SXJA 5KEIA 2HR1A 3SHQA 2GMWA 1QVRA 2VHQA 3S7TA 2XIJA 4WOPA 4DUGD 4PN7A 4YRBA 5BSFA 5LN1A 1KTIA 5EJ4A 4C01A 2BKLA 4A27A 1Q19A 4AJ2A 3H9UA 1Y34E 3REFA 5IAOA 1YB6A 1YZTA 2CDNA 2NW6A 3KZCA 3K2IA 4CM4A 1GG5A 2X3FA 3OKPA 2A7QA 4GMXA 1UMBA 1AS0A 1Q3TA 2QRLA 1NW3A 2VCEA 2ZWVA 4UHEA 1W19A 7ADHA 2CMDA 2IUYA 4QBGB 5BSWA 5TGZA 2GCPA 3IPLA 4O5AA 5F21A 3X0DA 3B8HA 4TUYB 3QPAA 4CM9D 4V0QA 3QEMB 1GT91 1W9MA 5AJWA 5KVAA 3KJFA 3PL1A 3NJRA 5BP7A 1VSQA 5A3VA 2FMHA 2JIBA 1K6IA 1O08A 3DDNA 4J16A 4F6RB 3PB3A 3P2IA 4FT2A 1TQHA 4IEEA 2XXBA 4IGAA 4M8LA 3B1ZA 4BLVA 4K46A 4CL3A 3C85A 1SC1A 1GPJA 2BM9A 1CY0A 2OWEA 3O4HA 4U0KA 5FORA 5J5CA 3NEYA 3PPWA 3BORA 4EEXA 4Y1RA 2BI7A 1RYZA 4MYSA 1F8UA 3RABA 4HZIA 1J1IA 1J5XA 1MG5A 2Q99A 3C3EA 3R4CA 4R7TA 1CZUA 1IMOA 2J1LA 3QTTA 4PFJA 4B47A 5A7FA 2JKZA 4YP6A 1KHHA 3VH4A 4K5QA 3R5FA 2XWQA 2ZFUA 4UEQA 1OIXA 2CHEA 4EPRA 2VJBA 1UMCA 2G17A 3UMVA 4A0SA 5KNDH 1TCCA 1KQFA 4Z53A 2X2EA 1COWD 3DOCA 3GLRA 1E1CA 2E82A 3EF1A 3ERCA 1GLNA 3MWEB 1YDEA 1TJ3A 3GAZA 3OT1A 1VLVA 3AOGA 3G8BA 3CCBA 3K9GA 4E88A 1L3BA 3L8DA 1BG6A 2HLDD 2QMOA 3AP1A 3RFCA 1FNBA 4UMVA 4DLYA 2VHZA 4EJ0A 3E70C 4DQVA 3OM9A 1K4YA 3TRKA 4JBYA 3FIUA 4TYPA 3K31A 2JLQA 3P2EA 2Z98A 2LVBA 5G4KB 1DDIA 4S3MA 5CJJA 1IG0A 4DJJA 3GLVA 1EDOA 3C8HA 3LUJA 3L79A 4L76A 4BFSA 4C4RA 1CJTC 4KO8A 5K0EA 3UK0A 1HFEL 2ATIA 4JSTA 1TF2A 2Q6LA 1X2BA 3PBKA 4G25A 3S1SA 3KQHA 2FZWA 4WBNB 1OWLA 1BKYA 1TKBA 1B6SA 5ALPA 1DKMA 3ZHSA 1LGYA 2X6QA 1UPBA 4NPCA 5CM2Z 5J2TF 4URVR 2J3EA 1B42A 1PCXA 1FP1D 2BFPA 4AP5A 3G5TA 4AY2A 4OO3A 1KMHA 2GASA 3WIDA 2ISQA 3X2EA 4YJHB 5BQ5A 4CF4A 3MBIA 1NLFA 4K2HA 3PXXA 1LPBB 1L4HA 2C8KA 3QPCA 4ED9A 1AHHA 1T8TA 1Y7LA 2JD1A 1Q16A 1QG2A 3DOHA 4FHEA 4QOFA 2VL7A 4CMIB 4R1PA 2RG7A 3KOOA 4CU2A 3WQHA 2ACEA 3RJTA 5FL7A 4EDHA 1RXCA 1APBA 3I76A 4WACA 2J0SA 1UAAA 3K0CC 2C2HA 4A92A 2FK7A 2D7JA 1ADCA 1CIPA 4ABTA 4MYTA 1ZR4A 3ZU3A 1YRAA 3F67A 1E9BA 4RMHA 2H5EA 1J56A 2RHGB 4RADA 5JCOC 1QRUA 4UTXA 4NE2A 3ZLAA 2WSSD 3SSMA 3QU7A 5K6AC 4DY4A 3MJ4A 4LBWA 1W2HA 2PXAA 3TW4A 2HQ1A 1DAFA 4M21A 3ZJ4A 3BIJA 4DIMA 4ZZ1A 2FVYA 5GZ6A 1PDVA 2VG8A 3ETEA 3U09A 3UH0A 2BT4A 3HJFA 2IHNA 3GFVA 1V35A 2R6DA 4BFUA 4GQIA 3EDCA 4A0QA 4E51A 3AOEC 1J9ZA 1UFVA 3K94A 1ETUA 4RHXA 1J5PA 5AQEA 1R27A 3HYLA 1FDSA 4JA0A 1NOIA 1PUXA 1R74A 1E94E 1UJ6A 3HLKA 4LJLA 5E7MA 2GM3A 1MHTA 1OLUA 2A1UB 2QZSA 1H3FA 4H3VA 1YL6A 2OFPA 2VYVA 1L1RA 1B00A 5F2KA 3T3DA 3TZLA 5H0IA 1G3UA 1BW9A 4MS1B 4Q6BA 3ZKAA 4E14A 3WI7A 2P9HA 5AVKA 1YZGA 4PYKA 2W0SA 5I9MA 5A9SB 2JLXA 5I4IA 4WESA 1ZIXA 5HM6A 3QWBA 1FW8A 2OE2A 4B6QA 3LVBA 1KSFX 3THSA 3FTNA 3QOFA 3S2EA 2IF2A 1YB1A 3LBFA 1C0EA 2AZXA 3F7TA 5HDBB 1ZIPA 1E1NA 1FJHA 1HKUA 3HMQA 1P4HA 4KWIA 3QHQA 2PUVA 2IXFA 1KQPA 4KFCA 4OX9B 2YN2A 1V16B 1EXWA 1SRRA 4XWOA 4MQBA 3ROEA 4IIUA 3RC7A 3HCNA 4YMHA 1KSHA 2OCGA 1C9NA 4M1ZA 1PZNA 1LK5A 1RDFA 4PIPA 1RKXA 4TT3D 4UBNA 2G8LA 2A58A 4X6XA 3RIEA 5D3QA 3TQHA 1JEQB 1P1BA 3OJCA 2AGVA 1L2TA 2QW0X 3L0OA 4GI7A 4H35A 3HMKA 2R9VA 4RM3A 5EJ7A 1DBPA 1RHJA 3QITA 1VCNA 2WINI 3NHRA 3WOVA 4PRYA 1TT5B 3ZWDA 2LD4A 5K6TA 2WSSA 3U7FB 4AIRA 1JEYB 3ER6A 5C8VA 4PAQA 4QFMA 1TAUA 4TVOA 1SUFA 2YNMC 3IDOA 4U7JA 1EK6A 5SZHB 2OHJA 3I5XA 4EL0A 3EGVA 4TMKA 3FGZA 3PNLA 4RK0A 4M87A 4DQLA 2R2AA 5JXGA 1IH8A 1C0LA 2FPOA 4Y8VA 3CG0A 1DEKA 1JEJA 1JEQA 1T5IA 4L95C 4RKRA 5G1PA 1Z6GA 4JNCA 3FDZA 3LW8A 4JU9A 2JB9A 5BPFA 5EJIA 4DMGA 1V8BA 1YR3A 2W90A 1V8ZA 3DDCA 3F1LA 5EIOA 1ZK1A 3NXKA 2HU2A 2MR6A 4ZKDA 2OD9A 3AFGA 4JNKA 1X1QA 3R8XA 3O74A 3S68A 3DMNA 5DYTA 2XCLA 3GMIA 3UTCA 1EVZA 3PHIA 1I6WA 3KQWA 5IDYA 5AI6A 1OYWA 1DBVO 3DFFA 3GOQA 1CR6A 1K2VN 2HKIA 2UV8A 3NAZA 4LRXA 5AVSA 4P58A 1NUTA 1WUJS 2BFWA 3WWZA 4JNGA 2XVAA 4AURA 1CUHA 1OAOC 1D8TA 3IUYA 1G20E 3RIYA 2PT9A 3KLNA 1SHLA 1TC2A 2PL5A 2ZSAA 3NBUA 2B3TA 4PFQA 3HADA 2JC3A 3AB7A 5JRJA 4QC2A 1CZNA 2C9DA 4CQMA 1UFKA 4JT8A 7AT1A 1R0RE 5AIBA 5LNK1 4UTVA 3MWYW 2P9EA 2UVQA 5DM70 2NUPA 2VJNA 3L8GA 1DIHA 3UQYS 3AX6A 2FPUA 3AHGA 2P2GA 1X38A 2FG7C 2HSZA 5DULA 4OFZA 1V7CA 1JVNA 2W42A 5JAOA 1YZKA 1GPLA 1XOIA 3AMVA 1JIKA 4KQ6A 2GXAA 3DULA 3MAJA 5IKEA 2B92A 2HRDA 2NU9B 1ZHOA 1Y80A 2HW8A 1SG9A 2OZPA 3RBXA 1D1PA 1M8GA 1YZLA 2K2QB 5M29A 5FV7A 4KSBA 1D2MA 4PHFA 2FG6C 5GADl 1FX0A 2V6GA 3A28A 2FUG6 3I2KA 3GLQA 4NSNA 5EJ5A 4KE9A 3FTFA 1PL8A 2C1ZA 4L22A 1X92A 5CFZA 1MOZA 4Q7QA 4NABA 1USIA 5KOJB 3A1SA 1B16A 5CB4F 2V6FA 3V2GA 3IXLA 1XNJA 4ROSA 1QNLA 1QIDA 2I78A 1H2XA 4ZHQA 3LQ2A 3I01A 4CMGA 4ON9A 5KTYA 4U8HA 3R9XB 1UBCA 3H2ZA 1IB6A 4E6EA 1ZWLA 2Q6KA 5CYPA 1OBCA 3TZBA 3LUAA 1N34B 1DBQA 3OMLA 3QLEA 4RKYA 4K0RA 1KYZA 2H92A 3L1JA 4EG0A 3QVLA 3O83A 3CX3A 2FWRA 1ZM4A 1Y3FE 3SDBA 1EPUA 1LXCA 1Q15A 4MLPA 4DA4A 4Z4GA 2PX2A 5F5XA 3PQCA 1T2EA 1WPRA 1YDHA 1YJ5A 3HDJA 3R0XA 4M1OA 3AO0B 4OFBA 3HLTA 1DAGA 4G85A 2OCDA 2OV4A 4OI0A 4WD3A 2BMJA 4HNUA 4UCQA 5BMVF 1Z18A 2W00A 4L9SA 2IUUA 1Z13A 4DDMA 5BR4A 2ZBPA 3SIRA 3DMFA 4NZPA 2FMUA 1X7GA 3LM8A 5ITZA 1A9ZA 4DAEA 1E61A 4GRAA 4QEZA 1ZINA 4B2LA 2HRBA 3KU4A 1DWUA 1L5FA 3M2TA 3BA1A 3T4XA 2D5BA 4A6DA 1SCUB 1R6VA 2A5DA 3KSZO 4C3ZA 3I5UA 2Q3MA 4BMYA 1G9XA 1N1GA 5G40A 1L5GB 4UXIA 3TM4A 2COUA 3IAS6 4S35A 2AKAB 5EEHA 4WUVA 2X14A 4LYYA 2FWAA 3TI9A 3MIZA 3NWJA 2ZM5A 1S0UA 5IZCA 1DDGA 1GKIA 4K87A 4RL4A 3N5KA 2QD1A 3K6JA 4YIHA 2O48X 3ZBUA 3DF7A 4LOIA 2HDOA 5BSVA 2XCOA 2F4NA 2P78A 3N8GA 5D7BA 2HO5A 4CI9A 3FZGA 5FHQA 1TT5A 1V7PC 1EFRD 1PLLA 2ARKA 4L2IB 3JD2A 4L5CA 2R8RA 4KW7A 3OHMA 1R0LA 4KIGA 4R16A 1ZNXA 1FPMA 3D1JA 3EDQA 1XRJA 3M6MD 3MGBA 4IICA 5AM4A 5EJGA 3X1KA 4N5NA 5JEDA 2HSEA 2C95A 3EJWA 3MJSA 3SM3A 2C07A 4KXXA 3VR3D 2QP9X 1L5QA 5LWHA 1U7DA 4KPUA 3SVTA 1OAKA 4KWEA 5ADWA 1H2ZA 3ILHA 1ZNZA 3P9RA 2I22A 5B58T 4GP9A 1N4AA 3TMAA 1V16A 1T0JB 1XGKA 2H9YA 2PMCA 4FFBA 1Y4ZA 4H1HA 4GYJA 4IZHA 4PGHA 3RROA 3D3JA 3UBMA 2IXEA 5AW1A 4JLWA 2YH2A 5JAIA 1FDWA 3GLHB 3D6AA 4WLOA 4F6RA 4R71A 2V0CA 1YR1A 1WZCA 3AGQA 3DD5A 3EQ8A 5FWXB 2YWRA 2IT1A 2HBYA 2B30A 4URFA 4BLUA 4R9UC 4GGPA 1Z4JA 1PR0A 1Y6RA 2P2DA 3DW3X 1ODTC 1Y89A 4U7PB 5I7HA 4GOMD 4LRUA 4N65A 3G79A 6REQA 1MAAA 1O57A 3GLSA 1WXGA 1W25A 5DHAA 2WPDD 4B3CA 5BOSA 1K9VF 1SBNE 3F49S 5A3QA 4YRGA 3FTCA 4FZJA 4QGBA 4EHBA 3KWLA 1R5JA 4AI6A 1DKLA 1ULUA 3EGXA 4H7PA 3U7EB 3WFIA 5CLJA 1DO2A 2FJUA 3ZZ1A 4JI6B 1XZPA 3KYIB 1SKBA 2HIGA 4BZWA 1NTRA 2HV8A 5J4KA 3BN3A 4LNUB 3G7UA 5EMJA 3D64A 2YXLA 4JOCA 4JR0A 3ZE1B 4CQMB 4D9CA 3RYCA 4JLMA 1TM1E 3TGWA 1BVYF 3KKLA 3A2MA 5A4AA 5JHGB 1OXMA 2G6TA 3L8MA 3OFSA 3PC8C 4OHMA 1BTOA 3BCHA 4TV8A 2ONCA 2P6MA 4W99A 4CKWB 5L3QA 1QS0B 1CZHA 3V8NA 4J1TA 4ZEXA 4BMVA 4DHWA 2OYRA 5JZBA 5K0SA 2G76A 1ZVKA 3CLTD 1PHRA 2QZJA 3CUWA 1QGYA 1V2GA 2OFXA 3B1JA 3H4VA 3KT6A 4CLRB 3OZIA 5F1OA 4XI9A 5JWRA 1G8PA 4N4AA 3E7PA 4PS0A 1RYFA 3DE0X 2GX6A 5BSGA 2YUIA 5HWSA 4A8JB 1DV2A 2WM8A 1PW7A 3F5MA 4HNAB 5F7OA 5EZ6B 5AW5A 4CR8A 5I7UA 1VHTA 4H60A 4PY2A 2ZDHA 1JTEA 5I9BA 3VFDA 1QGZA 2J3LA 3PWZA 5K03A 1B14A 4G9GA 3JQGA 2UUOA 2C96A 2V98A 3DCNA 1FYXA 4BNLA 2P69A 3JRWA 2PGAA 4UPVA 1CEXA 3TYXA 2AG5A 3QG5A 3TRFA 5L8VA 4ZDWA 3OQMA 1YVPA 2C4TA 5A05A 3ZV3A 1FX0B 1Z4KA 3T1NA 4DLNA 1I8TA 3RBVA 3OF3A 4LC9A 4BX3A 3RRXA 4JOQA 2W22A 2Q3LA 3SLKA 2DPGA 2FDXA 5AESA 1IBCA 2I4NA 2HH9A 4TZKA 2C4VA 3SSNA 5A3RA 1A95A 1EINA 4IJMA 1W87A 4MQUA 1ISMA 2QTRA 3IBGA 1G21A 4DM7A 1D0VA 1WUHS 3DUWA 1G17A 2XE7A 1T8RA 3JD0A 4YP1A 4LSWA 1F60A 3TK1A 4ZVUA 3ZW8A 1HLFA 4DLRA 2EIXA 3EDYA 2YHBA 2GBLC 3T3GA 1XHLA 3WIBA 4HLDA 1JHZA 1DRJA 2VTKA 4J7CA 2KQUA 4YDRA 4DWOA 1GU1A 1M67A 1QH1B 2IA5A 3KOUA 1GRQA 3HE3A 3W2TA 1AXEA 4N3AA 4C1BA 1MG0A 2H0QA 4RVSA 1F1BA 3ZJVA 1AF7A 4BXOB 4Z4EA 3GEEA 3NWBA 3MWEA 1E4OA 4GUAA 2PT6A 1U5BB 3LI2A 3C1UA 4ZCQA 1Y7TA 3U0VA 2UZ1B 1ZA2A 1P1RA 1XJWA 1AB6A 2H7CA 1CIJA 2ZWIA 3A1WA 3L7JA 3NPAA 3R5TA 4CM8B 2LZ0A 2OUKA 3ZU2A 4BVEA 3VSEA 3BM5A 4E2WA 4F1KA 3SICE 4IKOA 1O6FA 4MQLA 4UDXX 2QVGA 3RSOA 3SM9A 4Z4HA 2OD7A 1VQ1A 2BV3A 2EZTA 3IVXA 3FNEA 4YAKA 1L3IA 3U4QB 1WETA 1J7JA 2DPLA 3IH5A 4NFHA 5EXEA 4UTPA 1T2AA 4NICA 3E35A 1WB9A 4KPUB 1Y7IA 2WIDA 1C30A 2A1IA 1JR6A 3ASZA 2DJ5A 2XSZD 3KS9A 4DCMA 1BC5A 2KBFA 4J3FA 5AKYA 4HMOA 1E3IA 5ECYA 5DT2A 4RMNA 3QGMA 4DKXA 4BZXA 3OUUA 1W34A 3QFSA 5FBVB 3E3OA 4ECAA 3FHJA 4E2ZA 1W88A 4MV6A 4RA6A 2GXSA 4FPXA 1ULSA 3GELA 5AM5A 5F76A 3W9SA 3A4MA 3QTLA 3ROKA 3ZVRA 3K9WA 4AJNA 2ILTA 4HGYA 1UAGA 4KFTA 5TQ0A 4CL2A 4KR3A 1KRXA 2YY5A 3G2MA 3OIVA 4LNAA 1U90A 3CVOA 3I12A 4M54A 3KOZA 3HWSA 1XQ6A 2GLXA 4FYXA 5EMLA 2VVTA 1YHNA 3UICA 5I7SA 5J4VA 1GXSA 3ZU6A 3K70C 1F4LA 1YASA 2DFTA 5KAPA 5AW6A 3RF7A 1EWKA 4HP8A 3M3DA 3TLGA 3MT8A 2ZTLA 3FCEA 5CTJA 3I34X 4KYVA 5F1KA 3UT5B 2BFCA 1V5WA 3SHOA 3TLJA 4Q4LA 1AHIA 5JADA 1PL7A 2XCTB 1H85A 3KOYA 2Q29A 2ALJA 1CSEE 1JJAA 3U16A 5BUCA 1OU4A 5AR1A 3C41J 4AO8A 2C00A 4BCBA 4BQSA 1RLUA 3I83A 4XGIA 1HOXA 3THYB 3R3XA 3RSFA 4CG2A 3O03A 2FP4A 3IQWA 2WB2A 2PKXA 2DM6A 3OLVA 1N2OA 1FP4B 1Q3KA 3GB9A 4KNWA 1FEZA 1A2OA 2V96A 1YAJA 3HKEA 5HBRA 4HYYA 3W5HA 4ZI7B 3EUEA 2QT9A 1Z83A 2GN2A 5FPPA 2YVAA 3ZBTA 3I4LA 3E3LA 1MT0A 2Q1XA 2WOOA 3B1FA 1I0LA 4G8JA 5TF4A 1QGOA 2PUCA 4C1NA 4AL4A 3MJFA 4QUAA 1X7DA 3WIVA 1OFUA 1PFGA 4ENVA 5A5GA 1TDJA 1YKFA 5JR3A 4DR7B 3CXRA 1QVZA 3WMRA 1GM5A 1RWNA 4GDMA 5AVVA 2F9MA 4NBRA 3D59A 1K92A 3HWX1 3JAWA 3QEOA 3WHLA 3PUXA 3T3IA 3ZJYA 5AKXA 2I8CA 2AXQA 5BQ3A 5CFMA 2HMSA 2JLBA 3CWCA 4XCXA 1NJ5A 2DLDA 1YKSA 2XB9A 2YXNA 4K05A 1IQRA 4M89A 4XGRA 2VT7A 4QPZA 3RRBA 3X1WA 4F2DA 4OP3A 3DR3A 2YVQA 3DOUA 2FK8A 4BGVA 5DP1A 1SQ5A 3ZV5A 4IFEA 1CUYA 5B4UA 3ENWA 2VP6A 1MORA 1X77A 4JKYA 2DHQA 1RCTE 4TSKA 2H9AA 1U7XA 3NNSA 5FTKA 1UF9A 5TQVA 4K0KB 3KJZA 1PX0A 4B84A 4ES6A 2GN6A 4OMDA 5A02A 2ZIUB 5I6DA 1HI9A 1B93A 3I9FA 1GLGA 2FOXA 3FPJA 1DCMA 1IK4A 4FC6A 1EWVA 1PJCA 1EAYA 4WT7A 5A4DA 1UOOA 5HRCA 2XRYA 4KRYA 3NC4A 1Z37A 4TTVA 1SHKA 1XROA 5PNTA 1RBZA 2ZE7A 4GE3A 2C5EA 2PS9A 5JIBA 5KSYA 3KELA 4M88A 3FFWA 3OO1A 3U4HA 5G2OA 4RD1A 3BL5A 2VF4X 4QYTA 3TTWA 3GW8A 3TINA 2PO7A 2ZJ2A 2PZAA 4KYIB 3RARA 2XKJE 3HC7A 1NP6A 3N0VA 1J5EB 3NUGA 2PS1A 3A6LA 4MYCA 3NCHA 2HWXA 2P7HA 4DZRA 2V6IA 1LK7A 1ODKA 1UXOA 3MNFA 3ANLA 1S5PA 2WSIA 3MQ4A 1BDBA 3ES9A 2OSBA 2IV3A 2AZMA 4G86A 3RC9A 3VR6D 1QIHA 1UXHA 3RVKA 1HR0B 3H16A 1HTWA 1W96A 2C2GA 2WTUA 1U2EA 4R2HA 3AYXB 4LJ4A 4MUKA 5ALDA 5D51S 4X1KB 2DKOA 4WNAB 3UC9A 1PQPA 4BQOA 3TM5A 4CQLB 1T5HX 1PFYA 2YRWA 4A0GA 4KSCA 2JLSA 1FUUA 2CJWB 2R8PA 2IF0A 5LUBA 2RD2A 4KUHA 3MTAA 3QVWA 1RBYA 3V4OA 4N3CA 3GLGB 3GLHE 4K86A 2VNJA 3GEMA 1NIPA 4XUDA 4CKYA 1GTRA 1N0WA 2QN9A 3ADKA 3LUCA 3RS3A 4H7KA 1KEUA 2GSWA 4RUKA 2BHNA 3KX2A 5JD3A 5KUTA 4C6HA 1KI7A 4J1GA 1QQ7A 4V3BA 1EJ2A 5IUKC 3UJPA 3V55A 1EK5A 2EZ4A 5C35A 2O6LA 1RRKA 3AB3A 3K0KA 4DG8A 1GN8A 1R6AA 4L8FA 1FDRA 3WNZA 2ERXA 4Y9SA 1GVNB 1YDGA 3GBVA 3QEJA 3PLAE 3FOEC 2VJYA 3ANTA 4IF6A 3BK2A 3PWTA 2W11A 4LWPA 4OV6B 2PIAA 4TV9F 2OZLB 4I50A 3V4LA 4D9KA 2JPDA 4IHQA 3UW3A 4F2HA 4F71A 1V43A 1YA4A 4W9MC 3FCAA 4IIVA 2RGNA 4V1CI 1GGJA 1MX1A 1S3IA 5FOXA 1WKBA 3CURA 3O8QB 4BP3A 4D9NA 1DMSA 2AFIE 5ESXA 1DBRA 4HAYA 4N41A 1PP4A 2HPAA 2OP1A 3RUDA 1XTIA 2D0IA 1KY5A 3DJFA 3VPFA 2ZLBA 1ORDA 2B37A 4P33A 4S05A 3O47A 2OHOA 1AZLA 1E5LA 3CCCA 1HY3A 1JJIA 3ET5A 3HN7A 1N5RA 4CGZA 1KDZA 2VUHB 1Z2AA 2CYAA 2RGXA 4RWEA 3DTYA 1F2TA 1VL2A 4J75A 3V33A 1ODCA 5CDSA 1U1IA 4MQ5A 3F2VA 4TYWA 3A4TA 4PPNA 4YCNA 1QRSA 5B30A 1QPGA 2GZ3A 4Y0AA 2FF7A 3UAOA 1DJMA 4TRNA 3JQ9A 4CEIB 3TUZC 2FHPA 1LNZA 1AN0A 3NETA 4XGQA 9MHTA 2FN9A 1ZLXA 1B3RA 3D3QA 1NZFA 3DHEA 2DECA 2FGKA 4LJSA 3P71T 2VLIA 3DB2A 3KCNA 1CR2A 4LNUA 4BXOA 1VB3A 4FZ5A 3RS0A 5FNVF 4H4DA 4EF4A 3PNOA 2PRJA 4EY3A 3RD5A 1E1QD 1J2JA 2BEWA 2PH7A 4RY8A 3H2GA 4CM7A 4LHXA 2CJFA 2WKRA 3HB9A 1U31A 4Y0NA 4LJ7A 3RS2A 3RYHA 4R40A 4E5VA 4K9KA 3THXA 4IY1A 4JXJA 1GCIA 1XWFA 4WXYB 4BNMA 2YJNA 3ZXYA 5BUSA 1BROA 1OGJA 3UFXA 3FFBA 1XLUA 4N7BA 3DMGA 2EJBA 2D1RA 1WRBA 1YL5A 4GF5A 2CLMB 2JZNA 3B3AA 4WOKA 1V5IA 4OK5A 2QRQA 4QARA 3NMUF 2QN8A 1L5ZA 2R4QA 2WSLA 2Z56A 5JSHA 3LQQA 3YASA 2A4MA 4YGXB 3SU8A 1LBTA 2BDUA 3HBLA 4PBRA 1QFMA 5EGSA 3ZDEA 4CF3A 3UCFA 3GLFB 3GLHA 3W2GA 1DUIA 1UXIA 1A9XB 2C9MA 5AXAA 3ECSA 3WL3A 1AU9A 1H8EA 2HA5A 3AETA 1RRVA 2MDTA 3KQPA 1K8YB 3TX6A 3VR6H 3WRVA 4O3MA 2GK6A 3EASA 1W93A 1GFWA 3TKAA 1FU8A 2VAPA 4HQFA 5KOHA 2W58A 3GL9A 2BR3A 1ARZA 4FNMA 3O9ZA 4X65B 3S28A 4U00A 5EUMA 3F7MA 5AQ1A 1DXYA 3E03A 3KDAA 1SXJD 3QP9A 4P53A 1EP1B 1DQPA 1RQRA 4FFPA 4I1PA 1M7GA 3PHJA 1WULS 3R75A 4W5OA 4QNNA 2CVFA 2VQDA 2ODTX 5LLDA 3NTOA 3Q87B 4UW9A 4ZWNA 1EI9A 3D6VA 3UV3A 2JIQA 4B6PA 1YZFA 1Y6GA 1O96B 1FFGA 3ZI7A 4CGYA 4ZV4A 4B3DA 3LT5A 3S2UA 4ZO9A 4EK9A 1ESNA 3NXSA 2NU7A 1I3MA 5FCDA 5FF9A 1NBOA 5CHEA 3CZAA 3D4IA 4ITVA 5GM2A 1DX6A 3OOYA 4BNIA 4DLXA 2AJ8A 2JVKA 1C7JA 2PD3A 3I53A 3MCUA 5AT1A 3K1JA 4CTKA 1N8TA 4DXHA 4JJAA 1CC1S 3JQ8A 3T5MA 3KR1A 1HDGO 1UT5A 4RANA 4OLAA 1WCIA 4ZK6A 3BSFA 5IPFA 5ES3A 4G1BA 4HRXA 4MQEB 4DT1A 1PVOA 1ZUNA 3SJCA 1C80A 2I3GA 2R6AA 4YRCA 2UZ1A 4UQLA 1DNPA 2QXYA 2Z1NA 3A26A 3KPUA 3RUFA 4PO9A 3WLFA 5IVHA 3GLIB 3BJMA 3UMJA 5UKDA 1J1UA 5FWYB 1U2SA 4TN1A 2ATVA 5E9AA 2QOEA 2O8DA 3KTDA 4GW3A 4K6OA 3GGG