3RUHA

Alternative analogs as viable substrates of udp-hexose 4-epimerases
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
341
structure length
336
Chain Sequence
b'YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WbgU
publication title Alternative analogs as viable substrates of UDP-hexose 4-epimerases
rcsb
source organism Plesiomonas shigelloides
molecule tags Isomerase
total genus 125
structure length 336
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ruhA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3ruhA02
2X9VA 4BQRA 5FEUA 1ZJYA 3AY7A 5LCXA 2JAHA 3JQ8A 1HLDA 3ZHBA 4TQGA 3WGIA 3GG9A 3PGXA 1AHHA 3W8DA 2BI8A 1EDZA 1SAYA 2FSSA 5ENDA 4WLFA 4MP6A 2O3UA 5K9ZA 1T2AA 2BKAA 2VYNA 1PZEA 2OBYA 4GL4A 4RCVA 1A71A 2NADA 1GZ6A 2VHXA 5CP8A 3ZV6A 5JAQA 4BO3A 1CJCA 3D5TA 3I3OA 1MUUA 3OIGA 4GX1A 2R00C 3KM0A 2JFHA 1M67A 3KYBA 2POQX 3Q0EA 4AJ1A 1DRUA 4OJNA 2NLOA 2YV2A 2JKVA 4GBJA 4U5QA 4BNJA 1YKFA 2FP4A 3U09A 2CD9A 2GYYA 3CZMA 4FC6A 2RHRA 4Z0PA 3GH3A 2I76A 1DC5A 1NQAO 1O5IA 3DAGA 4XR4A 4MPDA 1XU9A 3IP1A 4A73A 3GVPA 3E9QA 3AY6A 1QYDA 4TVOA 3WNVA 2GD1O 2O4CA 2C29D 1GDHA 5TX7A 4E4YA 2E37A 1PGQA 2C82A 1E6UA 2ZCVA 3OJOA 1QR6A 1E7WA 1F14A 3R1IA 4RJTA 1Q1NA 4CMGA 4UUNA 1E1NA 3JQBA 5TJHA 4UVDA 1ZH8A 4L75A 4PGFA 3TZHA 3ZDFA 4ESOA 3G0OA 3KYCB 2PD3A 2JFGA 4DLBA 2AG5A 3HB5X 3X2EA 4IPTA 1J0XO 5I7FA 1LSOA 3KSDO 1H2BA 4MVJE 5T5QA 5BSFA 2YFHA 4YDRA 5JBIA 1XYGA 4AJ2A 2GN4A 5FI3A 1HDGO 5CEJA 2VNAA 1UXJA 5JCJD 2J5QA 4PG7A 4OM8A 2XPCA 3P2YA 2NV6A 3F3SA 4J7CA 4W9NA 1K6IA 2DFDA 4D0SA 1C0KA 5IN5A 1IL0A 4I9HA 3VH1A 2IYOA 1Z74A 5EINA 1G6KA 5EQDA 3F4LA 4R1UA 2VWPA 3I6IA 4I5EA 4OXKA 4WLOA 5HS6A 3QRWA 2Z5LA 3AI3A 1HDXA 1B8UA 2Y0EA 2QRKA 4BQPA 1NVGA 2W90A 2J5RA 3ITDA 3HDQA 1NM5A 1ORRA 3OHSX 5DDIP 1H6BA 3WJAA 1B14A 4OXNA 4E33A 1CETA 3BMQA 4IDDA 6LDHA 1X1EA 4WCFA 1RM5A 3GUYA 1ZEMA 2WM3A 3G49A 4Q3AA 4MVJD 1T1SA 3PJDA 3TNLA 1H2HA 4J0EA 5G0WA 3DDNA 1ZK3A 1XCBA 3DBRA 1LDGA 2DFVA 1ZK0A 2C5AA 3KUXA 1V3UA 3UCFA 4DQUA 2CVQA 3BMNB 3TL2A 3WTBA 4R5MA 3JQCA 1E3WA 1CQJA 4BNHA 4D45A 1EFKA 1ISMA 4J2OA 5KIAA 2CMDA 3ETGA 2QW8A 4MJLA 3M1AA 2FPPA 1X14A 3CEAA 1HF3A 4QSMA 4S3MA 5JAIA 3RUDA 3CSDA 5KTKA 3ZHXA 2YDXA 1KS9A 2BRUA 4EUEA 2DQ4A 1YOVB 4FFLA 4J0FA 1IPFA 4CLEA 1P44A 1QLJA 4L76A 4Y98A 2UVDA 1A4IA 4MIOA 4Z9FA 3TJRA 4XRRA 4EBFA 3OQBA 1HTBA 4YT4A 1PU2A 1XG5A 3LT4A 3PK0A 3CZRA 1BG6A 3ENNA 4JP2A 3GZNB 5TT1A 4DC0A 1BW9A 2E4AA 2IXBA 2D5CA 1IZ9A 3KSUA 4IDEA 3WOHA 1JQBA 2OGUA 3RAJA 3NJ8A 4AICA 1N7GA 3JQBC 2GGSA 3I83A 1GYPA 2BFPA 5T67A 2FRDA 3RVDA 1E0DA 1UAYA 4EYEA 1LLQA 1I5RA 2VT3A 4ID9A 3ROKA 1E7SA 1NQ5A 4E2ZA 1CRWG 3IOYA 1JDJA 3GRPA 3W4JA 3V1TC 3W8EA 5CDUA 3WYBA 4ZD6A 1LRKA 2X22A 1BMDA 1XEAA 2G5CA 4OQYA 5T8KC 2W2LD 4O5OA 2AA3A 4K6FA 3Q1LA 1NWCA 2DKNA 4JJFA 5JO9A 5K6AA 2O3JA 3IS3A 3GAFA 2DBRA 4Z9XA 4E5KA 1CERA 4M8SA 2G82A 1OZAA 1GFSA 2DBVO 1B16A 1LTHR 4INAA 1ZO8A 4ZN6A 4E5MA 1WWKA 2JCXA 2ZB8A 3IKTA 4CLRB 4W9NC 2Y0DA 4D44A 3FWNA 3QIVA 4D3SA 1X7GA 4LVUA 1A27A 2IZ1A 1DRVA 3D1LA 2P68A 3GC6A 3DTYA 4DYVA 1ADBA 4RQUA 5DT9A 4CL8A 5CDSA 1U28A 1T25A 3HN2A 4C7KA 4GKVA 1EVZA 5DCUA 3ONEA 4DTIA 3SJ7A 3HADA 3OM9A 4P8RA 3VH2A 3VZSA 4YVFA 4I8XA 3TZQA 3KOUA 4WCFC 2X9GA 1Z6ZA 1LRJA 3LVFO 5GZ6A 4BO0A 3E8XA 3RFVA 4E21A 3CE6A 4MVJM 4IDCA 4PLGA 2VOEA 4KP7A 5CHEA 4CMIB 1P1RA 4G81A 1VL0A 2Y1GA 4ALNA 1BXZA 4IGFA 4M54A 3EYWA 2CZCA 3GF4A 4PVCA 4CMAA 3Q2KA 3S2IA 3GAZA 5T57A 4Q9NA 4L4XA 4BMSA 3ZWAA 2NM0A 1A7AA 2C07A 2AEMA 3GFGA 5ICSA 1Z82A 3PWKA 3PHIA 3TOZA 1EMDA 4IJWA 4ALLA 1QYWA 4DIOA 4OQZA 4R3NA 3UN1A 3MOGA 4ZQBA 1NPDA 1ZW1A 3ZU4A 1F12A 3MTGA 1ZZEA 2PA3A 3NTRA 4IDAA 2EV9A 4D42A 5MGBA 1I3KA 4YR9A 1QORA 4H3VA 3WDSA 4CLHA 4J43A 3H5NA 2UAGA 4R3WA 2RH8A 1P1KA 1ZBQA 5KVVA 1NNUA 1W73A 1UXKA 5BR7A 5TF4A 3GK3A 3DWFA 4B7CA 4WKGA 1YBMA 3INGA 3P2OA 1YJ8A 5AVOA 3RBZA 3AUSA 3N58A 4XB2A 3LC1O 4XYGA 2GR9A 5DULA 4J4BA 4Y6RA 1K6XA 1ZSVA 2QG4A 1TLTA 1MB4A 2JD1A 1B7GO 2Z95A 2ZQYA 4LGVA 1KVSA 2WWRA 1Y6JA 4B3IA 4FN4A 4U0KA 3GEGA 5HTOA 3RD5A 3RKUA 3R6DA 5DCWA 3BMNA 3FN4A 4NJMB 1DIGA 2EG9A 1AHIA 1EZ4A 3H9JA 2I5PO 4CL3A 4LCEA 1U8FO 3DOJA 3VHRA 1TVEA 5K6AC 3UICA 2PY6A 2ZTMA 2VZ8A 1PGNA 3JD0A 4AJIA 1JAXA 3NV9A 1BXGB 3JQ9A 1PQWA 1UH5A 1N2SA 4A03A 3GEDA 4HXYA 2DAPA 1NFFA 4QECA 1R4MB 1HLPA 5FYDA 2JJYA 2NQ8A 4GMGA 3RFXA 2D59A 2I6TA 1YOVA 4LRTB 4Q3EA 3RC2A 5IN4A 2HMUA 4RLSA 3V2HA 5AYVA 2EIHA 2ZATA 2ZYAA 4R1NA 1M66A 1EDOA 1PZHA 4J1NA 1PJ3A 3QA9A 3BTSA 1DIRA 1V6AA 1LRLA 4LCJA 2JD2A 3PFWO 3GZNA 4FQ8A 4W99A 2BGLA 4FJ0A 4ILKA 2V6GA 2YUTA 3TWOA 1ZFNA 3EY4A 3K30A 3KVOA 4ZQHA 4KDFA 1GQQA 3OEWA 4L9RA 3C24A 5F1PA 4FFOA 4GGPA 1P77A 1I32A 3TZKA 3WQSB 1I2ZA 3QVOA 4MVJA 1PJCA 4AL4A 1M6HA 4UVIA 4O59O 1XELA 3L9WA 3L9XA 3G3EA 1PEDA 4PG8A 3UUWA 4ZQEA 4EI2A 1LSUA 3DOCA 4CQMB 3G1TA 3AY3A 1XA0A 4NBVA 2Q2WA 3JD4A 4IXTA 5KVCA 3VPXA 4W7IA 2I99A 4WPGA 4YWJA 3SC4A 5CEFA 5F3RA 2AXQA 1JLLA 3DBHB 4CLRA 1GV0A 2IEDA 1ZK1A 3RC7A 3KLPX 3RWBA 1WNTA 5DN9A 3JQ6A 1NVTA 4DL9A 3TL3A 3WB9A 3S55A 1SC6A 3B20A 1W6UA 5F5LA 2ZJ0A 5U1PA 1QMGA 3L6DA 3NAQA 1E3IA 3FNFA 3C1OA 2RH4A 5T6BA 1NQOA 1QRRA 3PYMA 2OFPA 1IZ0A 4J90A 8LDHA 2EERA 2X8LA 4TRJA 4K1LA 5JMPA 4OOFA 3VOSA 2CSUA 3MWDB 3IUSA 3WGHA 3ZGYA 3DAFA 1Y8RB 3K2EA 3G79A 4OYRA 3DO5A 1Y81A 4MKRA 3PIIA 1GQ2A 4CMIA 1VJ1A 4NFYA 4RF3A 2W2KB 1E1KA 4DBZA 2F00A 3PTZA 4R5HA 2HMTA 4RZIA 3BMOB 5EIOA 1K2WA 2HCTA 5KWEA 1T2FA 1IUKA 4Q39A 5L7YA 2A35A 3JQ9C 2W2LA 2WSBA 4JROA 1OAAA 3EZLA 5JYEA 3JD3A 1S6YA 3ZI0A 4C7JA 5LDHA 5DF1A 3W1VA 5TJ9A 1U3TA 1H0KA 1X1TA 1YXMA 1LSSA 1AXEA 2O7QA 3PQFA 5AXDA 4J49A 3ANLA 2DC1A 2IZ0A 3KBOA 5JYDA 4AJNA 1ENZA 2OHXA 5EPOA 3DHYA 4BKQA 1Y9AA 1PZFA 5G0TA 1DB3A 2A92A 4J1SA 1QYCA 4J4HA 4TRRA 5ILGA 1TEHA 2NACA 3E48A 3GRKA 3K2BA 4GVXA 4RV9A 2JL1A 4IS2A 1DEHA 4YXFA 4JN6B 3ADOA 4ONEA 3VTZA 1YWGO 1MG0A 4IDGA 5ER6A 3AI2A 1W0CA 1HYGA 3EGOA 4RQTA 2X5OA 3X2FA 3C7DB 1YQDA 1EVIA 1U3VA 3I4CA 2CVOA 2JHGA 5CG1A 3R3JA 1RKXA 1GZ3A 4JNKA 3QVWA 3QVSA 4NJMA 3PI7A 3UF0A 2Q1UA 4YRBA 3ITKA 3PFFA 4ND2A 4RORA 2ZYDA 2RBEA 4IDFA 1MFZA 3UAGA 1PWZA 2C20A 4FFPA 5DBGA 3E82A 4OKNA 3TDKA 1SB8A 1BXGA 2V6BA 1I30A 1U4SA 4CUKA 4J7XA 1LX6A 4I5DA 3QQPA 4J4TA 2DU8A 1R4MA 4GKBA 1I01A 4EGFA 3CIFA 4QFCA 5JFOA 2XAAA 4U0JA 5C7IO 3U9LA 4AFNA 2EW8A 4LMRA 3MJEA 4CV0A 1IYZA 3COSA 3NJ4A 3ANNA 4LRSB 4X54A 3UHAA 3WGGA 4YA6A 5L40A 1TT5B 2FSVA 3FPCA 3U4HA 1X15A 4DPKA 5JDCA 1SPXA 2HMSA 3ZU3A 4JLWA 3FF4A 4Q3NA 5KJCA 2Y1FA 1Y7TA 2Q99A 1P45A 3AUUA 4DYDA 1HYHA 1NAIA 5JCXA 1N8KA 2EXXA 2XXBA 4E5NA 4PZEA 5JE8A 2Q2QA 4UVHA 2YW9A 3GFBA 4U8GA 3B1JA 1ZSYA 2CDCA 4WLNA 3EZYA 3OJEA 3HFSA 3ZNPA 4B8WA 3RU7A 1SOVA 2Y66A 4CQMA 2X58A 1P3DA 2PNFA 1FDUA 4TMFA 4L4SA 5EL0A 1W4ZA 3DBLB 2YHIB 1I8TA 1K89A 1KEWA 4A27A 2GZ3A 4DPMA 4DBVO 3DBHA 3EVTA 4J1TA 5A06A 5B12A 5KVSA 1PL8A 1XR3A 4W7HA 2HRBA 2XF8A 4GVLA 2VHZA 1OFGA 1YB4A 2YV3A 2V6FA 3OSUA 3ENKA 3HJAA 1P0FA 1DXYA 3WGQA 4ITUA 4JGBA 3F5QA 2FHSA 1SZJG 3QWIA 5TS3A 4YQZA 1LLDA 4Z0TA 3EVNA 3HWRA 4ALKA 4YT8A 4W4TA 1ZUD1 1BDMA 3RKRA 1KVUA 2AG8A 3WBBA 3GMDA 4XYEA 2CUKA 2Y68A 3BTOA 2V6MA 4KQWA 5IDWA 3DOOA 3JQEA 4QO8A 3I9JA 4NBWA 3ZWBA 2TMGA 1E77A 2X6TA 3OEYA 3NYWA 4W82A 1G0NA 5HM8A 3ZNNA 1UXHA 1EUZA 2VYVA 5A03A 4FGWA 4TWRA 3U62A 3U4IA 4DMLA 5BSEA 1FF9A 3CUKA 4CM7A 1Y8RA 3D7LA 2IZZA 1T4DA 4N5MA 1E6EA 1NYTA 4WNCA 3BIOA 2V7PA 1F8FA 4BUCA 1UZNA 1B8VA 2VUSA 1QSGA 2W2KA 2EGHA 1C14A 1H6CA 3D0OA 5TLSA 5IZ4A 4GX5A 3BHJA 1MV8A 3BMOA 1KEUA 1LQUA 2PKRA 5AXCA 3RIHA 1VI2A 5IXYA 1QYVA 4P4NA 3GQVA 3A1NA 4HWKA 2VHVA 4JCOA 2Y05A 1UJMA 2UV8A 5G0UA 4BNLA 4DXHA 2BHLA 1T1RA 4GQAA 4IDBA 3GVIA 1AUPA 2IEBA 3ETDA 3GDGA 4D79A 1UP4A 1PIWA 5K0ZA 3E9NA 3JYOA 1YVEI 1PS9A 4FCCA 5LC1A 4BO5A 3M1LA 4H7PA 4YB8A 5A4DA 1GD1O 1JVBA 3I9NA 3QY9A 1GAEO 1M76A 4YJHB 5A02A 4QEDA 1I36A 3LC7O 2JD0A 1WXDA 5JO0A 4ALMA 2PK3A 1I10A 2EP5A 2HLPA 2BGKA 2QQ5A 1TI7A 5JDCC 4CMEA 4KUEA 4D0RA 3C7AA 3DMTA 4K26A 5AOVA 3GVXA 4RPGA 4O63O 1P0CA 4BNTA 3WGZA 4WJZA 5A5FA 3PXXA 3NRCA 3WSWA 4FSHA 3IUPA 4E5PA 3IIEA 3S2FA 2NTVA 3ANMA 2P9EA 4GH5A 3OETA 1PGPA 2IDZA 1EUCA 2EWMA 2FN7A 5BSGA 1HDCA 4BNFA 4CLOB 3I6QA 2ZB4A 3ZU5A 3ZZNA 1PJ2A 4CMJA 3D64A 1KERA 2HUNA 1CDOA 4NU6A 3UW3A 2X1HA 5IG2A 1IY8A 5ADHA 4IIVA 2VCYA 4HX5A 1LXCA 4J9UE 1VE9A 5DBIA 1BVRA 3DZKA 3SX2A 4FB5A 1KVTA 3HG7A 1MFPA 5EQFA 3L4SO 2QIOA 1OMOA 1QV7A 1B26A 3DBVO 4IY1A 9LDBA 1RM4A 4BNIA 3ZV4A 3HUDA 5CDTA 2E82A 1ZKMA 1QLHA 1HYEA 3WTCA 3HDHA 2QZ9A 1TT5A 3BMCB 4R41A 2HQ1A 2GN8A 4QTZA 1EFLA 3ICPA 4Z6KA 1UUFA 1O6ZA 3OIFA 1N92A 3KV3O 1P1FA 2P91A 2VZ0A 2R2GA 1XWFA 3ZWOA 1WW8A 2W98A 3LQFA 2DVMA 2V65A 3GGOA 1KEVA 2Q1TA 2PH3A 2BFMA 2VTEA 1MXHA 2BLLA 3CMCO 3GNTA 2O23A 4XRGA 4AVYA 3DZJA 4KTTE 2O4UX 1J49A 3C1AA 1ENPA 5L51A 1P74A 4CUZA 1ZK4A 2W4QA 2Y1CA 3O38A 3PQEA 3C85A 1BTOA 2YHIA 3DBLA 3NUGA 4ALIA 4DC1A 3MJTA 5F5NA 2PH5A 4NFHA 1BHSA 1ONNA 4IMRA 2I3GA 1LEHA 2YZ7A 3FNGA 3ZWWA 1XQ6A 4PLYA 2D4AA 2DPHA 2RCYA 2JCVA 3VKVA 1BXKA 2HAEA 2Q49A 5DBFA 3PDUA 4L74A 4IJKA 5TGDA 2I65A 2B4RO 4QXMA 2D0IA 5H82A 1YQGA 2P5UA 3N74A 3HZZA 5HWSA 4E6PA 1MG5A 3FPLA 3GOHA 4UULA 3WYCA 4DIFA 2C5EA 2D1YA 3C8MA 1UDBA 3WWZA 1J6UA 4CMEC 2BI7A 3H2SA 4ZGWA 1XSEA 2BELA 5A9SB 2JFFA 3QLJA 1RWBA 5DP1A 3DMTC 3GDFA 1ZVMA 4YPOA 4PLVA 2JAPA 1PX0A 1M2WA 4P22A 4OH1A 2J3HA 3VH4A 4F3YA 3D5QA 1ZIDA 3PZBA 3NGXA 3TOXA 3AFMA 4BKRA 1MC5A 1Y9EA 4ALJA 1XLTA 4D43A 4KDEA 3EK2A 1D8AA 1XKQA 2EJVA 1HDYA 1GEGA 4OIMA 4XA8A 2DLDA 2IODA 4ZICA 1ARZA 2B4QA 4ZQGA 2NNLD 1VM6A 2O2SA 4FIZA 1GADO 3ON5A 4YCAA 2J3JA 1GCUA 2F1KA 2Q45A 3LF1A 4MIYA 4D3FA 2PGLA 1Z7EA 2C7VA 2GDZA 3ZN2A 5FI5A 2GF2A 4LW8A 2ILTA 5IDQA 1HE3A 1FK8A 1HT0A 3AU8A 1PSDA 1LDYA 3WIDA 1AN9A 3SC6A 2NQTA 1RYDA 2O3RA 3MEQA 3OECA 2A94A 2WYVA 3Q9UA 4XKJA 1NR7A 3R3SA 1ISHA 1I3MA 3IAHA 3PJFA 4R01A 4JBIA 4YJHA 1GEEA 4LN1A 3NGLA 3WS7A 1YONA 1DBVO 2RIRA 2EGGA 3B1FA 4PLWA 4CM4B 1WMBA 3MTJA 3RJ5A 4AJEA 4Q3BA 4P4LA 3L77A 1EE9A 3GEMA 4UUOA 3VZPA 1E7YA 1YDWA 1WZEA 3QWBA 3U0BA 1UZMA 4B7XA 4YEDA 2OORA 5IF3A 4BNVA 2BD0A 2VOJA 3FHLA 4TZKA 2WDZA 2OZPA 2WYUA 1C1XB 1L7DA 5G0VA 5JLAA 1EEHA 3O8QB 3PWZA 4HFRA 1JWBB 4ZRMA 4CLOA 4AJOA 1SBYA 1DJNA 3KYCA 1U8XX 3OIDA 2VWGA 3AW9A 1X7DA 4NMHA 3DTTA 1D3AA 1K5HA 3GNSA 4LK3A 4CM8B 1S7CA 2WEKA 3O26A 2X0JA 1GYRA 3DFUA 5AXAA 5MDHA 4A0SA 2CF5A 1YBVA 1PJQA 3Q11A 4RPJA 4BGVA 4BO1A 4B4VA 3JYNA 1VC2A 2HMWA 3NX4A 3GGGA 3KLMX 1UP7A 3IMFA 1WP4A 3CPSA 5DOZA 3OBBA 4BMVA 1K6JA 2ZIZA 3GVCA 3PJEA 4D7AA 5IZCA 3DZIA 4DREA 3A14A 4N5NA 3GHHA 3PEFA 2O48X 4GSKA 4QT0A 4XD2A 4FR5A 1KIFA 4GWGA 2D5AA 4HP8A 3UOGA 3VZQA 1P31A 3BMCA 1KVRA 4L73A 1T24A 3CINA 3Q2IA 1T26A 3ZWVA 4Z3KA 3RC9A 5CG2A 2AW5A 3KTDA 3SVTA 1XQ1A 1B2LA 1HKUA 4YJDA 1IHYA 4EW6A 1ENOA 5J23A 3WMXA 4N18A 1WMAA 1LLUA 3NDJA 2PTGA 2GO1A 2WD7B 4CJXA 2PZKA 2WD8A 3UXYA 3PYLA 3WG9A 4RVUA 1HE4A 2J3IA 3JD2A 4IINA 1ZMTA 2OP1A 1FMCA 3B6ZA 1I33A 1U9JA 4D3DA 3DB2A 3ROMA 3PGJA 3L07A 3T7CA 1F0YA 3MZ0A 5A1TA 3GLQA 2G17A 4BKPA 4CQMD 1IHXA 1EVYA 4YAIA 3FTPA 3GG2A 4BO6A 4OXYA 3CH6A 2ZTLA 4I9NA 3INRA 3GZ4A 3EAGA 5JAMA 5L45A 2E48A 4M87A 4CMBA 4L8VA 3H9UA 5I7VA 1U2DA 4A26A 5L7WA 2HK7A 1GV1A 1I2CA 4FFNA 5IDXA 1BSVA 5TC4A 3NDRA 3GA0A 3EMKA 3K31A 5DNAA 3S2EA 4Y9DA 4A2CA 3KO8A 1EBUA 4RPLA 4CV1A 2PR2A 4FFMA 4R4JA 5A9SA 1N5DA 2ZTVA 4H15A 3H3JA 4UUPA 3DAPA 3PDJA 5A05A 1HDRA 2ZJ1A 3AJRA 4M1QA 4J1QA 1C1DB 4WLVA 3DHNA 4XWYA 1D7OA 1XHLA 3HDJA 3ZWNA 4WE3A 1E7QA 2VYVD 1HE2A 3GY0A 1SB9A 3U5TA 3W4IA 1AGNA 3BXXA 2H9IA 3KSZO 4YJFB 2PV7A 4BHTA 2I66A 4G65A 3WICA 3LT0A 1ZSNA 4GX0A 2QYSA 1L1FA 4WCDA 2J5KA 3C7CB 1ONPA 3H9EO 5TQVA 3D4NA 1DFIA 5KJ6A 2TMDA 5JC1A 3TPCA 5CEEA 3QW2A 2CVZA 5CAEA 1UXIA 1A9ZA 1T2EA 3TRIA 3E18A 5L7TA 7ADHA 1V9LA 1YB1A 5T64A 5IZCC 5JAZA 3PZRA 2DTEA 5U9CA 3HB4X 3JSAA 1U5CA 2BF7A 5HBRA 1EBFA 5ICMA 1H9BA 3U4CA 1U4OA 3FNEA 2Q46A 1E6WA 1V35A 4GAEA 5C5IA 2VWHA 3I5MA 3KYDB 4YJGB 3KRTA 4GMFA 3ULKA 2O3QA 1PR9A 3RUAA 3T4EA 4JP3A 2OO5A 1ZXBA 4B3JA 1DDOA 1UDCA 4BIIA 1X13A 2O2YA 3W8FA 2AQHA 1VSUA 1B3RA 1ZXLA 1UP6A 5F21A 4CM4A 5B1YA 1NPTO 4WLEA 3LU1A 2I3AA 2YDYA 3I9KA 1CIVA 2X4GA 4CQLB 5I9LA 1NQTA 1R66A 2EHDA 4RF2A 1FDTA 3ZWXA 2EF1A 4XDYA 4K9DA 5G0SA 3VDQA 3HQ4O 2EJWA 3UCEA 4JJIA 5B37A 1VPDA 5JNLA 1C1XA 4QQRA 3O8QA 2VTDA 5FF9A 1VSVA 2HK9A 2FR8A 4MKZA 4KUGA 4OSOA 1U1IA 2GZ1A 3K9QO 5TT0A 2ZCUA 5TSDA 3ZHYA 1R0SA 4RL6A 3SJUA 2VUUA 4CM8A 1YJQA 5KCZA 3O4RA 3A4VA 3TFQA 1RJWA 1PGJA 3QP9A 1LC0A 2GPTA 3RC1A 1MGOA 1Q0LA 3E6AA 4G5HA 3V5NA 1LDMA 5BNFA 1KVQA 4R54A 4RVSA 2XOXA 5A3JA 3C1TA 2YY7A 4PCVA 1C0PA 1PJSA 2OUIA 4A7PA 3SXPA 5A04A 1NP3A 3JQDA 4OHUA 2EKQA 1I0ZA 4BB6A 4CM3A 4XDZA 4B8ZA 2P4HX 2CDBA 3ZCXA 2VHWA 4B7UA 2RAFA 2VN8A 4GLLA 4NIMA 1GUYA 4KQXA 4CMCA 3WXBA 4E2YA 3LK7A 2FWMX 4PLFA 4E30A 4DMMA 1VLLA 3KHUA 1A72A 1FDVA 2E49A 2Y1EA 4IQ0A 1OBFO 2EW2A 4RVDA 1LA2A 4CM6A 3ZV5A 4Q3DA 4PLHA 4BGIA 3RUCA 1C0LA 3OA0A 2ZK7A 2Z1MA 3VVCA 2O3TA 3RUEA 2PKQO 4BVAA 1V3VA 1R0KA 5HS4A 1MLDA 1F8GA 3VVBA 2AHRA 2GRAA 3NDIA 5CPBA 3F46A 1PR3A 4DIBA 1ULUA 3LZ6A 5G4LA 3JQAB 4N7RA 4DUPA 3GT0A 1X0XA 1KEPA 3LF2A 1I3NA 4PIVA 4CV3A 3OMLA 1LQTA 2Q4BA 4ROSA 2I9PA 1QV6A 4XX0A 4ZJUA 1GCOA 4WOJA 1VL6A 1QXSA 2DT5A 5L95A 1HSOA 3DZGA 4KMSA 4D46A 4R69A 4BNWA 3RASA 4XIYA 3ST7A 4O0LA 2C2XA 9LDTA 1A9YA 2GLXA 3L4BA 5BT9A 1A5ZA 1YRLA 4CV2A 1DLIA 5JY1A 1PL6A 3UKOA 3OQ6A 3NT5A 1EVJA 1ENYA 4FD3A 1CQIA 1HE5A 1N7HA 2C54A 3AUAA 1TT7A 4PG4A 3WYEA 4II2A 4XB1A 2EEZA 1K3TA 3ZHZA 1JA9A 3OF2A 3WFIA 3STHA 1C1DA 3D3EA 4F45A 1E5QA 1GY8A 4JJGA 3TN7A 3NTQA 1V8BA 2ZQZA 3QVTA 3R0IA 3RSHA 3W6ZA 1P9LA 2A9FA 4BB5A 2OMEA 1O89A 4JBGA 5DZSA 1HDZA 1Q7GA 3RCBA 4YJFA 3H9GA 3QV1A 4J91A 3RUHA 4FBGA 1GQYA 2OL4A 3LLVA 2CFCA 2X0NA 4UEKA 4MIEA 4HBGA 5C7LO 1IE3A 3JCZA 1XGKA 1DAOA 5JS6A 1ISIA 3QHAA 1VKNA 4PRKA 4DVJA 2R00A 1B3BA 2YQ4A 2X23A 5HA5A 4H16A 4AJLA 2C7GA 2AMFA 5C7OO 4ZHSA 1E3SA 1WPQA 4RVFA 3RFTA 3FRJA 5COBA 1ZMOA 3NT2A 2YHUA 1GPDG 1SO8A 2DBZA 1B0AA 5L4LA 3EUWA 4XCVA 3BTVA 3PLRA 4ND4A 1DPGA 3V8BA 1O94A 5JY6A 5L9AA 4OMUA 3KYDA 4YJGA 3A9WA 1IULA 2DM6A 2AE2A 4Z0HO 3GPDG 5C3MA 1PQPA 2UUPA 2P4QA 3BMQB 5COAA 5KNLA 5A9RA 3ONDA 5ER9A 3MCVA 3Q3CA 2QRLA 5IJZA 2VRCA 4CQLA 5C37A 2GERA 2HDHA 1WDLA 4IS3A 1NVMB 4KOAA 3WLFA 1YBAA 3FSRA 1DOHA 2AQKA 2H5LA 4PZCA 2PZJA 4GLOA 1PS0A 1GUFA 4UUMA 4WASA 4I9UA 2ZYGA 1R37A 1QYXA 4AJJA 3O03A 4DWVA 4RLHA 3I4FA 3HHPA 3MJVA 2PD6A 1BRMA 5IAAA 3UGKA 4OSPA 1BVUA 4YTEA 4XEHA 4U7WA 2C59A 4LISA 1WDMA 4KTVE 1KOLA 3GUCA 1A4UA 4XQEA 4C4OA 1ZJZA 4II3A 1ISFA 1DIAA 1UAGA 2E6UX 3V2GA 3K92A 5EERA 3IDSA 1NX6A 1P1JA 4RZHA 3VAZA 2QYTA 1GZ4A 4CR7A 3INTA 3V2UA 2QX7A 2PLAA 5ITVA 1LDBA 2YV1A 4YRAA 5A5EA 3DXFA 3ZH2A 3FTNA 3UFXA 2NTJA 2B0JA 4NK4A 1MA0A 3MJ4A 1GR0A 4F6LA 1NHGA 4M89A 3B70A 3I9LA 1PTJA 1XDWA 2VZ9A 4EJMA 1H94A 2HJSA 1J4AA 4CM5A 4DGSA 3EDMA 5BNTA 3BAZA 1PJTA 1LBEA 1SMKA 3U4DA 3CTMA 1GTMA 4HADA 3ZWMA 5GY7A 3ZV3A 1HXHA 3GR6A 4HKTA 4RDIA 1BDBA 1LC3A 4BO4A 2WTBA 3AI1A 4OO3A 1TXGA 3WIEA 3M2PA 4MP8A 3SBOA 1MC4A 5B4UA 3RUFA 3U49A 2ZB3A 2B83A 2GZ2A 5JDIA 3F4BA 3JQAA 4DQXA 2YJZA 3AM4A 3L0DA 4IIUA 3F47A 1P33A 2D2IA 1P1HA 3FCOA 2PZLA 3VTFA 1D4FA 3SLKA 4QUKA 2DTDA 3GPIA 2WJPA 1KY5A 4TZTA 5CDYA 3MJSA 3KEOA 1HETA 3FNHA 4ND5A 4RGBA 3W4KA 1R16A 5AXBA 2C0CA 2HSDA 1Z45A 4I5FA 4B4UA 2SCUA 3QVXA 5IFLA 1NWHA 4HUJA 1MX3A 1N1GA 3UH1A 1SEVA 1YL6A 1PS8A 2YQ5A 3ROQA 5JC8A 3KB6A 4UVEA 1NR1A 3PPIA 4PVDA 4Y6SA 5BQFA 1EE2A 2P2SA 3WGTA 1KETA 2AEJA 1ADCA 2ZKLA 3OQ1A 2BMAA 2H1SA 4WEOA 3OP4A 4NDNE 4RVHA 2B36A 3WGYA 3AFNA 5JW6A 3PWSA 4Y8VA 3I23A 5KJ1A 4ZU3A 3B1KA 3LC2O 1YGYA 4UVGA 1QP8A 1QKIA 5G2OA 4OL9A 1G0OA 3ETEA 4NHEA 5CPFA 1YB5A 2CNBA 1VJTA 5T8KA 4M86A 4XGKA 1AXGA 4YAGA 4FJ2A 1YE3A 3BHIA 3E9MA 4BO8A 4B4OA 1GU7A 3EW7A 3PYXA 2P9GA 3AK4A 3K8ZA 2FY8A 2GSDA 1SOWA 2Z1NA 3BTUA 4Y67A 4F6CA 2DTXA 4E12A 2X7HA 4LSMA 4NI5A 2NVUB 1HRDA 2HJRA 4LSWA 3NTOA 1SEPA 4NQZA 5JMWA 3WQRA 3H7AA 1PJBA 2FPIA 1F17A 2BGMA 3ONFA 5KOIA 5JXWA 3VC7A 3K73O 2EP7A 4D41A 1R0LA 4XZ3A 1KYQA 1EUDA 4M49A 5H81A 4BS9A 4TRMA 3VH3A 2GN9A 3DZFA 3L6OO 4FOSA 4ND3A 2CF6A 1U3WA 4P4GA 4EJ0A 5KJFA 1H93A 3WX0A 4I1IA 2VHYA 2AQ8A 3GGPA 4UEOA 3ZWYA 4B3HA 2HRZA 1CYDA 1ISJA 4NG5A 3T4XA 4YT2A 4OKIA 4WEQA 1D1TA 3LT1A 1WZIA 3NKLA 3TF5A 3I1JA 2IYPA 1P1IA 3PIDA 3GMSA 4BO9A 4EUFA 4O6VA 3K5PA 3D3WB 3RQSA 4NH4A 4BL5A 2DUWA 2AE1A 1DRWA 4OAQA 5G4KB 2Y1OA 2NTNA 1PL7A 4XQ9A 5TIIA 2NUAA 1RM0A 3WWYA 1GL3A 4QX6A 1Y5MA 3GDOA 4MINA 5JDIC 1DC3A 5THKA 1I2BA 3RBVA 1SCUA 3H5RA 3VPFA 1LDNA 5DCYA 4G2NA 4MOWA 4BNZA 4NJOA 2W8ZA 4IJVA 1JU9A 1TA4A 3PVZA 3GHYA 4MVJP 4PZDA 2HK8A 2WMDA 5GZ3A 1LUAA 4BV8A 2GNAA 2NU7A 4JK3A 4AJKA 1OOEA 3AUTA 3ZW8A 2VUTA 1BWSA 3RI3A 3KZVA 1UZLA 4MP3A 4HV4A 1DIHA 1RYEA 4HNGA 3F9IA 4O1MA 1E3LA 3M6IA 3PP8A 2RHCA 3P7MA 4FS3A 3VPGA 4GPD1 5JPIA 4DA9A 4Y6PA 5L3ZA 5B4TA 4K28A 4CMKA 1YDEA 2GCGA 4M55A 3P19A 4XQCA 3JYLA 4XYBA 4RDHA 2WE7A 5A9TA 3WJ7A 4W6ZA 3Q9NA 5F1KA 2LDBA 4TSKA 1CEQA 2Q1SA 3FD8A 2B35A 5I9MA 5KVQA 4BMNA 2WE8A 3UVEA 1Z7BA 1R6DA 2PWZA 1ZK2A 3ASUA 3GN2A 3HSKA 3VKUA 1EK6A 1H9AA 5GMOA 3TZ6A 3DMYA 1GUZA 4BNKA 1E5LA 1WVGA 2IXAA 5LDGA 3OFSA 4Z3DA 1DSSG 2P9CA 5I7EA 1HL3A 4YACA 5KKAA 4R68A 4DLAA 2X0RA 4IXWA 2B5WA 4MVJF 3ZNOA 1E7RA 2XXJA 4RF5A 4KUHA 3ZWCA 4BO2A 3DL2A 2J3KA 2NVBA 1N1EA 4GSLA 3OJLA 4FDAA 5KJEA 5CDGA 4HFJA 5U4QA 1FDSA 3IC5A 1KC3A 1O95A 4NR0A 4JXKA 4CM9A 3E1KA 2HO5A 4FW8A 1GPJA 1LNQA 1T2DA 1JW9B 1FJHA 1NASA 5IXSA 3DC2A 1Y8QB 4XGNA 4R51A 1A7KA 1V3TA 3JD1A 4NPCA 3WSVA 4PG6A 4BGUA 2PGDA 3T7EA 2Y0CA 1ZEJA 2Y1DA 2DBQA 3CMMA 4EEZA 3GNQA 5JSFA 1LU9A 4YAKA 1NPYA 2NWQA 3G1UA 3UCXA 3VZRA 4KZPA 3OH8A 4B79A 2X86A 4IBOA 4WNIA 5H83A 4IGEA 7MDHA 3QE3A 4IZHA 4JX8A 5I7SA 3V1UA 3LSYA 2GASA 2OOSA 1O0SA 2D3TA 1E92A 1HZZA 1EQUA 3WMWA 4QO7A 4J7UA 2NU6A 5TNXA 3DR3A 2PFGA 1ZNQO 1FXSA 4NBUA 3D4OA 1TB4A 3BHMA 5ENVA 1J5PA 4BNXA 3JTMA 1CWUA 4IUYA 4MDHA 2NVUA 1M75A 3WR5A 4YBZA 3OICA 2GN6A 4J2HA 1JKJA 3U3XA 4EUHA 1WLYA 4TRNA 3KETA 3A06A 4E0BA 4U6QA 1X0VA 4CM1A 3SEFA 1ZCJA 4WLUA 1Z75A 2EKLA 1DC6A 2NVWA 3TZCA 4IQ8A 4U6SA 4OOEA 4HY3A 2NU9A 3N7UA 4NK5A 1Q2XA 5FFFA 3VPSA 3QWHA 3E03A 1W8DA 1MP0A 5EN4A 5BSHA 4RVGA 1JN0A 4UREA 4R1TA 5I8ZA 4FFRA 3ASVA 4MVJH 3JQ7B 1UDAA 5COQA 1OC4A 1B15A 2UUOA 4MO2A 3BYZA 4IZIA 5ITWA 4CLDA 1PZGA 2AQIA 4ZA2A 2FR1A 1Q7BA 3QWAA 3D3WA 4HFMA 4K6CA 3AU9A 4YAEA 3WFJA 4TROA 1YH3A 1Y5RA 2VRCD 5G4KA 3WQQA 4CLXA 4RPHA 3IP3A 1LLCA 3H65A 1KC1A 1ML3A 1JVSA 3JYQA 4RO0A 3RBXA 3FWZA 2ZTUA 3PHGA 3HFGA 2VWQA 3JQFA 2ET6A 4N5LA 4L0QA 5JCJA 3HDYA 4AJ4A 2B37A 4LMPA 2BH9A 1DFGA 4AJPA 3IJPA 1U7TA 5I8WA 1EQ2A 4J16A 4XGIA 1WAMA 2NU8A 3WNQA 5ILOA 1WDKA 1HZJA 2J8ZA 4IQGA 2VNSA 3O9ZA 1GYQA 3FR7A 1HEUA 4ZRNA 4R9RA 3JYPA 3G17A 1E7MA 2BFAA 4JQCA 1JKIA 3K6JA 1T4BA 3F6YA 1ID1A 2G1UA 2X5KO 2Y93A 1I3LA 4XJSA 2QHXA 5BNIA 5FWNA 1K0UA 4NBTA 4NZ9A 3OA2A 1U3UA 3PHJA 3MWEB 1XIVA 1Q0HA 2VQ3A 4KWHA 5A3VA 3S8MA 5L4SA 3M2TA 4FC7A 5IDYA 4CUJA 3IJRA 3FBGA 5EMHA 4I5GA 2B69A 1VL8A 2UDPA 4BGEA 1LI4A 1H5QA 1O9BA 1YQXA 1C3VA 1OC2A 2WYWA 1R4NB 1Q0QA 1YL5A 3LYLA 3MOIA 1CF2O 3H2ZA 2QRJA 1DFHA 1D1SA 1L7EA 2FZWA 1N9GB 4AG3A 1E3EA 4TKLA 8ADHA 2VYND 2PGJA 3AOEA 6ADHA 3HN7A 3H5AA 3TQHA 3EC7A 4EITA 3ZWPA 2G0TA 1LSJA 4S1VA 5L4NA 1VJ0A 2O50A 3JQAD 4BV9A 3IL2A 2C2YA 1SNYA 1HDOA 4FJ1A 4IMPA 5THQA 4A10A 1R12A 1H6AA 5ES3A 1JTVA 4E2XA 1RPNA 4BNMA 3RUIA 4RF4A 3JQGB 1UR5A 1Y8QA 4GX2A 4JBHA 3PHHA 4P38A 4PFJA 5L53A 3BZUA 4E3ZA 4AJHA 5I9NA 3OJFA 2FMUA 2DUUA 2CY0A 1DC4A 3K96A 1ISGA 5EESA 4ND1A 2OBNA 1T2CA 4EZBA 4TVBA 4PN3A 3DFZA 1I24A 4JIGA 4CODB 2VRBA 1YO6A 2O3SA 3I52A 2X5JO 3SLGA 2IE0A 1ADFA 2UYYA 3PHLA 2OXIA 3WLEA 1IOLA 3E5RA 1U2GA 3JQ8B 4ZQFA 2P5YA 4J9VA 1NFQA 4CMHA 1OI7A 4BNNA 3HE3A 1Y1PA 3F1KA 4EJ6A 3QSGA 3LLSA 3JQFC 1C0IA 3ZU2A 5GZ1A 4CPDA 3H3FA 3KXDA 2WD7A 4LVCA 3RROA 1JWAB 2PD4A 5DOVA 4YRDA 3H6KA 3W6UA 1ADGA 3MJCA 3HNPA 1IPEA 1DO8A 1DHRA 1B8PA 4XQGA 1VRWA 2HKIA 2YFQA 1ONOA 1JKFA 4HFNA 4L4RA 1AE1A 4XIJA 4F46A 4CR8A 1FDWA 2I67A 4R16A 3FR8A 2FOIA 4WGGA 1LJ8A 1DHTA 2Q2VA 3DZBA 4E13A 3JV7A 1DJQA 2HU2A 2Q3EA 1Q7CA 4NU5A 4BO7A 4WOKA 2AEFA 2B5VA 2X0IA 5DP2A 4Z9YA 1E1LA 1O8CA 4E2WA 3RJ9A 3JQ7A 3C3XA 4MVJG 1NXQA 4XJTA 4EEXA 3AM5A 3WBFA 1LDEA 2PKQP 5F1OA 2FR0A 4A5OA 1PJLA 2O7SA 3BA1A 4GGOA 3TFOA 3DQPA 3CKYA 4MKXA 4WK6A 4Q3CA 4R9SA 4IJUA 2Q1WA 2Q4EA 1PJ4A 1YL7A 3ROPA 1HSZA 1PQUA 2D8AA 4J6FA 3ZW9A 4FOOA 3VPHA 1PGOA 1IB6A 2LDXA 4PLPA 4KWIA 4GWKA 3AOEC 2R6JA 3QJ5A 4PLZA 4ZVVA 5AQ1A 4URFA 4XR9A 5TRTA 1U7HA 1PWXA 1X7HA 3E5MA 4YT5A 4UEJA 1E1MA 4BNYA 4PLTA 5CFZA 1QG6A 3WGOA 1DLJA 3P5SA 4TKMA 2Y67A 3ORFA 3F1LA 3AOGA 3L6EA 1V0JA 1KY4A 1E3JA 3ZNQA 4RPKA 3H8VA 4HNHA 3Q6IA 1YS4A 3S1LA 3TSCA 2G76A 4MVJI 4DPLA 3GVHA 4E5YA 2IRWA 5KKCA 3PJGA 4BKOA 1ULSA 3I9MA 3S2GA 4DLLA 2YYYA 4YQYA 5EJ2A 4BNGA 2X9NA 3CXRA 3V1YA 4PG5A 2HMVA 4R1SA 4NNJA 4WECA 2JHFA 4NFSA 2GUGA 4B4WA 4BKUA 4BNUA 3FI9A 2H6EA 2A4KA 3IKVA 3PLNA 3QWFA 3AWDA 5B4VA 4WCFB 3ADPA 1H6DA 1NHWA 2EKPA 2JCYA 2QZZA 3H4VA 4YAJA 2DPGA 1R4NA 4FGSA 1U5AA 1NAHA 4PRLA 3DBRB 1Z73A 1DIBA 1N9GA 2FPGA 4FPXA 1M6WA 3DEYX 2Y99A 1E3WB 1XU7A 5HRUA 3GN1A 1NBOA 1NFRA 3PQDA 2H63A 3NEPX 4E31A 1RM3A 3LT2A 3I9OA 3FBTA 1R15A 3KEQA 3AM3A 4XYLA 4XYMA 3ABIA 3A28A 2NSDA 4YYZA 4OGWA 2CDAA 1BGVA 2J6IA 4GI2A 1KBZA 3IQDB 3F5SA 3JQGA 4N54A 4J3FA 2B4TO 4IM7A 4WUVA 1MXFA 1VKOA 4CM9D 1NTOA 3D4PA 1JAYA 4I08A 3RU9A 2VT2A 3PRJA 3NT4A 1HWYA 3LDHA 4DQVA 4EDFA 3DHEA 3L4BC 4NBRA 1EK5A 1DAPA 3DONA 4PLCA 2PZMA 2Q50A 2FZEA 2BFOA 3ICCA 4QFDA 3VDRA 4CR6A 3DZHA 3H9QA 4BOYA 4DRYA 4E32A 1G1AA 3EHEA 1BW9B 3OJ0A 2ZB7A 4UAGA 2OP0A 1UXGA 1F06A
chains in the Genus database with same CATH superfamily
1W29A 3B3FA 4H6XA 1V1RA 3M6UA 3FTCA 5H1YA 3VR6D 5C8VA 4BYMA 4X62B 5CH8A 3WIVA 4BU0A 5E6SB 1U7WA 1AHHA 3W8DA 3HJHA 4KBYA 1T0BA 2FSSA 5ENDA 1F7VA 4DR4B 2NSYA 2O3UA 3CJRA 3I30X 1JXAA 1HE8B 1P9NA 4UTVA 3FUCA 1T2AA 1NBME 4XUDA 3U9TA 3FOBA 2J0QA 1D4AA 4EJFA 1GNSA 2I3DA 1PZEA 2IPLA 4IGKA 4RS4A 2OBYA 2X3YA 3PUIA 4DADA 1XZLA 3BXGA 3U3RA 1GZ6A 4YR7A 5J47A 3VUFA 1BFDA 4D1YA 3W5AA 1Q92A 3H11B 1AUVA 1F20A 3I6ZA 3VOTA 5ELXA 3GLFB 1NXPA 2JEOA 2Q6KA 3HJRA 1ZJ4A 1P7WA 3F9CA 1M67A 4JT4A 3IAUA 4L9SA 2IPMA 1U0RA 3M70A 4ZV9A 4LWQA 4AJ1A 4BNDA 2ZTSA 2JKVA 3KKOA 2WTXA 3P9RA 4HBZA 1QDUA 4AWXA 3CC8A 4C3ZA 3PUHA 5KUTA 3CZMA 3FRIA 1EJ0A 1WY5A 4QJ3A 1DXQA 4ZU6X 3MHTA 3GJ4A 2WZCA 4C7VA 1S1MA 4MJ3A 3KU4A 1UCFA 2QN2A 3KL2A 3AY6A 1QRDA 3QM1A 4EO9A 3OPMA 2BEVB 4IIDA 2WBLC 1A50B 1JAHA 4DQ0A 2REXB 2DKFA 3OJOA 5DXAA 1QR6A 1E7WA 1F14A 2ESRA 3HUFA 4LWPA 3R1IA 5IKEA 1YZ3A 2P4UA 3SAJA 4E7PA 2WUEA 3LPMA 2HL6A 2AOTA 4PGFA 3T3PB 3TI7A 3OAAD 3L8GA 1L1RA 3UK2A 5KVAA 2XCRB 4KPUA 1U1EA 4K81B 2TSYB 4G5FA 3X2EA 3HBLA 1G63A 1SUFA 2E3JA 3W2FA 1S2DA 3IULA 1N3LA 2Q5IA 4AZSA 5CURA 2WVAA 3KPVA 2OLJA 2BEWA 4EHLA 2BDEA 3K70C 3DLHA 1XYGA 2A5DA 4GPBA 4AJ2A 3PPVA 4X45A 1DBQA 1P73A 5GM1A 2PS3A 5F7ZA 4I4TB 4UBIA 3OX2A 3TW6A 5BV7A 3QOWA 1YMVA 5JCJD 1IOVA 3JATA 3N2LA 4ZDIA 3SGLA 2AV6A 3NM6B 3BB4A 2OV4A 4KPEC 1XPJA 4E70A 1LPSA 3RT9A 1O08A 4W9NA 5TQ0B 1K6IA 4EKYA 4COKA 4M83A 1JEAA 4LGCA 4QA9A 3BSFA 1P4SA 3F4LA 3JX9A 4I4IA 4R1UA 4I5EA 5HW0A 4OHKA 2B4AA 4OXKA 1IUNA 1QO0A 3AMVA 1ZN8A 3A6JA 2JJ2A 1U3CA 4HH0A 1RRVA 2QRKA 4O0MA 1RFLA 5BSVA 4YRQA 5KNBD 2Q5FA 1JL3A 2N1BA 3ITDA 3HDQA 2IA5A 3G23A 5AI8A 3TR5A 5K3EA 1H6BA 1YR9A 4KLNA 4HH3C 1CETA 2CVHA 2Q0SA 1GSOA 3L5KA 4NPHA 3IPRA 4PYJA 4IDDA 4JC0A 5E6UB 4MB0A 1LPMA 2OAP1 4JBYA 4HNRA 2A0XA 2GBLA 1MRNA 4JELA 3VC1A 3G49A 4Q3AA 2RFLA 1P2DA 4MVJD 1T1SA 1P39A 2BGGA 5BO5A 4Y30A 1EGQA 3LQKA 3ZE6A 1PBTA 2XIQA 3FYHA 1VXRA 3ZXIA 3ZKWA 1RWXA 2GD0A 1XZHA 1OV4A 1ZK0A 2C5AA 2GFQA 3TQCA 4RD0A 4YP0A 2CVQA 3F3YA 4JLKA 4X00A 3UB4A 2IOQA 4QUEA 1W6RA 2DP4E 3W9BA 1UJ2A 2G8NA 3PDCA 1UKVY 1J9ZA 1HOXA 1X1RA 1DJPA 1MJGM 3EQ8A 4UD2A 5LQMA 3VR5D 3P2JA 2QMEA 4NYMR 4ICIA 1NVWQ 3VYUB 3ZLUA 3DJFA 4FE4A 3N05A 3OHPA 2ECKA 4ZT3A 3ZLTA 2FZGA 2PSJA 3ETGA 2WSLA 4AMYA 3M1AA 4CVNA 3DAOA 3ERCA 3UXHA 2FPPA 2HCFA 5CB0A 1GPH1 4CU2A 2DRIA 3WGLA 2QLMA 3D8HA 1J8YF 1KWKA 2Z83A 4TWJA 1P7YA 2YDXA 3LWZA 3MINA 5H4HA 3ZHXA 5FWYB 3AEUB 2DHEA 3TMAA 4JEIA 4OY3A 2JI6A 1P44A 1QLJA 1KYIA 4ZYZA 2A0WA 1CY8A 4Z9FA 4DNOA 4S1PA 1AQ6A 3PQ2A 4C5CA 4DUZB 2UZ3A 3BXEA 3F7MA 3AHHA 3NTUA 2C8KA 2ZI6A 4JLMA 2ZBFA 4YT4A 5CIYA 2I34A 1VG0B 3L7OA 2P9TA 2FPLA 4PPQA 4DFDA 4J0CA 4JP2A 3FSGD 1BW9A 4CNBA 1T91A 2OAEA 1G19A 4FYWA 3N2KB 1IZ9A 4IDEA 1P7CA 2O7RA 1JQBA 3NOXA 4AICA 1FMFA 3JQBC 1ZH4A 3I83A 1GYPA 2I4LA 4PTYA 5AW7A 3T3OA 1ZZGA 3M6MD 2BFPA 2BBOA 1Z8DA 4AUEA 3KCNA 3QF7A 1PG2A 4H3KB 1E0DA 3J7TA 4M8NE 1LLQA 4PYNA 4B3DA 4EYEA 3BIWA 1I5RA 3DEFA 2R0QC 2GCEA 1KO5A 2DQZA 4G8BA 5E2IA 1YTUA 1TQ6A 5EA2A 5JATA 1IBSA 1IWOA 1ZQ9A 4JENA 4RCYA 5CNMA 1Q22A 4YGXB 1ULBA 4BJ6A 4DA0A 1LI5A 1M1YB 3EGCA 4QLAA 4GYWA 1EFUA 5I7UA 1XEAA 2G5CA 1F6BA 2ZXEA 1SG0A 4IWNA 4D6XA 2W2LD 1DEKA 4OAOA 4BFCA 4YUAA 4JJFA 5K6AA 4S2EA 2XI4A 2BFCB 1NI4B 2O3JA 4MKGA 3GAFA 4S0XA 1TMYA 5IK2D 3U60B 1KY3A 1OZAA 1GFSA 1SZPA 2DBVO 3B2EA 4INAA 4UDOA 4X1YA 3SBEA 2BHNA 1B6RA 1A9OA 2ZB8A 4CKWB 4E5MA 3IKTA 2FDCA 3VR4H 4CLRB 2ZJ6A 3NBYC 4X0EA 2Y0DA 4B8YA 4GE0A 4D44A 2XWQA 4YIHA 4I2VA 3FFTA 1KQOA 5DLEA 3TEMA 1G7CA 4F3RA 2KSQA 1LBHA 5T3UA 3TB6A 2GEJA 2XTJA 1FUKA 3DTYA 5C32A 1WKCA 2EBFX 4Q00A 4UHKA 5FOVA 4CL8A 5CDSA 3ACBA 3V7YA 4DSAA 4E4TA 4OP2A 5TF0A 3HN2A 1GPYA 5CDHA 4HNSA 1NM5C 5DNEA 3ONEA 2PO5A 4PNPA 2WAAA 4JHLA 3OM9A 4FMPA 5EMLA 3VH2A 5F9HA 3E2PA 4FDVA 2XVMA 4RSRA 3VZSA 1OT5A 1ORDA 4I8XA 3TZQA 1L7VC 3KJZA 5KQPA 3GIDA 1RQRA 2X9GA 1LRJA 3AYXB 3TB4A 2C7QA 4E21A 4QWMA 2VDMB 3AF1A 3GGDA 2BCJQ 4IHJA 4HVLA 3I0ZA 5LA6A 1KK3A 1HR0B 4CMIB 3MGKA 1U1GA 4EZEA 4GC5A 3HUEA 1E1QA 1SRQA 3KQUA 1G9XA 1G60A 4CIXA 3M4XA 5JTUA 4DKXA 1X1QA 3K0BA 1G3IA 2WWGA 2PLRA 4RHEA 3U7RA 4IGFA 4M54A 2CZCA 3E2MA 4GBMA 1E9FA 1L8AA 3PPYA 4FR2A 4CMAA 3S2IA 1W46A 3W3AA 3FPFA 4G09A 1MJGA 4FOLA 3JZAA 4URUR 1SU8A 4L4XA 2Q8PA 1XMIA 1K3FA 4MQLA 1XXHA 3B3AA 5D6OA 2AEMA 2DCUA 2XB4A 4R1OA 5DI3A 2V7UA 3PHIA 3T5CA 1EMDA 3JAWB 1QYWA 4DIOA 2X76A 4Y2SA 3UN1A 1JP7A 2PGNA 1ZIPA 2WOJA 3W6OA 5LNK1 4OQQA 4IICA 4TYNA 1M7GA 3IV7A 1U5BB 3L8CA 1ZW1A 4N12A 4TMTA 3S2YA 3MTGA 1WP9A 5DKFA 2IHKA 5AH0A 4EFMA 1I3KA 4YR9A 3RRYA 2UAGA 2PFSA 2E7ZA 2VP9A 4JI8B 1N6HA 3I53A 1P2FA 2R7NA 1N1DA 1YBHA 2OCBA 2WV9A 2TECE 3OEEA 1T2NA 1YJ8A 3P2OA 4K40A 5AVOA 4ZFNA 1SD2A 3N58A 1G291 1VL2A 1ZMRA 3TSAA 2ZBPA 5DULA 5A7HA 4EQ6A 3EDRA 4L0CA 1MV5A 1TLTA 1MB4A 2JD1A 2H1IA 1N4AA 1NBMA 3QYAA 4HAYA 4FN4A 3WWOA 3IIIA 1Z9BA 1QZ3A 5HTOA 4FYYA 1NY5A 2QVZX 4X94A 5CK5A 2IU4A 3FN4A 1BCSA 2O2IA 4BLSA 3PL5A 1AHIA 2OD9A 4GPAA 3NWPA 4D26A 4UOEA 1VZ2A 1A1VA 3M49A 2V0CA 3TAHA 1E58A 2CNWA 3FXAA 1MNQA 4KNVA 4DY6A 2PY6A 2FEMA 2ZTMA 2NUBA 3RWOA 3NV9A 4GQBA 5REQA 1CVRA 1UH5A 3CLKA 3HYLA 5EZ5A 5KYKA 3A0RB 4MS4A 4AYXA 3EMBA 4DKJA 2VT7A 2YV5A 3O1IC 3EULA 2A1TS 3TYXA 4QECA 3KYIB 1OWPA 1V16A 4TV9A 3V4LA 2QTWB 2D59A 3M33A 1Q1BA 2I6TA 3HCBA 4G5XA 4M76B 3RC2A 4B73A 4EYKA 4XVRA 1ACJA 2W00A 1ILWA 2HMUA 4RD2A 4RLSA 2UUCB 2ZATA 4KK4A 2ZYAA 3BB1A 1NXOA 1EDOA 1T15A 1U28C 2Q0HA 5AVYA 2ZW9A 1KMMA 1UXOA 3BTSA 4ZQIA 1DIRA 3Q3IA 4PCAA 2CVPA 1LRLA 4PF1A 3X1ZA 1Q14A 5AHWA 1LPAB 4EM6A 1Z2PX 3K6SB 3GRYA 3GZNA 4NJEA 3SS8A 2E6KA 5BWLA 5J5AA 3W5DA 5CT6A 1QK4A 4FJ0A 2N46A 1IBCA 3TWOA 3ESRA 2ZRJA 4DB4A 2G5GX 5FOQA 3QNMA 5DNYB 3OEWA 4F71A 3C24A 2HIGA 3L7BA 2Q3LA 1AKEA 4H7EA 3TLGA 3NWJA 2WZBA 2EBWA 1I32A 3FGOA 4ZXPA 5ECWA 1YZNA 1ZKDA 3KDAA 4JVLA 4GLFA 1KHHA 3FTFA 2OD2A 4FCVA 2RGBA 1OT3A 1WO8A 5DM1A 2VPYA 4O59O 3C48A 5CNJA 4R3UC 3I42A 1CF4A 3QVVA 1A04A 3M5DA 2Q9UA 3L9XA 1PEDA 5CFMA 2MYTA 1TNDA 4Z4QA 4NEQA 5GWXA 1SFRA 2G9QA 4EUKA 3QITA 3T0IA 1LSUA 3AUFA 3TUIC 2X1MA 4WJKB 4CIDA 1TEXA 4KIWA 3KJFA 3VHQA 3G1TA 5ALPA 2X0FA 2F90A 4IXTA 2AH5A 3I1FA 3H7IA 4BWFB 2DUNA 3A4MA 3EY9A 4OL0A 3LCUA 5CEFA 5F3RA 2ZU0C 3DBHB 3VC3A 4ETIA 4A36A 1JALA 2V5VA 1TO6A 3WB1A 2IEDA 2HDNB 3RC7A 3JVEA 4DJAA 2ZYSA 4Q9JA 4AX8A 3ND6A 4QJBA 1C4KA 3JQ6A 1E9SA 2JPDA 1TZCA 5GGXA 4L9WA 3UJNA 1DWOA 2PWBA 4EVQA 2RHDA 1HV8A 1RXSA 2OCGA 1SC6A 1AD2A 3B20A 1BGWA 3HJBA 1J99A 1FLVA 3WSTA 1QMGA 4HAIA 2Y3IA 3L6DA 1E3IA 2IYTA 3F5DA 3G82C 5DGHA 3C1OA 2BFFB 2RH4A 2EG5A 4LQCA 5FOXA 3RK4A 1NQOA 3N0RA 1QRRA 1XEWX 4FOPA 5IM4F 5JADA 2ZWMA 4KV7A 2R6GA 4OHFA 1IATA 4A91A 5KOJA 4D6YA 3I04M 8LDHA 3S8YA 4XM1A 3IEVA 2ECPA 2X8LA 5MHTA 2C2ZA 1QM5A 5JMPA 1S2GA 1RWNA 4LZWA 2Z9BA 1QGOA 1LBIA 2WMOB 4QHYA 3MWDB 2WAMA 3ZGYA 4HDOB 3T38A 3K2EA 3H1GA 2HQRA 2WFLA 4WCVA 3C6YA 5AM5A 3MB5A 1Y81A 4YV0A 4H1WA 1W30A 3EZ9A 1FLDA 4AQ7A 2WIBA 4R40A 1VJ1A 3GD5A 5F3DA 3AFHA 5IKOA 4WKPA 3UAZA 2NXJA 2F00A 3GJXC 2HMTA 4D25A 4FWTA 1RPAA 2XW6A 2J7PD 3WHLA 2A35A 3LL4A 4TMVA 3JQ9C 4HTFB 2WSBA 4OXIA 2B6NA 1OUMA 2XMPA 1RLTA 4P32A 1HQCA 4EDHA 3VNUA 1Z62A 3JD3A 2ODBA 3ZI0A 4FEAA 1L5HB 2PG3A 2JLBA 3W1VA 4NCHA 1F0NA 2I7XA 4UEWA 4GKKB 1U3TA 1JG7A 2YVAA 2JH8A 4M1OA 1X1TA 3AHDA 2FU5C 1YXMA 4OK5A 2PJRA 1AXEA 4P3YA 2QROA 1ESDA 3ANLA 2DC1A 3KBOA 3ZY4A 5JYDA 1I7DA 5BXQC 1K6EA 1IEVA 3AUYA 3QPBA 4RHYA 4FK8A 4H0FA 4HCJA 3Q7QA 3DHYA 1AO0A 1X2BA 1G5FA 1W2HA 2OYSA 1ZWLA 1PZFA 1KAOA 2NZUG 1XYVA 4M9QA 2J0UA 5B64A 2B4YA 2WYIA 1JKXA 1QPGA 4RXMA 4JDUA 4FE3A 5F4BA 2DPLA 2QN8A 3QLUC 4MROA 4ZT4A 2RKBA 1UK6A 4MZXA 5JCOA 3WC4A 3U6BA 4YP6A 4IH9A 3QV2A 4JN6B 4LYJA 3WYDA 1MVLA 1RI2A 1XUOA 3CRMA 3GMIA 3L8ZA 3MRXA 4IDGA 4IV5A 1HYGA 1SIUA 1AUXA 4S35A 4EJ2A 2X5OA 1K5PA 5GJCA 4LPSA 5DEOA 4NU0A 5G3YA 3R3JA 3TINA 1W1UA 1MABA 1GZ3A 1X86B 5BYAA 4P81A 5ITZB 1MPXA 1PWHA 1XN4A 2O8NA 2YRWA 3FJ1A 3N7TA 3NBQA 3QVSA 1AKRA 3PI7A 4MYDA 3AVUA 1PUIA 2G06A 2D5IA 4RORA 4EA8A 1RQ2A 1AO3A 1BX1A 3CRNA 1X1CA 1MFZA 3I6BA 4NYIQ 2CXNA 3AY0A 5CYOA 1UDXA 2WJ6A 4JJKA 2VTKA 5TY0A 1EXMA 3HVUA 4FFPA 3U1VA 4CN8A 2XCIA 4GW3A 1KDTA 3TDKA 1SA0A 1SB8A 1BXGA 5JZMA 2KJQA 2J5BA 3B7WA 1SHJA 4CUKA 5J4VA 1OZ0A 3ZGOA 1YC2A 2IKSA 4KI7A 1PNTA 2JGDA 1FSSA 1B00A 4F4CA 4Q9AA 1WMEA 4Y2JA 4R0NA 1CP3A 5JFOA 3TRFA 4MCHA 4AFNA 1HT3A 1ZDMA 4REMA 4YUVA 3TUZC 2XKJE 2RHTA 4XVCA 1JHUA 3AZPA 2ARKA 4LMRA 1TVKB 4CV0A 1SQFA 3ANNA 2MSDB 3CLUD 3WKBA 4LE0A 2I3BA 3PNBA 3F7TA 4FWBA 4JR1A 3UHAA 1LJUA 2NSLA 1TT5B 2F48A 1QHIA 3U4HA 5L40A 1KJQA 3KEFA 1YZKA 2BP7A 3MSCA 3PTLA 3QPCA 4HN2A 1PR2A 4Z2YA 1EX9A 3U19A 1Y33E 4N39A 5GJWC 3ZCTA 4ENPA 4JLWA 3DL7A 3I04A 5KJCA 2Y1FA 4O2BA 3ZGNA 3QE4A 4G5GA 3ZDDA 3AUUA 2IHNA 1HYHA 1NAIA 2GOYA 1N8KA 4E5NA 5IT5A 2R8EA 5EHNA 1QB8A 4UVHA 2N3ZA 5C3UA 1KS2A 2HX1A 4WLNA 3ZHRA 3N3BC 1U2GC 3H42B 2OBMA 2TS1A 1G3QA 4GI1A 3KT0A 5FTLA 5LQNA 1P3DA 3ZGLA 4NOJA 2C7PA 4OYLA 5EL0A 3TTSA 5JJCA 1EX7A 5G40A 3STUA 1PKEA 4HDRA 4KYIB 1SBZA 1SCQA 2YKGA 2GZ3A 3IQXA 2W2TA 1OAKA 2Y9PB 4MHSA 3C3KA 5HKKA 1KAGA 3CF4A 4EY5A 3U7HB 1T8WA 3D7SA 1D2MA 3EVTA 3EIFA 2GK7A 1OFTA 4YCJA 1AQLA 1PDVA 2XF8A 3R3WA 3C3EA 2UYCA 1VCIA 3KXLA 2V6FA 3U37A 3HJAA 1G1MA 1W47A 2YJGA 2GN0A 3FHJA 3TPFA 1RWOA 3QWIA 1VIVA 3DTVB 3MCUA 3OJXA 5KAMA 3R44A 5KYWB 1YOBA 4C14A 1UK8A 1Z5GA 1LLDA 4LHVA 1RLIA 4JLAA 4Z0TA 4ALKA 4Q4CA 4YT8A 1EM8A 3ZGZA 1N5IA 2GPSA 1IN7A 5A6SB 4L5IA 1Z39A 3RG2A 1AK9A 3TNFA 3KKLA 3GMDA 4XYEA 4WBNF 3ZIDA 3DOOA 3DE1X 4JOBA 3TIFA 1LH0A 1XFDA 3ZWBA 4INOA 4CQNA 5DU2A 1E77A 5FAXA 3TE6A 1RYZA 3DW1X 3G1WA 5HM8A 2WB2A 1QYRA 4F12A 2NYAA 2VYVA 4YXWA 4K2HA 1NI3A 2OEPA 4ZI7B 4ZGGA 1MTOA 3MF4A 4TWRA 3NBAA 3U4IA 4EB0A 1ORIA 1FF9A 1J09A 1Y8RA 2FMXA 3D7LA 3SF8B 2A78A 3GRRA 4BHHB 3O4IA 4N5MA 1NYTA 5A0TA 1W0JA 3EA4A 3N8GA 4C01A 1F8FA 2QTGA 2DWQA 3OLVA 2HBQA 3A2LA 2W2KA 2EGHA 5JNWA 3C6KA 3AC0A 3OD5A 3CLRC 3D0OA 5TLSA 1XJQA 4GX5A 5F2NA 3BMOA 1KEUA 4GM1A 5AVQA 2HIMA 4X8MA 3IUJA 3ZDXB 3K3PA 1C80A 3L04A 4XX1A 2PKRA 4P7FA 5AXCA 1FU8A 1X42A 4BVLA 4M1YA 2G71A 1RMTA 3DW3X 4YCCA 1UC9A 4HWKA 4H4EA 3KTOA 4DR3B 2X4IA 1VKRA 4BE4A 1QHHA 2UV8A 3I9V6 1UMBB 5CCXA 2PU7A 1A9SA 4IDBA 3DLTA 1QFMA 3DTNA 2W4IA 1AUPA 1L5LA 1UP4A 2BMDA 1KORA 3L3BA 3SS7X 4F2DA 3ZEIA 1OLUB 5LVAA 3QMPA 4B6OA 5A5GA 3L6BA 5EJ8A 1YVEI 1PS9A 1L3IA 4FCCA 4KGVA 4LOLA 2Q62A 2Y6VA 3OPQA 1SUEA 2XTAA 4YJHB 1Q77A 1EVEA 5A02A 1IQ0A 1NI5A 3LC7O 4NENB 5T7BA 1UMCB 4EAQA 1RLJA 4YFVA 5AWFC 1TI7A 3UK6A 2O6LA 3VI3B 3F5FA 5J58A 4MO9A 5A62A 3KKZA 4KNYA 2JAQA 4JJAA 5AOVA 1Q11A 2ADMA 2PV0A 2VR1A 4TWIA 3VOAA 1J2EA 4GOOD 1P0CA 3GLSA 4OXRA 3R7LA 4BNTA 4IOKA 4JOQA 2CB0A 4PV7A 4YAWA 5A5FA 4FHDA 1JEEA 1DNPA 3BN3A 4K9NA 1P5RA 3PXXA 2QG9A 1FL9A 3IIEA 2NTVA 3KXPA 3BWBA 1NLMA 3Q0TA 5BMVB 3WGKA 1E18A 1S9HA 1F6WA 1OASA 2FSHA 2VDQB 2ZIVB 3BBPA 4G8CA 2OBBA 1XF1A 2FN7A 1S3GA 2KBFA 3ASZA 5BSGA 3CRZA 5KYXB 121PA 5AVKA 4EB6A 4MPTA 5J1SB 3I6QA 3ZU5A 3KXKA 3ZZNA 2VJPA 2YWJA 4BJ1A 4F4JA 5C5EA 4DA8A 3HV2A 5DH9A 3D64A 4WKCA 1IWBB 4CG2A 1QGZA 1XL0A 1AH2A 1LI7A 1WUKS 4QPNA 1BS9A 5IG2A 1IY8A 5C4MA 2PBFA 1D0IA 5LP6A 4WOCA 5AK5A 4HX5A 2Z08A 1EJ6A 1V5GA 3M9XA 4I14A 3GLIA 1M2HA 2B8TA 2QKYA 3TUJC 2IF0A 3GJYA 3LG2A 3AJEA 2XXAB 4EYGA 3PU6A 5K8LA 2VF7A 1TUGA 2V97A 2ZPUA 2R1VB 4JP8A 2UZ1B 3L79A 3TZLA 3OT1A 1QV7A 2CHFA 1DX6A 2P7IA 2WFZA 3DBVO 1YF3A 2FX2A 3L7DA 4Q6WA 1JQJC 3ZDRA 3LCCA 1V4VA 3PUWA 1RM4A 5GINE 4MCAA 5IC4A 2FHPA 3ZD6A 3ZV4A 2WIFA 3HUDA 5CDTA 1TX4B 2P90A 1IHOA 3GRUA 3MAJA 3HDHA 2QZ9A 3WTCA 2XKKA 1YZHA 4HC4A 2XCTB 2GN8A 1EFLA 1UJBA 2H2IA 2OV3A 2W9XA 3AJAA 3ES9A 4LY9A 2JIOA 1WKBA 3R7SA 3ICPA 4PHGA 3P5BA 4Q05A 3AVVA 1N92A 4MARA 2VZ0A 1XWFA 5ERXA 4HWGA 1WW8A 3HP4A 4Q5IA 2W98A 4U1RA 1T5HX 1HBJA 3IEXA 4EG5A 3RT1A 2PH3A 3V1KA 2ORYA 3B1XA 4ND8A 1O4VA 3GNTA 1NURA 2YNMC 3RADC 3OMXA 4XRGA 1P4RA 1PV4A 1KU6A 3C1AA 1P74A 3T0FA 1EFTA 4QXRA 2P1RA 2W4QA 3UENA 1HQKA 2R8PA 1R6XA 1TZJA 1QGUA 1MRZA 3EQ6A 3ZCRA 2YHIA 4DC1A 3NUGA 1EHYA 2C8JA 1ZOSA 4NY1A 5JZVA 3UWKA 1WTCA 1BKSB 4G0NA 3ICVA 3MELA 1I6KA 3NTVA 4C7BA 1J0BA 1DDGA 1BOFA 1Y5LA 4X61A 2QBYB 1H8HD 5CTAA 5CFRA 1UPXA 3IODA 1Y5IA 1XQ6A 1RHMA 1AIPA 2XRFA 4V0LA 1KDZA 5LOVB 4CEJB 2RCYA 2JCVA 1MJ5A 3G6KA 2PGOA 1OF1A 1YJ5A 4G0MA 2GKOA 2WJWA 4X85A 1ND5A 2B4RO 2Y71A 4QXOA 2QUIA 5F23A 4EMTA 4CFYA 4LECA 4P4TA 3WK4A 2LW7A 1OILA 4RDXA 1XQWA 4Z9BA 3LDAA 1FSGA 4YAFA 1P18A 3WWZA 4CEHB 1UDBA 4KQHA 1TU4A 4MGEA 1NDQA 2ZJ8A 5EHGA 3Q9LA 1T1GA 4ZI5A 3LYHA 1T9GS 2JFFA 2H9AA 5A9SB 1J2JA 5JH7B 2J0EA 2V55B 4HDKB 1CQPA 5B53A 3ZE7A 3RSQA 5KZMB 3EXFB 1PT8A 2RGWA 3E5HA 4QTUB 1IXZA 1FNMA 2R86A 1RBQA 1GFWA 5ALEA 10MHA 1T8RA 4LY0A 4DM7A 4YRSA 3X1YA 3I8OA 2WJJA 4QOSA 3D6HA 1Z0FA 2JLAA 4ALJA 3UT5B 4QDOA 4KX3A 4I19A 2G4LA 4KDEA 3EK2A 4G89A 3U3JA 3JPYA 4YMHA 4ZICA 3PNOA 2OR3A 4ZOLF 4ZQGA 2ZSJA 2VBIA 3OTHA 1JFLA 2D7DA 4QDTA 4GPIB 2J3JA 3Q3HA 4LQLA 1MJFA 5ALDA 1AKNA 2PUEA 2CFSA 3LF1A 2WUFA 2AJDA 3A1SA 3DBIA 3ZN2A 3V42A 4IHKA 1CNEA 2ZSDA 1CR0A 3IEUA 2V9CA 1BH6A 3AEKA 4N3NA 2ILTA 4ZAXA 4MVCA 5CAEB 4FDTA 3LBNA 3NAZA 1P2TA 4LXHA 4Q3KA 5D3KA 4UCXA 2DXIA 1M5RA 1AGRA 1QIKA 5D3MB 4NQRA 2ID7A 2ZIWB 3MEQA 2FNAA 4RY2A 3HMKA 1RC1A 3WAJA 5AJHA 4MTLA 2ZAOA 3TD9A 1E3QA 2WW8A 3R3SA 4I9FA 3SZRA 1VPTA 4D3YA 1MB9A 1I3MA 2RKOA 3IAHA 3IQFA 5GONA 1LCIA 4HSEA 4F6RB 3DPIA 2J6CA 1J22A 2OM2A 5JFTA 2Z9DA 3NGLA 5I9SA 1JLHA 4TLCA 2RIRA 2QGFA 2EGGA 3EXHB 3MM4A 4PLWA 2VJMA 2VJDA 2XKBA 2LVBA 1KAQA 4Q3BA 1U99A 3L77A 3GT4A 4P4LA 5HMMA 3GDWA 2XQFA 3PNKA 1YDWA 1WZEA 2A9JA 3B36A 2RK4A 3QBTA 2JFUA 3EIHA 1HG0A 1YK0A 1VLZA 2A5LA 1DG1G 2I22A 4B7XA 5KPJA 2DETA 1U7XA 4M7WA 1NU6A 1EFPA 2PS0A 2P3QA 2RH9B 2VOJA 4L0MA 3OZCA 5NLLA 3FHLA 2HZ7A 3V32A 2OZPA 3EODA 3WY9A 1UBHS 4F8YA 3E58A 4KN5A 5G0VA 2G9NA 3PNYA 4PFQA 3HP7A 3O8QB 3AZOA 1NRXA 3PWZA 3R41A 4YPFA 1T8YA 4O02B 1Z4QA 3D2BA 3X1DA 4AJOA 2N42A 5J2TA 4L6CA 3KYCA 1U8XX 4IF4A 4XWOA 4Z4CA 1KR5A 1ZESA 2O0HA 1S7CA 1JJVA 3O26A 3Q6MA 1ZOOA 4N6OA 4ENTA 4IR7A 4P0QB 3PD0A 1NMZA 1YBVA 2ATEA 3OWXA 3Q11A 4IDQA 3G9XA 4RPJA 4B4VA 1THGA 2VYFA 4RKRA 1VC2A 1KR2A 4ARVA 4C43A 3EVGA 4S1WA 3IMFA 3CPSA 4WZBA 4A92A 3CH4B 2K2WA 3OTIA 4D7AA 2V98A 4LRUA 4IW3B 4B6GA 2IV3A 2E21A 4YMVA 1J7JA 3G02A 2VPZA 4R2WA 4GSKA 2O48X 3ZTWA 1CD5A 2YXDA 4QT0A 1HYQA 1UT5A 3KAKA 3LDGA 3T35A 1O2DA 1ABBA 4FR5A 2ODWA 2XVZA 1X1DA 2D5AA 1LWOA 3HXPA 4D74A 3CLUC 1A4XA 1GZHB 5C34B 3IXQA 4ER5A 1R7RA 3BMCA 4H4DA 3T1QA 1T0UA 3NNSA 4URVR 1NRWA 4Z3KA 2QRVA 3G2MA 2AW5A 3V8NA 2BBTA 2DLNA 3HBJA 1HKUA 1A97A 1GZDA 2R8ZA 3A6KA 3IT1A 4LY3A 4UPDA 4UHDA 5J23A 3VR2D 4Q3OA 5FPYA 3STWA 4YRZA 3JARB 1FRNA 4N18A 4Q93A 4YJKA 4HGRA 4QPCA 4Y6OA 1LLUA 2CJWA 1X74A 4CT4B 1I7QB 2WD8A 2HU7A 1PHRA 2WWVD 2I8AA 4JLSA 1S4MA 1MX9A 3PYLA 3GJ0A 1HE4A 3DAHA 3JW8A 3FNQA 2OP1A 4X7RA 5DIFA 2GPJA 1I33A 5J9FA 5FXMA 4D3DA 4DNPA 3DB2A 1XTZA 1CB0A 2FXVA 4Y9TA 4N6GA 3AL3A 3GW8A 5CR9A 3UUFA 1KFEB 2PL3A 4B74A 4Q1BA 3COYA 4BAGA 4G1FA 4XSGA 2MYPA 4K9LA 1F2TB 4KLCA 1IUOA 1MOZA 4U7TB 4M0LA 4C0LA 1TYDE 1DMRA 5F52A 2ISSD 5AVRA 4YAIA 2GD2A 1IN5A 4V0ME 3GG2A 2B4KA 4BO6A 2G77B 4FGJA 1SJ9A 1KFCB 3KNZA 2XV1A 3R6WA 4Z7JA 5LP1A 3QKIA 2PKYX 4U3JA 4UAJA 4LDAA 1M54A 3T5TA 3ODGA 1U0FA 3W6NA 3IEKA 4KHPB 5L45A 4PIPA 1W48A 2IDMA 2Q7DA 1T5BA 1DU4A 2E48A 2H18A 2PSDA 3M6XA 3F96A 4L2IB 2LP4Y 1U2DA 3EUEA 2DMRA 4YJ2A 1RRMA 4FFNA 3NDRA 3E0QA 4F85A 2IYQA 1JEOA 3SKYA 4BMPB 2PGXA 3KO8A 3WYGA 4N3AA 3EVEA 3HGMA 5GVSA 5JR3A 2PKXA 3M4NA 4QQ8A 4QPJC 1CP2A 1OIVA 2HF8A 3MWGA 4HGQA 1KYVA 3AJRA 3PF8A 2ZUEA 1ZJWA 2C2WA 4Z8XA 2IOFA 3HDJA 4FCTA 4X6XA 3ZWNA 3ZDZB 1ZNYA 1HE2A 1LK7A 1P61B 3G0BA 1L4MA 1DUIA 3W4IA 2IOHA 5HKAA 1WXEA 2V8BA 4XH9B 1JDUA 3EXEB 2VTVA 4LJRA 2GEBA 3BH7A 2CL0X 1GN9A 4LXGA 4MKHA 1B74A 3E9RA 4QIHA 4BHTA 1TJYA 1VI6A 2QF7A 2FPXA 3SMVA 1SK8A 3ZWKA 4YHHB 1KO7A 5H3LA 1L1FA 2J5KA 1SOUA 3VUEA 3TPCA 1N6OA 3FCCA 1Z36A 3QW2A 1FFCA 3OUZA 1A9ZA 2F8TA 2OHJA 3E18A 2H57A 3GWGA 5L7TA 1JIQA 2JJ1D 1BD4A 3QW4B 1QF9A 2P5SA 4MA4A 5T64A 3TQSA 1UM9B 2OHOA 4ZDJA 5JH7F 4URHA 1U5CA 2Q3JA 2BF7A 3M3PA 5HBRA 3U26A 1RI4A 3QXSA 5EZYB 2E4XA 4Z4EA 3FNEA 5FX2A 4MR9B 4QNMA 1C3EA 3KRTA 4DAOA 1PR9A 4J8PA 4JQZA 5JLJA 4RD3A 2R6HA 2VYQA 2FDXA 3HCCA 4G4GA 3W8FA 2O2YA 4ZVSA 3LXXA 1VSUA 1B3RA 1ZXLA 4CM4A 2E18A 2IJGX 4MUEA 3SQXA 3CEMA 4WLEA 2YDYA 3F71A 2HCBA 4KLAA 3TLXA 3EIUA 3I9KA 2PGAA 2BMFA 4L8YA 1H0HA 4QRHA 4PWYA 1NQTA 2Z9CA 1R6TA 4F91B 1JVNA 3C8ZA 1POXA 1YT5A 1Y6RA 3HRIA 1VLJA 1AKYA 1N4DA 3UK7A 4ESHA 3P26A 2AOUB 4ZIRB 1N3YA 1TFUA 5B1HA 3UCEA 5FTWA 2WJYA 1M0EA 3FE2A 1FSPA 3L1KA 1XDUA 4DMCA 5ESDA 3PQ7A 3V8VA 2F8MA 5KYNA 1ID8A 2C1EA 2P2DA 3SKXA 1QH0A 1XRJA 2VT6A 1G6Q1 2OLEA 3HPQA 1EE1A 2GZ1A 5CFLA 1N36B 2A9RA 2ZCUA 5TSDA 5M29A 3SJUA 2MSLA 5IKPA 2VUUA 4LX8A 3K0CC 3A4VA 3OE7D 1WB9A 1PGJA 1DRJA 2QAIA 2VHUA 3V5NA 1AQJA 2HY7A 1Z37A 2RAVA 1KVQA 4U9IS 2POCA 2ZJ5A 4LI0A 3KT6A 2XOXA 3MA0A 5DYWA 5LLSA 4LNAA 1XLWA 2YY7A 1C0PA 4ZZ2A 4AF7A 2OUIA 4QQKA 1SQ0A 2XGGA 2J6BA 4HG2A 4A7PA 1JT2A 1Z34A 3SXPA 2BFDB 1JPUA 3UT6A 221PA 1JBQA 1XCGB 1I0ZA 3FG9A 4B9EA 1AQYA 3NALA 3OPYA 5EYPB 4CF4A 1U04A 5H16A 1PUXA 3AR5A 3P0RA 3KE9A 4ZANA 3ZLBA 3UY4A 1EXDA 4MR7B 4FZRA 3ICOA 4LWZA 2FEAA 1BGXT 4KN8A 4M37A 4ZVQA 3UMFA 3BIJA 5GPBA 1MQSA 1ODSA 3VISA 4ND6A 1ZI6A 2WU0A 1ILEA 4E5UA 3DLBA 3H8WA 3T7JA 2BYTA 1U0TA 1VLLA 4N7MA 3KHUA 3X1JA 1A72A 1FDVA 4GT1A 4OKSA 3P0EA 4GEKA 4IQ0A 2WF8A 1OBFO 4QDXA 1T8SA 2G7ZA 4V0OA 3R4VA 3DCYA 2EWWA 3LBIA 3JALB 4Q9IA 4ZPXA 4DARA 4JYAB 1JTEA 1K2VN 5BWNA 1WD5A 3MXOA 1C0LA 3SQDA 4G1EB 2ZJ3A 3WDKA 3OJCA 4OA5A 3O1JC 2IE8A 1R8YA 3PUYA 2PKQO 4BVAA 2ZULA 3K0AB 1KDOA 3CNOA 1PCXA 3WI7A 4RHXA 3VVBA 4DR2B 2OZLA 2AHRA 4MWGA 1PEKE 1RZVA 1RACA 2IHVA 4FKBA 4YAOA 3WLLA 1E2IA 2FSPA 3KTAB 3T34A 2GN2A 3HKEB 1XT6A 3H86A 3N1UA 4LC9A 2HU8A 2X8JA 3EOAI 1R0ZA 1UDRA 1YB7A 2XYVA 3A1CA 4QVIA 1XZ8A 1LQTA 1QHFA 3RYFA 4XX0A 1E66A 2GLTA 1RRKA 3ZGXA 4INZA 4ZJUA 3CNHA 4G0UA 3R3UA 2FUEA 1V47A 3FNBA 2DT5A 2HNBA 2Q3BA 5BV8A 3EVBA 4WESB 1J8FA 3DZ8A 4KMSA 1FS6A 4WXPA 4ON9A 3GJ6A 4C5AA 4XIYA 4Y2HA 5LKAA 4DCUA 1JZQA 1W88A 1N6PA 3H0CA 5AW1A 1PNOA 3L4BA 2AHOA 1Q3TA 3L8EA 3PG5A 4FFDA 4BEBA 4ER7A 2CV0A 2B9EA 4Q7EA 4KWCA 2I03A 4P31A 1BMFD 1DLIA 5JY1A 4KIJA 2BEKA 1RFGE 5AKEA 4UU7A 5B36A 5KWIA 4ZJYA 1EVJA 3DEIA 3DTVD 1ENYA 1IVNA 4FD3A 5AIAA 3TX6A 1HE5A 3FZYA 1I4EB 1WL8A 3DV0A 2XE7A 4HL6A 4IEIA 4L28A 3T0GA 3B8HA 3EN0A 3HY4A 4PG4A 3WYEA 4II2A 2O8EB 4XB1A 3WKCA 3IIJA 1JA9A 1Y1TA 3WFIA 2R84A 4D8UA 4E2WA 1JHYA 3D3EA 4F45A 3FYUB 5LMNB 2V5UA 4D0LB 1GY8A 4G6ZA 3F6CA 4JJGA 4F4IA 3FMGA 4UFPA 3CCBA 2ZQZA 4GHWA 3VMFA 3QVTA 3R0IA 3MFYA 3USZA 3C5WP 4ZVOA 5BSKA 1U0EA 1T5TA 3B3QA 4KE6A 3HXQA 2QJOA 3RCBA 3NW9A 3MD0A 1Q7GA 4YJFA 5FUYA 3RUHA 3E3NA 4PAOA 4IG9A 4EPTA 3IQGX 2OL4A 4CNQA 3BICA 3LLVA 3N86A 4QEKA 1XA4A 4MIEA 3JCZA 3TW4A 3K1ZA 1VKNA 3D1VA 5DFAA 1QNLA 1WCWA 1GDDA 2R00A 4ZP1A 4DVJA 3EPPA 4TKZA 4ZCMA 2FPKA 5DBEX 1X77A 2X23A 4LMAA 5HA5A 4AKIA 2DJ5A 2C7GA 3NHRA 5EJGA 1CQWA 1D5WA 1PEYA 5C7OO 2RI6A 3GMTA 4PC2A 1Q16A 2WMNB 1ZMOA 1MPTA 3JAKA 4R2KA 2YHUA 1FYVA 4AF6A 4EGAA 1FW6A 2VF2A 1SO8A 3KFLA 2DBZA 2OCDA 4F0JA 3EUWA 4WERA 1NNSA 5DN6D 4CETA 3BTVA 1AM4D 4TMYA 5JBNA 3B5IA 1Q1GA 5L9AA 1QZTA 4ZEVA 1QVAA 5LUBA 3KYDA 4F97A 2C2BA 4CKBA 1IULA 2RK6A 2ZBQA 3H05A 4Q4AB 3WK7A 1MMFB 3W9SA 3PHBE 4YCMA 2G0AA 3ABQB 4L08A 2PL5A 3P4XA 1M0TA 3BMQB 3ZX5A 5COAA 1EVKA 4PAMA 3PTAA 3BREA 5JZSA 3I39X 4B7AA 3GJQA 1JE1A 1N0HA 3OF3A 2VRCA