3RUHA

Alternative analogs as viable substrates of udp-hexose 4-epimerases
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
341
structure length
336
Chain Sequence
YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternative analogs as viable substrates of UDP-hexose 4-epimerases
rcsb
source organism Plesiomonas shigelloides
molecule tags Isomerase
molecule keywords WbgU
total genus 125
structure length 336
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ruhA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3ruhA02
2A9FA 3KSZO 3NTOA 4BUCA 3DQPA 1ENPA 3EY4A 4IZIA 3QVTA 2GGSA 3VPSA 4RPHA 4OKIA 1KBZA 4CM9A 4OSOA 1E3LA 4XQCA 2V7PA 3Q11A 4BNUA 3SC6A 4MVJD 5B4VA 1R0SA 1JKJA 1KEWA 2HO5A 2QZZA 3F6YA 1HE5A 3DFUA 3GRKA 1HRDA 2FN7A 3JQAD 2E4AA 1GEEA 3RKUA 1P0FA 2W4QA 5KVSA 2VWQA 1V8BA 3I9KA 1LQUA 2FR0A 4RVHA 2J3KA 4R51A 2X5KO 1B0AA 1ZUD1 1CETA 4EUHA 3G1TA 1GTMA 2O7QA 5L4LA 1SPXA 5JYEA 2YFQA 5K6AA 4YQYA 3PWZA 1M2WA 2Q2QA 4NK5A 4P8RA 5F21A 3NGLA 4D0SA 1L1FA 1ISIA 1VJ0A 4U0KA 3RUDA 1KVRA 2CZCA 5FYDA 1A9YA 5DDIP 2VOJA 3WGZA 1V3VA 4ZA2A 1LU9A 5KVCA 3T4XA 4IJWA 2JD0A 3QE3A 3SJUA 2VHWA 4GLOA 5COBA 1BXZA 2B83A 3HB5X 3H5AA 3G1UA 4CLOA 4F6CA 3HDHA 1HXHA 4CMCA 2VWPA 1YOVB 1V9LA 3NT4A 2Q1WA 4BO3A 2R00A 5A9TA 3JTMA 3AU9A 1YGYA 3TZHA 2Q99A 3VZQA 5I7SA 5DZSA 4GKBA 4Z0PA 4NBWA 3FF4A 3ZWXA 2D2IA 5L3ZA 2YHIB 5JDCC 4BV8A 1HYGA 2AA3A 4EUEA 1GFSA 3L0DA 2BGMA 4K26A 5TX7A 3TN7A 1XU7A 1EVIA 3ZV6A 1QRRA 3IOYA 5DCYA 4HV4A 1GYPA 4MP8A 3RI3A 5TIIA 2BFMA 1KEPA 4XB1A 4GGOA 3G0OA 3QWIA 1W8DA 2NNLD 4NNJA 4D79A 3RUIA 5KIAA 5COAA 3KV3O 3HUDA 2VHZA 3IKVA 5IXSA 2TMGA 1HDOA 2GASA 4NBUA 1RM0A 2P4HX 4O63O 3WICA 4AVYA 4W6ZA 3AUUA 1PSDA 5ENDA 1DIBA 2VZ0A 5BNFA 3DTTA 1U7TA 3CE6A 4INAA 4I9NA 4ZQEA 1HWYA 1N92A 1XYGA 3K30A 3QWAA 4TVBA 3GPIA 2IEBA 4QO7A 2JAHA 4YT5A 3SX2A 2VT3A 4DBZA 1GY8A 3D3WA 1TEHA 3K31A 3WIDA 1KEUA 4R9SA 4W9NA 5ILGA 1XR3A 2VN8A 3DHNA 1YDWA 1YBVA 2QG4A 1ZSVA 3KSDO 2Q46A 3LLVA 1PU2A 2EJWA 4L4SA 4YTEA 3M2PA 1HL3A 1R12A 5C7IO 1Y1PA 2NU9A 2PD3A 1D1SA 3LF2A 4FCCA 3GDFA 3B1JA 3NJ8A 1W6UA 4FIZA 5DN9A 1YE3A 3GEMA 4Z9YA 5JO9A 5B4UA 1MUUA 4K6FA 5JDIA 1GQ2A 1AUPA 2WD7B 3CIFA 1P1HA 3AOGA 4WCFC 3HZZA 1TT5B 1W73A 2D5AA 5JO0A 2W98A 4R5MA 3Q9NA 3RBVA 4B4UA 2A94A 1LBEA 1QLJA 4ZQGA 5BSGA 4CL3A 3U4HA 4ZHSA 1C1XB 4CLHA 5TF4A 4TZKA 3DR3A 2W90A 4JLWA 2YHIA 3N7UA 4Z0HO 4S1VA 1R0LA 2CDAA 2OXIA 1E1KA 4OSPA 4QECA 5KVQA 4II2A 4GX0A 3ABIA 3B1KA 1MX3A 1NXQA 5EIOA 1I5RA 3OETA 1FDSA 4WOKA 1UJMA 3WX0A 1WVGA 4B79A 4YRBA 5KCZA 5L51A 4OXKA 1O94A 3JQDA 4RF2A 5JDIC 3LYLA 3DBRB 4BO4A 3GPDG 5AXBA 1SEPA 2HUNA 2Q45A 5JYDA 2C2XA 3OA0A 4BIIA 4U6SA 3AUTA 2IZ1A 3MJVA 5FEUA 5KJ1A 4X54A 1G0OA 2DQ4A 4UEOA 5IG2A 5TS3A 2P9CA 1PWZA 1GCOA 1S7CA 3C8MA 4L8VA 1E7RA 5L4SA 4E5MA 4TRJA 1Y5MA 5JXWA 4EW6A 2RHRA 3ITKA 3ONFA 3ETGA 4NZ9A 1ZXBA 3K5PA 3RU7A 3JQ9A 5KJEA 5C3MA 5G0WA 1HDCA 4Y6RA 3E82A 2BRUA 4AICA 1HE3A 2AEMA 3ZW9A 1WAMA 3GEDA 4ND5A 2VOEA 4R9RA 3U49A 2GZ3A 3PJFA 3TNLA 4ILKA 4FFOA 1MXHA 4BNJA 4IPTA 1E6UA 1YBMA 4NFYA 2O3TA 3QVXA 1Q7CA 4CM1A 3KSUA 2BHLA 4UVEA 4JBIA 1EFLA 4EDFA 1BW9B 1EK5A 2DBZA 3IMFA 2PKQO 3AI1A 3PDUA 2IXBA 3TZCA 2WD7A 3JYNA 4UVHA 5TJ9A 1FDUA 4E3ZA 4WCFB 4QFCA 3BZUA 3WQRA 3ZWBA 1U4OA 4MVJA 4IDGA 1EDOA 3GVCA 1HDZA 3KLMX 4HNGA 4MIEA 8ADHA 4PLYA 3VH3A 4BO2A 3D1LA 3OEWA 4Z3KA 3RC7A 2PGDA 5ER6A 1Y8RA 1ADFA 3JQAA 4I5EA 4XIYA 3VAZA 2OORA 4YJDA 4BNHA 2Y1FA 1EBUA 3PHHA 4TSKA 2P5YA 5CAEA 4G5HA 3ZNOA 1DC6A 1YQXA 1RM4A 4BKRA 2ILTA 2VZ8A 1WPQA 2O3JA 1P9LA 1PJQA 3NDJA 2O3QA 3GZ4A 4RVSA 4UUMA 7ADHA 3IL2A 4LRSB 2Q4EA 4R01A 5EINA 1Q0QA 2D3TA 3NAQA 4JIGA 4D7AA 1CWUA 5U1PA 2EWMA 3V5NA 5ICSA 3LC1O 4IINA 3VZRA 4WNCA 3UCEA 4FC6A 3BIOA 4DXHA 5F5NA 1YJ8A 3Q2KA 3ORFA 4J6FA 4XR9A 3A9WA 5JSFA 4B4WA 4BNXA 3Q0EA 3V1TC 5JW6A 4I5DA 1KVUA 5CDYA 1PJBA 1IHYA 4GH5A 4I1IA 3M1AA 3CSDA 2JFHA 3CEAA 3E5RA 1PGQA 1U8FO 4UVDA 1PZHA 3HSKA 3I6QA 4JQCA 2XXJA 2JJYA 3L6OO 2JHFA 3I9JA 3ZWVA 4R1NA 3HE3A 4J9UE 3ANLA 3P2YA 2I6TA 2WJPA 2HCTA 1DOHA 2FHSA 3MWEB 2O2SA 3GA0A 3H65A 4JCOA 5CHEA 1OZAA 4BO7A 5HBRA 1I3KA 4PGFA 4I9UA 4ALJA 3HDJA 1QLHA 1VI2A 5B4TA 2EV9A 3I5MA 4FFMA 4QO8A 3EMKA 4W9NC 4CM5A 4DYDA 4ROSA 2PKQP 4ALMA 3ITDA 4OL9A 1UXJA 3IJRA 1NQ5A 1F17A 1MG5A 1QYVA 2D59A 3VPHA 3OHSX 1O8CA 1L7EA 5AQ1A 1YKFA 1FDWA 2FOIA 4MDHA 4FOOA 4PVDA 4RLHA 2ZCVA 3AI3A 1U5CA 1T2AA 3E5MA 4PCVA 1I2BA 2B37A 2R00C 3KRTA 4AL4A 4YT8A 3FRJA 3IJPA 3L4BC 2CNBA 2EP7A 3TSCA 3E8XA 1TXGA 3P2OA 1E3WA 4IIUA 1TI7A 1T1RA 1H0KA 2Z95A 4MVJF 4I8XA 1AHIA 2CDCA 1U2GA 2C7VA 3G49A 1CJCA 3D4PA 4DQUA 2Q50A 3RUAA 4WLNA 4CM9D 5COQA 1LDEA 2ZYAA 1LTHR 5BR7A 2A4KA 4OJNA 4E5NA 2HK7A 4PLWA 4O1MA 3LU1A 4JJIA 1V3TA 1QYXA 4FJ2A 3AM5A 2EP5A 3LT2A 1Y6JA 2XXBA 4EJMA 1CIVA 1ZNQO 1DFHA 2Q3EA 4LN1A 4EITA 5HS6A 1DPGA 2PTGA 4G65A 4NU6A 5CPBA 2PFGA 4YEDA 5AYVA 3MOGA 3A14A 4NBVA 5EN4A 4ALLA 3WGQA 2C07A 3LLSA 2E48A 3T4EA 5CEFA 1D7OA 1HTBA 1DFIA 6ADHA 1T24A 1RM5A 1NPDA 3BXXA 2IEDA 2RCYA 5DBIA 3LDHA 5ILOA 3NKLA 1NPTO 3BA1A 4R3WA 1DJQA 3TOZA 3GMDA 5FI5A 3DMYA 2OFPA 4BB6A 2AE1A 3DFZA 4DREA 4CQMB 2IODA 2PGLA 3ZU3A 3JQGB 4YBZA 2C5AA 3K73O 4TMFA 4RDIA 3ZW8A 4HFNA 4PVCA 4BKOA 3PK0A 1JDJA 2FZEA 4IIVA 3OH8A 1JVBA 4CM3A 2ZCUA 1EBFA 3DONA 4WEOA 5H82A 3KB6A 3B70A 3COSA 1B8UA 4P22A 3NTQA 3ZU5A 1PGJA 4AJIA 5JC1A 1T26A 3AOEC 1N9GA 2B69A 2JCVA 1ISJA 1MB4A 1I0ZA 3FCOA 4J4TA 3QA9A 1KY4A 3QVWA 2WEKA 3KVOA 3PJGA 2CD9A 4TZTA 3DBLB 5G4KA 1YB4A 4E2WA 1BSVA 1X1EA 4CMKA 4CLDA 1HT0A 1I10A 4R1SA 2P68A 3C1OA 2PWZA 1CQIA 5KKCA 4BQPA 4ESOA 4GI2A 1H5QA 1VRWA 1E3IA 4KMSA 3QWHA 5C37A 2D1YA 3JD2A 4IDBA 4U8GA 2CF5A 3RFVA 4E5PA 3H8VA 4BO6A 1BWSA 4N5LA 1OC2A 4CM7A 2QX7A 2ZKLA 5F1PA 5CFZA 1ZO8A 2G76A 4YWJA 4NMHA 3ANMA 4BNKA 1V0JA 1XSEA 1NBOA 2ZYGA 3ROKA 3JSAA 1LQTA 5H81A 2C5EA 2DTEA 4S3MA 3VPFA 5JY6A 2PH5A 2E37A 1Y8QA 4H15A 5TQVA 4DPLA 4FC7A 1DEHA 3M6IA 3WS7A 2JD2A 2O7SA 1HZZA 3U09A 4IS2A 4A03A 3TPCA 4W99A 4LCJA 2PK3A 1QYWA 3WBBA 4DQXA 3PQEA 3G17A 1UP7A 2Y05A 3I9MA 3ZHZA 3HDQA 4KQXA 2VYNA 2EEZA 3DAGA 3GGOA 5MGBA 2PH3A 3PZBA 4CMIA 2FRDA 3H9JA 5CPFA 4XYEA 2EKLA 2FR1A 3R1IA 1V35A 5A5EA 4KTVE 5BT9A 4RDHA 1EUZA 4WLUA 1GCUA 1PZFA 3D3WB 3PRJA 3BTVA 4J1TA 2NVWA 3UFXA 2Y0EA 3MJTA 3GH3A 3IUSA 1QKIA 3ASUA 2AQHA 3K6JA 1TA4A 2D0IA 4ND1A 3ZH2A 3DMTA 1DHTA 2D5CA 2H1SA 4CODB 1R16A 1HYHA 1V3UA 5KVVA 3RC9A 1BTOA 2I65A 2W8ZA 2YV2A 4D3DA 1K3TA 3GGGA 4L74A 3H6KA 1ZK1A 3KUXA 3OQ6A 4E32A 2VUSA 5IZCA 5LDHA 4IXTA 1SNYA 1W0CA 4BKPA 1YQGA 2P4QA 3RBZA 1Q1NA 4UAGA 4WPGA 5IDXA 3AY6A 4OOFA 2NTNA 1MG0A 3OBBA 2X0JA 5KNLA 3PLRA 4YB8A 5T5QA 2BD0A 3T7CA 2J6IA 1SB8A 2YDXA 4IDCA 2QRJA 3BTUA 3TQHA 5HM8A 1E77A 3EZYA 4GMFA 4IDFA 4KDFA 3TDKA 4A73A 4BO0A 3E6AA 2QZ9A 3FTNA 1NASA 5L7WA 2P2SA 5C7OO 2I76A 3H2ZA 1LRKA 1NP3A 2EIHA 4YJHA 3INGA 3O8QB 5U4QA 4Y67A 1TT5A 3V1UA 5IZCC 3DBRA 4E21A 2E82A 4BNZA 4NDNE 2VHYA 3R3JA 5TLSA 1PJLA 1IY8A 3S2EA 1Y8RB 1I01A 4URFA 4AJ1A 3ICCA 1YL6A 4MVJG 4OMUA 1RYDA 5T57A 4XYLA 3S1LA 1QSGA 2CF6A 4XX0A 2YDYA 3CZMA 2VNSA 1LSOA 1IE3A 2GF2A 3GVIA 1R4NB 1SMKA 2DBVO 3S2GA 1E1NA 1PJCA 1HLDA 2VWGA 5KJ6A 4AJJA 4JBHA 4BNIA 4RORA 4L73A 3K2BA 3OMLA 3AWDA 1T2EA 4GMGA 1PR9A 3RASA 4CM4B 4M49A 4BNFA 4WJZA 4YA6A 1CYDA 2PZKA 2Q2WA 2TMDA 4RVDA 4ZQFA 1GQQA 1SB9A 2PZJA 3PYLA 1KVTA 1KETA 4HXYA 1DBVO 3LSYA 2V6BA 1H9AA 4DYVA 2OP1A 2DU8A 2WTBA 4ITUA 1PEDA 2VYVD 3O4RA 1P3DA 4DUPA 3TJRA 4C7KA 3FD8A 2W2LA 2H9IA 1DSSG 3ROMA 3DDNA 4WASA 2J3IA 2AG8A 1PJSA 4MKRA 1JA9A 3FR8A 4PIVA 2C29D 2F00A 4XRRA 5F5LA 3V1YA 2Q4BA 3RUEA 4D0RA 4PLTA 3C3XA 4FR5A 4RVFA 3ZN2A 1MFPA 3JYLA 1FDTA 4DA9A 2VUUA 3OIFA 2UYYA 2HQ1A 4TRMA 1I24A 2VWHA 1E7QA 4I5GA 5TGDA 3KTDA 4BQRA 3E9QA 4CMHA 1DAOA 2J8ZA 4QSMA 4KTTE 3IAHA 2YYYA 4II3A 1E1MA 2EERA 1HSZA 1JTVA 4MO2A 5IAAA 4BHTA 3INTA 3EDMA 3L4SO 4BNWA 2J5KA 4OO3A 4Y6PA 5A3VA 4YXFA 2BI8A 4GX1A 2GN6A 4RLSA 3ZNQA 1LRJA 3NEPX 3DBHB 4HWKA 2UDPA 3G3EA 3WSVA 1TB4A 1Y9EA 3BAZA 3KOUA 1P1IA 4GWKA 3NRCA 2UV8A 1ISGA 4IDDA 3V2UA 5JNLA 3RKRA 2OGUA 1T1SA 2ZB3A 3FNGA 2X9VA 3QWFA 1C0PA 4W7HA 1PIWA 3PFFA 4YR9A 1UDAA 1UXGA 4B7XA 2PV7A 3DZHA 3PHJA 1DRWA 1J6UA 1ENYA 4R68A 2NM0A 2BGKA 2RHCA 4HADA 1M67A 4IMPA 1OMOA 4PG4A 2ZQYA 2Y93A 4J4HA 4TROA 1T2DA 3H9QA 3TFQA 1V6AA 1NHGA 3ST7A 3BTOA 2GLXA 1HDYA 4J1SA 3HFGA 3WWYA 2YV1A 1B7GO 2ZTLA 1P74A 1PWXA 1WWKA 1X1TA 5L4NA 2NWQA 3KEQA 4L0QA 3ZWAA 1BDBA 5DULA 1PX0A 4Q3NA 1XEAA 4YPOA 3MJEA 1MXFA 2O3UA 1LLQA 3FPCA 6LDHA 5F1KA 3VPXA 1HE2A 2NQTA 2DAPA 3A06A 1J49A 3EC7A 4BO9A 4BV9A 5K0ZA 2JFFA 4DWVA 3L07A 2PZLA 4AJNA 1QXSA 7MDHA 1K5HA 4B4OA 4YACA 3K96A 3LC2O 4JP3A 1EK6A 2Y68A 3CH6A 3RAJA 3LZ6A 3H9EO 2B4QA 2VYVA 1P33A 4P4GA 2DVMA 3OICA 4XJTA 1Z74A 4RCVA 3PPIA 1T25A 4ND4A 4R16A 3GZNA 4XZ3A 4H16A 4R69A 1BW9A 3P19A 2WYVA 3QQPA 5ICMA 4H7PA 1R4MA 4A7PA 1ZJZA 5JAIA 1P1KA 4UUPA 1CERA 1O9BA 1KC3A 4LVUA 1ZVMA 4CR7A 5A5FA 1BXGA 2NV6A 3M1LA 2VRCD 5TNXA 4Z6KA 1ZH8A 1I32A 1WDLA 5K9ZA 3I9OA 1H94A 1P44A 2H5LA 4RPGA 4QQRA 1LX6A 1QR6A 3E18A 4A2CA 1VE9A 4LMRA 4PZDA 2CVOA 2Y0DA 5KJCA 1Y81A 1Z7EA 4IM7A 4GSKA 4D45A 3O03A 2ZQZA 4NBRA 2J5QA 1JVSA 4XQ9A 2CVQA 3KYDB 4CR8A 4CMGA 2HRBA 4CQMD 5CDSA 4MVJI 3UUWA 3WG9A 3X2FA 2C7GA 4L4RA 2VZ9A 3SLKA 3ONDA 4J7XA 1P1RA 4E31A 4PFJA 3PQDA 2BKAA 2GNAA 3FNEA 4DIOA 1HZJA 4XB2A 3GR6A 3GUYA 1KEVA 2O23A 2YHUA 3BTSA 3AU8A 4WE3A 5AXAA 1GYRA 5KOIA 4L9RA 2G0TA 3BMQB 4JBGA 3IDSA 1KS9A 4MJLA 5DP2A 3BMOB 4BNGA 1VSVA 2V6GA 4IJUA 1A5ZA 3IQDB 4N7RA 2UAGA 1QP8A 3UKOA 3WDSA 1GPJA 1Z82A 1R4MB 4IQ8A 1N2SA 1YB5A 3HDYA 4OM8A 2C20A 4PG7A 2X0IA 5IN5A 1BHSA 4PG8A 4RPJA 3JQ9C 3PDJA 3GGPA 1GAEO 2BELA 3OFSA 5G0TA 2A92A 2JKVA 3E48A 1DC3A 3U0BA 1YB1A 5EMHA 3WLFA 1U5AA 3ON5A 4FD3A 1NFFA 4WECA 5HA5A 4ZVVA 2I3AA 3MJCA 4NI5A 3GN1A 2QQ5A 1EEHA 2WDZA 3BHJA 4IBOA 4XQGA 3K2EA 1H9BA 1LSUA 1M6HA 3JQ8A 1LDNA 2D8AA 1PS8A 3F9IA 4WNIA 5BNTA 3T7EA 5IN4A 5JDCA 4PG6A 1ISHA 1OFGA 3VZPA 4UVGA 3SBOA 1O0SA 2C54A 4F45A 4NU5A 2NVUB 3ZWOA 5I8WA 4IDAA 3DWFA 3LT4A 2Y0CA 5GZ6A 2X86A 4J9VA 4OHUA 4YQZA 5KTKA 1LLCA 3H2SA 3KZVA 4Q3AA 2QRKA 2HK8A 3QP9A 3OEYA 3I9NA 3MCVA 4KWIA 3H9GA 5JC8A 1LC3A 3UOGA 2YUTA 3ZWPA 4XRGA 4FJ1A 1WLYA 5JMPA 2BLLA 1U3UA 3WGGA 4TRNA 1OI7A 1SCUA 3W1VA 3IC5A 2CVZA 3GG2A 4ID9A 1GD1O 3WGTA 1GUZA 3W8EA 3WGYA 4RF5A 3OM9A 4YT2A 1P1JA 1RWBA 3DL2A 1I3LA 1NWHA 3I9LA 3VOSA 3AFMA 2C59A 5I7VA 1LXCA 1YH3A 3ZNPA 2VHVA 3AY3A 1N5DA 1I2ZA 1YOVA 2NQ8A 5DP1A 5JLAA 4DTIA 2NVUA 3A28A 5A03A 4KZPA 5T64A 2GD1O 3ANNA 4PLHA 4BNMA 1ZK0A 1OBFO 3PZRA 1HYEA 4WK6A 1UR5A 4UUOA 5LC1A 1CRWG 4GAEA 4JX8A 4YYZA 2O3RA 3JQBA 3ASVA 3RUHA 2NU8A 4CUZA 4DVJA 3F4BA 3Q2IA 2OBNA 2BGLA 2RBEA 2FPGA 1XQ1A 1CF2O 5A3JA 1UZMA 3QY9A 3ADPA 4HBGA 4R4JA 4CLOB 1A9ZA 4CLEA 2UUPA 3EAGA 2FMUA 4CL8A 4RJTA 3VTFA 3GDOA 2O48X 4CMJA 2B35A 3LK7A 1ZK2A 4N5NA 2DUWA 1G0NA 3RCBA 4E5YA 4PG5A 2I66A 3OJLA 1F0YA 4J7CA 1U1IA 1JWAB 4KWHA 1CQJA 2PY6A 4BMVA 4FGSA 3UVEA 5A9RA 2G1UA 4HKTA 5A05A 1A7AA 1C0LA 3DHEA 2P9GA 1F06A 4CV2A 1LLUA 3VDRA 4TWRA 2Q1TA 1DXYA 2PR2A 4CMIB 1IPEA 1IHXA 1A72A 1BVRA 2QW8A 1R15A 1KC1A 2NTJA 2HAEA 5HTOA 3KYCB 4I5FA 4YAJA 3FSRA 2CFCA 1AHHA 3K9QO 1DC5A 2WD8A 2J3HA 2DBRA 4YJGA 1I3MA 5I7EA 1NAIA 3F4LA 1H2HA 1XCBA 1B3RA 3WYBA 1EVZA 2FZWA 2O3SA 5L40A 3D7LA 3DZKA 3OIGA 4BMSA 1DLJA 1SBYA 1HDGO 4E4YA 3EUWA 5CG1A 2O2YA 1ML3A 1QORA 1ID1A 1ZEJA 1IULA 4QFDA 1N7HA 1JKIA 4C4OA 1Z75A 2DUUA 1ENOA 3PLNA 2FSSA 3RU9A 3GLQA 1X0VA 1YS4A 1B2LA 1F8FA 4R3NA 4E13A 1DRVA 3I3OA 3H3FA 4N54A 1EMDA 4FQ8A 2FWMX 2OUIA 1GADO 3OECA 4NR0A 3LT1A 2X5OA 1JAYA 2X9GA 2EW2A 1C1DA 3ENKA 4K6CA 4BVAA 4CR6A 2V6FA 5L7YA 4DLBA 1SO8A 5AXDA 5A06A 5IZ4A 4YAKA 1WXDA 2AXQA 3INRA 5G4LA 1MA0A 1ZSNA 4PRLA 5KKAA 3RWBA 2I5PO 1GUFA 4P4NA 2AE2A 1EDZA 1AE1A 4KP7A 4K28A 1PZGA 4AJLA 3PJEA 3I4FA 5FF9A 1ZXLA 3WFJA 1UAYA 4HFJA 3TFOA 1B8PA 4XGKA 2PZMA 4ZU3A 2AQIA 4RVGA 2DT5A 1C1XA 1E5QA 3V2GA 4GGPA 3ZHYA 1X0XA 1IPFA 2GZ1A 4OXNA 3DMTC 4CV3A 1LA2A 3I23A 2GN9A 2QHXA 4FJ0A 3W4IA 3D64A 4M8SA 2I67A 3Q1LA 4XCVA 4BGVA 3UCXA 1EQ2A 1DHRA 1YWGO 1U7HA 4NJMB 5T8KC 4OYRA 3MWDB 3ZV4A 4E2ZA 1I8TA 2B36A 2JL1A 4NG5A 2G5CA 4CLRA 3TZKA 3JQFC 3E1KA 3OJOA 1KYQA 2B5VA 3FNFA 3JQEA 5EERA 2X0RA 2E6UX 2ZB7A 3VDQA 2CMDA 3AI2A 4XYBA 1YL5A 2PNFA 2HRZA 5CEEA 1NR1A 1B16A 3DZBA 4IXWA 1SEVA 2IXAA 3V8BA 4RQTA 1RM3A 1AN9A 3DB2A 3B20A 3WGHA 2EG9A 1G1AA 1AGNA 2C82A 1GPDG 3KHUA 2OZPA 3CUKA 4UVIA 2HU2A 4L75A 2X58A 5JAZA 4ND2A 1XGKA 3IIEA 3ZHBA 3H5NA 1EVJA 4PLCA 1NR7A 3CINA 2PA3A 2D4AA 4QTZA 2EGGA 2I3GA 2I9PA 2X23A 3NT5A 2JCYA 4OOEA 3UAGA 1XHLA 1LDYA 2EKPA 3DAPA 1PR3A 1PS9A 1U4SA 2FY8A 2V6MA 3DEYX 4BOYA 4EYEA 1D3AA 3NYWA 3V2HA 3ZZNA 2HDHA 1ULSA 3AOEA 3ICPA 4RL6A 4RZIA 4Y9DA 1D4FA 3EZLA 4IUYA 3VH1A 5JCJD 3A4VA 3HG7A 2PD4A 1HEUA 1E0DA 3L4BA 1M76A 1NVGA 1Y7TA 4D3FA 2HKIA 3WMXA 4CM8B 2UUOA 4ONEA 3BMNB 4Q3EA 3VC7A 3JQCA 3PEFA 3VZSA 1X7HA 3RUCA 5LDGA 3R6DA 2C0CA 4FFRA 3DZFA 3FI9A 3ETDA 3ULKA 4CLXA 4DIBA 4ZGWA 1JLLA 5MDHA 2CDBA 1D8AA 2YFHA 4YDRA 1DRUA 1WDKA 4JN6B 2AQ8A 4NFHA 3E03A 4XDYA 5DCUA 4DC1A 1HF3A 1Z45A 5GMOA 3F1LA 5JBIA 3W4KA 4MINA 2AHRA 2GERA 3D5TA 1ONOA 3EW7A 1R4NA 1ZIDA 3KYCA 5A9SB 5DBGA 4J0FA 3I1JA 2NUAA 1YL7A 3AM3A 1U3VA 2DPGA 3C1TA 3HQ4O 4J1QA 3DC2A 3GDGA 1EFKA 4BMNA 1H6DA 4F46A 4KDEA 3UHAA 2PLAA 1C1DB 5THKA 1JN0A 3D3EA 4UULA 1Z7BA 4BS9A 1K6XA 3GOHA 1Y9AA 5IDWA 1J0XO 4M1QA 2VRCA 1O6ZA 2AW5A 4TKMA 2P91A 4P38A 3RC1A 1UXIA 1NFQA 4YJHB 4DLAA 4EJ0A 5A04A 1T2FA 2YW9A 4BNNA 3F1KA 3PYMA 4ALNA 2VNAA 5THQA 1E3EA 1OC4A 4XGNA 2B5WA 3VVCA 3L77A 5EJ2A 4U5QA 4YRDA 4CPDA 1LLDA 1TLTA 2XF8A 4CMBA 3PGJA 1VKNA 1LDMA 4D3SA 1B14A 2DPHA 4N5MA 3GVHA 4GKVA 3JYPA 2IZZA 3DHYA 4FPXA 1MC4A 3F47A 1E3WB 1ULUA 5JAQA 4Y8VA 3L9WA 4Q9NA 2W2KA 1E7SA 5DNAA 4YAGA 2HSDA 3ADOA 3WYCA 3AFNA 1X7GA 5EL0A 2OHXA 2NLOA 3BMCA 3CKYA 4DIFA 2EGHA 1X7DA 2ZTUA 4CJXA 5A1TA 2OOSA 2IZ0A 1N7GA 2BMAA 3AK4A 3GEGA 4BL5A 1E6EA 5CDGA 1PQPA 2DLDA 3FWNA 2DBQA 1LDGA 3GG9A 1XELA 2HMSA 2X0NA 1NVTA 3BHMA 1ADGA 1DFGA 4I08A 3SJ7A 4J2HA 1Q2XA 1PJTA 3QIVA 4H3VA 1ZFNA 1LUAA 1K6JA 1LI4A 4LVCA 4PLVA 9LDBA 1ISFA 3OJFA 3QV1A 1I3NA 1WW8A 5GY7A 1ADCA 1UDBA 5F1OA 4OKNA 3ZNNA 3EVNA 1WMAA 2JCXA 4BKQA 4J0EA 3O26A 5CG2A 1HE4A 3S2FA 3PVZA 4L76A 3KM0A 3N58A 1Q0HA 1A4UA 3U4IA 5CP8A 4GLLA 5JY1A 2RIRA 1RPNA 4CLRB 4R1UA 3WIEA 4HY3A 5C7LO 5ITWA 1BDMA 4R54A 4RGBA 1XG5A 4XGIA 2ZK7A 1NFRA 4BO8A 1XLTA 1A71A 3HB4X 1GV0A 1B26A 3OIDA 3MTGA 4J7UA 4ZRMA 4MVJH 1R6DA 2ZTMA 3PWSA 3TRIA 2FSVA 4JK3A 3WTCA 3KETA 3C85A 2O50A 4OQYA 4IY1A 4RVUA 2X9NA 2DC1A 4DPKA 1LSJA 3WNVA 3F5SA 5BSHA 4KUGA 5JS6A 3ZI0A 2DFDA 4MKZA 4PZCA 4NBTA 5J23A 4DLLA 4JP2A 3K8ZA 3CXRA 5AOVA 1P0CA 1LJ8A 5AXCA 3U62A 5U9CA 2GYYA 3DXFA 1HETA 2Y1OA 2Q49A 3EHEA 3IP1A 1NYTA 4Q39A 4CQLA 3TZQA 5EPOA 2WYWA 5FFFA 3ZGYA 3PGXA 3UH1A 4FFLA 5HRUA 1PGOA 4LISA 4BB5A 2RH4A 3I4CA 2ZJ1A 1VPDA 2YJZA 1MGOA 1DDOA 4DBVO 3QJ5A 3AUSA 3RVDA 3WMWA 4AJOA 1Y8QB 4RPKA 1R37A 4B3IA 1K0UA 4JROA 1LRLA 4GWGA 3BYZA 1IB6A 5G0UA 1VC2A 3SC4A 5B12A 2P9EA 4WLFA 3WLEA 3NJ4A 2Z5LA 3WSWA 2ZIZA 2RAFA 1PJ3A 3F3SA 4O0LA 2G82A 3PHLA 1U3WA 3BMCB 4AFNA 1FXSA 4MIYA 3RBXA 3ZV3A 1KIFA 4TKLA 4AJ4A 2HMVA 1FF9A 2QIOA 2XAAA 4D43A 1DO8A 4NJOA 2OBYA 1E7MA 1GDHA 1YJQA 2Y1CA 2B0JA 1WP4A 3BMOA 3JQBC 2W2KB 5G2OA 5A02A 1UXKA 4MIOA 3OSUA 3RC2A 1JAXA 2X5JO 3KBOA 3RQSA 4L4XA 4TVOA 4A10A 4F6LA 3HNPA 2X1HA 3I83A 2GR9A 4EBFA 1H6CA 3S55A 1XWFA 4MP6A 5FI3A 1VKOA 5DOZA 1EUCA 3ZV5A 4YAEA 3GMSA 2ET6A 3DO5A 4GBJA 3HJAA 1FDVA 1K2WA 1NM5A 2Q1SA 3EK2A 5DF1A 4MVJE 2IYPA 3O38A 4XDZA 2G17A 3TZ6A 3WFIA 4DC0A 3QSGA 1Q7BA 1HKUA 2JAPA 2HLPA 4LRTB 4W82A 4IQGA 1SAYA 4GX2A 3EVTA 3FHLA 4WUVA 3W8FA 2XOXA 4BKUA 1VL6A 3A1NA 1YDEA 5A4DA 2Q2VA 3JYOA 1ONPA 4RQUA 1B15A 5I8ZA 1C14A 1OOEA 4FFNA 5ES3A 1W4ZA 3GNSA 5JCXA 3C1AA 4JJGA 1VLLA 4R5HA 2YZ7A 4WCFA 3GZNB 4JGBA 4D42A 4XJSA 5CDUA 2IE0A 5DT9A 1QMGA 4IJKA 4J4BA 3FWZA 1LC0A 3PWKA 5EQFA 3GC6A 2GSDA 1A27A 2FPIA 1O89A 1YVEI 2X6TA 5DOVA 1IOLA 4MOWA 1GZ3A 1FMCA 1PS0A 3E9NA 4B8WA 2GUGA 1VL0A 1DLIA 4RO0A 1BGVA 2EHDA 3W6ZA 3WYEA 4MVJP 4PLFA 3AJRA 3B6ZA 3ENNA 4CM8A 3O8QA 3GAFA 3ZU2A 4BNTA 3U9LA 3P7MA 1X15A 4AJKA 3CPSA 3KLPX 4UEKA 1ZCJA 3TL2A 1KOLA 3DOCA 2E49A 4QX6A 5JCJA 2Y99A 3WOHA 2OMEA 4XKJA 3UGKA 4P4LA 3M2TA 1WZIA 2JD1A 3BHIA 3AUAA 2X22A 1IZ9A 3NDRA 3QVOA 1GU7A 1YONA 4OIMA 1FJHA 2Q1UA 4FS3A 5B37A 1HDRA 3CMCO 1P1FA 1DJNA 2WWRA 1Q7GA 3GFGA 1Y5RA 5DCWA 1GZ6A 3DAFA 5GZ1A 2YQ5A 1XQ6A 4GVXA 3TWOA 4O59O 1DAPA 1XU9A 1QG6A 2WE8A 2HMUA 1M6WA 2RH8A 4E0BA 3DOJA 4BGIA 4EI2A 1BG6A 3SEFA 3VHRA 1J5PA 2IYOA 1M66A 1PGPA 1ZK3A 2GPTA 2W2LD 3PIIA 2H6EA 2WSBA 3GUCA 4QT0A 3MTJA 4YCAA 4Y98A 3VKUA 1PJ4A 4A27A 4BNVA 3FBTA 3UW3A 2HJRA 4BGEA 3ROQA 1XIVA 3RFXA 5I9LA 4XA8A 2HMWA 3GK3A 2X4GA 3VH2A 4FOSA 4CM6A 4HFMA 3CMMA 4JJFA 1IYZA 2QYTA 4DMLA 3FR7A 3JQ6A 3WR5A 1YXMA 3PHGA 4O5OA 4OH1A 1ENZA 1ZJYA 3RUFA 4AJHA 2ZB8A 4WKGA 3ZWNA 4ALIA 4YT4A 3PJDA 4GSLA 1UUFA 1GUYA 1JW9B 1NAHA 2LDBA 1X13A 3GHHA 1H6BA 3FN4A 5DBFA 5L53A 4YJFA 4W7IA 4CQMA 1CDOA 4M55A 1F12A 3ZHXA 4D44A 3PTZA 2ZB4A 1UAGA 4TRRA 2O4CA 3GAZA 1UP6A 5ENVA 4IGEA 2LDXA 1PL8A 3U3XA 4Y6SA 1B3BA 1I36A 3F46A 5TRTA 1O95A 4DPMA 3CZRA 4FFPA 1N1GA 3OP4A 1U8XX 1NX6A 4PZEA 1F14A 3KYBA 3DBLA 5G4KB 1YRLA 3GRPA 4M86A 1IZ0A 2NVBA 3K92A 3WJAA 5T67A 1H2BA 1UZLA 1GL3A 1VM6A 4CMEA 4JXKA 5BNIA 3NUGA 4XEHA 1KVSA 1GEGA 4D46A 5HWSA 3JD1A 4EZBA 3VH4A 3H5RA 1C3VA 2DTDA 3WNQA 3UF0A 2Z1MA 4A5OA 3U4CA 4E33A 1HSOA 1UP4A 5H83A 3RD5A 1ADBA 1ORRA 3ZWCA 2AQKA 1U28A 4HP8A 3LVFO 3ONEA 1LSSA 2NU6A 2Z1NA 2H63A 3WTBA 5IDQA 5L9AA 1JU9A 3KYDA 3Q6IA 1H93A 4CV0A 1ARZA 2VCYA 3PXXA 4WOJA 3WGOA 4B7UA 3JQFA 3JQGA 1P45A 4XQEA 2HK9A 8LDHA 3KEOA 1LEHA 5BQFA 1QYDA 1ZSYA 2NTVA 1RKXA 3UXYA 1BMDA 4B3HA 1M75A 4CMEC 4E5KA 3GHYA 4ZN6A 2ZTVA 1ZKMA 4DQVA 3WBFA 3D0OA 3OQBA 3JD4A 3O9ZA 1EE2A 4RF4A 5JFOA 3AM4A 3C7CB 4U0JA 4UREA 1NPYA 2O4UX 3KXDA 4Z9XA 1GQYA 1P77A 4B3JA 3EYWA 2HJSA 2IRWA 3H4VA 5HS4A 1NQTA 1VL8A 5LCXA 1RYEA 4EUFA 2IDZA 4B7CA 4BO1A 4C7JA 4CQLB 2VTEA 3GVPA 1EUDA 3PYXA 4UEJA 4NIMA 4HFRA 2B4TO 4ALKA 1G6KA 2NACA 4KQWA 1E3JA 3VKVA 1K6IA 3QW2A 3TOXA 4Z0TA 2VTDA 4GL4A 4XWYA 3ROPA 1T4BA 3DBVO 1IUKA 3PI7A 5EQDA 5IFLA 4PLGA 4LSWA 4RZHA 4CUKA 1QV7A 3DZIA 3WJ7A 5AVOA 1NTOA 2PD6A 4WLOA 2WMDA 5CDTA 1DIGA 3OJEA 1UDCA 3QHAA 4YJFB 4MKXA 3MEQA 9LDTA 1T2CA 3PP8A 1XKQA 4XYGA 3HHPA 5L95A 3ZWWA 1X14A 4FDAA 1E92A 2J5RA 1FK8A 3JCZA 3ZWMA 2X8LA 2Y1EA 2GN8A 1JQBA 3P5SA 4AJPA 2B4RO 1ONNA 1C0KA 1XDWA 3GQVA 4N18A 2GZ2A 4PLZA 3HN7A 1Z73A 3S8MA 4NHEA 5CEJA 5TT0A 2DFVA 3GNTA 2A35A 3QRWA 2NSDA 4BO5A 3AW9A 4IJVA 3FNHA 4ND3A 3FBGA 2FP4A 3WQQA 2EF1A 4YAIA 5F3RA 2Y1GA 5T8KA 4U7WA 2AG5A 3I52A 4EGFA 2C2YA 4CM4A 4O6VA 4EEZA 1L7DA 5I7FA 1N9GB 4HUJA 1RJWA 1E7WA 4IMRA 4NK4A 4DMMA 4J91A 4Q3CA 2FR8A 1U9JA 2EKQA 4UUNA 1DIHA 2DM6A 1NVMB 3D4NA 3EGOA 1Z6ZA 4K1LA 2BI7A 4WLEA 4ZQHA 3RFTA 4NJMA 4GVLA 1I30A 3VPGA 1SZJG 3L9XA 3JQ8B 1MP0A 3C7AA 4D41A 2AMFA 4W4TA 1GR0A 1F8GA 3PQFA 4WEQA 1BRMA 4AJEA 4XYMA 1R0KA 4B8ZA 5L7TA 1BVUA 1BXKA 1HLPA 2F1KA 3OF2A 1NHWA 2BFAA 3ETEA 2CY0A 4K9DA 3QWBA 3W6UA 2NU7A 4EEXA 3QVSA 2GRAA 1PQWA 1PL7A 3NX4A 3OA2A 2XPCA 4J3FA 2GN4A 3JD3A 4LGVA 1QYCA 1LNQA 2BFOA 1ZK4A 4Z9FA 3ZCXA 1EZ4A 3DOOA 4OAQA 4QUKA 1ZW1A 3I6IA 3W4JA 3GN2A 3HADA 1JKFA 1E1LA 2BH9A 4BNYA 3U4DA 4E30A 3R0IA 1LDBA 1KERA 3MZ0A 2Y1DA 1ZEMA 4LMPA 4BGUA 4PN3A 1ZMOA 5I9NA 4MP3A 4YRAA 3E9MA 2EXXA 1DB3A 5EESA 4GPD1 2GDZA 3NDIA 2ZATA 3DZJA 1PGNA 2P5UA 4XIJA 2ZJ0A 2Y66A 4J1NA 3F5QA 1VSUA 4YVFA 4NH4A 4A26A 1ZZEA 4U6QA 3RJ9A 3Q9UA 5TSDA 1C0IA 3WQSB 4YJGB 1P31A 3LF1A 4CV1A 4E2XA 3WGIA 1OAAA 4F3YA 5IDYA 1Q0LA 2EJVA 3UCFA 4OQZA 3Q3CA 4I9HA 3JD0A 4FGWA 1NWCA 3NV9A 4IZHA 3VTZA 4AG3A 3SVTA 3D4OA 1TT7A 4FBGA 2VQ3A 4NQZA 4OGWA 2J3JA 3IUPA 2UVDA 2YV3A 3NT2A 3CTMA 5G0SA 3SLGA 1GYQA 4EJ6A 5IJZA 4IDEA 5JPIA 2AEFA 4AJ2A 2WM3A 4IGFA 4CUJA 5TC4A 4Q3DA 2PGJA 1AXGA 2DKNA 2V65A 1PL6A 4RF3A 1JWBB 1U2DA 4WLVA 5JAMA 1UXHA 5BSFA 4LCEA 4M89A 2VUTA 1E7YA 1HDXA 2OP0A 3GVXA 3JQ7A 5TT1A 3RJ5A 4ZQBA 4MPDA 4KUEA 3OJ0A 4GX5A 3RSHA 1MFZA 1H6AA 2VHXA 3GF4A 4MVJM 5B1YA 1PTJA 3KO8A 5BSEA 4NPCA 5TJHA 2BFPA 4Z3DA 1BXGB 2X7HA 5T6BA 4HX5A 3AY7A 3UN1A 4J49A 3RROA 1EQUA 1PQUA 1PZEA 4RPLA 3VVBA 1DC4A 3DBHA 3NTRA 4J2OA 4ZJUA 3BMNA 2R6JA 4G2NA 3LQFA 3LT0A 1WDMA 1YQDA 3PIDA 1GV1A 1A4IA 1S6YA 3LC7O 4ZRNA 2OL4A 3ZWYA 2HMTA 5GZ3A 3DZGA 3GFBA 1CEQA 4DGSA 5JMWA 1VJTA 3UICA 2GCGA 1DIRA 5IXYA 2VYND 3RIHA 4JNKA 4B4VA 3TF5A 4E12A 1I33A 1KVQA 1YBAA 5IF3A 1U3TA 4PLPA 4DL9A 3N74A 4HNHA 1NQAO 4IS3A 1ZBQA 3L6EA 2R2GA 4XD2A 3U5TA 1ISMA 5C5IA 2PKRA 3D5QA 5JE8A 1D1TA 3PFWO 4WCDA 3PHIA 2VT2A 2WYUA 5L45A 4NFSA 3HN2A 1PJ2A 3C7DB 4G81A 3OQ1A 4FN4A 4RV9A 4KOAA 3MJSA 4J43A 4QXMA 1SOVA 1VJ1A 1EVYA 4R41A 1TVEA 4DRYA 4GQAA 4QEDA 4R1TA 4J90A 3HFSA 5FWNA 3STHA 3IS3A 5K6AC 4IQ0A 1NQOA 2EW8A 1SOWA 3X2EA 3MJ4A 3IP3A 4WGGA 1GZ4A 2OO5A 3H3JA 5ADHA 3R3SA 4FB5A 4M54A 5KWEA 2I99A 2WE7A 1UH5A 1N8KA 1ZMTA 3H9UA 1MV8A 3IKTA 2SCUA 4BNLA 3S2IA 3TL3A 3HWRA 3MOIA 3WXBA 2DTXA 1J4AA 4OXYA 3B1FA 3JV7A 3W8DA 2Y67A 3GNQA 5KJFA 1WMBA 3JQ7B 2ZYDA 5I9MA 4LK3A 4LSMA 1QV6A 4LW8A 2BF7A 3FPLA 1K89A 1E6WA 1O5IA 2CUKA 3GT0A 2NADA 3SXPA 5ER9A 1N1EA 4ZICA 3QLJA 3JQAB 1MLDA 3WB9A 2YY7A 3C24A 3NGXA 3BMQA 4PRKA 1NNUA 4TQGA 4E6PA 3GY0A 2YQ4A 4J16A 3ZDFA 4CMAA 1E5LA 1IL0A 1KY5A 3JYQA 1E3SA 2POQX 1AXEA 3L6DA 1WZEA 2VRBA 4KUHA 2GO1A 2CSUA 3FTPA 1MC5A 4FSHA 3DTYA 1YO6A 1R66A 1SC6A 5G0VA 2FPPA 1WNTA 2QYSA 1UZNA 4E2YA 1T4DA 4XR4A 1B8VA 2QRLA 3ZU4A 5ITVA 2JHGA 2JFGA 4ZD6A 1XA0A 3G79A 4FW8A 4Q3BA 3WWZA 1I2CA 4A0SA 1DIAA 1EE9A 1A7KA 2AEJA 4M87A 3H7AA 5A9SA
chains in the Genus database with same CATH superfamily
4EENA 1ECBA 3KSZO 4ZOQI 3EY4A 2XUDA 1X7YB 4IW3B 5K0LA 1RRPA 3R6LA 1VJGA 2WSIA 2A9RA 1TUIA 1KBZA 4CM9A 2IBSA 2AD1A 1Y4ZA 1XQ9A 1BU5A 4XQCA 5CK4A 1EDDA 2V7PA 1G3MA 3SC6A 1WV0A 2OBBA 2I54A 2XX3A 2OV8A 3K9WA 5DX8A 5IT5A 5FBKA 3GRKA 3AG5A 4M9ZA 1TJ4A 4DLXA 1E3TA 4XD7A 2QGZA 4TLCA 4LBVA 4ZDIA 4A2PA 2G36A 4UUBA 2EC5A 1V8BA 5G1NA 5BXQC 2IIVA 4O4HB 1P3JA 1LQUA 2FR0A 1UKVY 2WIKA 4NZNA 3IIJA 4QU5A 1RPJA 5LJLA 3V32A 3LSTA 4R51A 2AR0A 1Y3BE 4I55B 4M1TA 5JVDF 1GNTA 3A6DA 4EUHA 3QBTA 1E8NA 5JYEA 1IBKB 4YDSA 3M82A 4QG7A 3OLZA 2GMWA 4C89A 1KSGA 3B1XA 5ALGA 4H1VA 2XMZA 1OLXA 2XBUA 4P4TA 4EB0A 1N3YA 4JBWA 4CBVA 4MQ5A 1KVRA 5E2AA 2CZCA 5FYDA 2VDPB 2J46A 1K4MA 1YQTA 4QOGA 4BJ5A 2HW8A 3GXOA 3WLTA 3A0RB 1PDOA 4TMTA 3R76A 3KJIA 5KVCA 4DLRA 5KX5A 1GWNA 4IJWA 4C4SA 2AWOA 5COBA 4X95A 1TAHA 1BXZA 2B83A 4ZT2A 1L5YA 2CHEA 4OAOA 4ZVOA 4JI8B 3FNQA 2W2TA 3T3PB 1HXHA 4HDRA 4ZTBA 3TAHA 1QIGA 2VWPA 3FHOA 4QUGA 2ZSAA 1V9LA 2A3NA 5BSRA 4QHSA 2CFSA 3QMWA 1VI6A 3IEUA 1W0JD 3L92A 4BO3A 3D43A 3JTMA 2I6XA 3KB8A 1RMYA 1RTKA 5ITZB 4R2JA 3RU3A 1I4TD 1RWPA 3OKPA 4IIGA 2H06A 1L7VC 3FF4A 4OREX 4HRAA 1WRBA 4F4IA 4JSRA 3E2MA 4YAFA 5JDCC 4KFTA 3LVQE 2HOQA 5EJFA 1VGQA 1GHTA 4P5PA 4K26A 4Q47A 5TX7A 5K3FA 3ZK9A 4EY5A 4LF5B 3E0QA 1EVIA 4H2DA 3V80A 2BZSA 2O2IA 2QT9A 4LOKA 4MV1A 2O14A 5CJPA 5TIIA 4WXPA 1PW7A 2YWGA 1U2TA 1KEPA 2BFMA 4DNFA 2X8WA 4XB1A 1JH9A 3QWIA 4LJKA 2NNLD 4LG1A 4NNJA 2GN1A 5KIAA 5COAA 5IXSA 1SKUA 1XT6A 2GASA 2JH8A 2XZDA 1FRVA 2GRJA 3WICA 2O07A 4AVYA 5BNFA 3AUUA 5ENDA 2O8NA 3K1AB 3NXKA 1G7TA 4GW3A 3DTTA 3GFQA 1U7TA 3MLAA 3QY0A 3RE1A 2GD2A 2PA0A 3LHDA 3SZRA 3ZJ5A 4DWWA 3C5VA 1X8XA 4TVBA 3N2KA 1QQTA 1V9SA 3KUKA 3NAGA 2RGGA 3HEMA 5JMTA 1IY1A 5SY9A 4PV7A 4I3GA 3CO5A 4CETA 3P9RA 5L3VA 2QTVA 1GY8A 2ZT6A 3WIDA 2F55A 2LP4Y 4QRIA 3V4OA 4R9SA 3VVLA 3H83A 2IKQA 4W9NA 5LQNA 3VR5D 4LXGA 4KXVA 1J99A 4ZJYA 4YCJA 1YBVA 3UBTA 1BCRB 3RRBA 1ZIOA 4C7OB 5DWVA 1FLAA 1ZSVA 3EQZA 4U2CA 4IIJF 4FMCF 3RDPA 2Q46A 1J9ZA 2E89A 1U0EA 2IU4A 3GWZA 3T7IA 1NVXQ 2EAUA 2ZYHA 4AB1A 5GONA 2ATIA 2XZPA 3TR6A 2HHJA 2ZTSA 1E3MA 4NOKA 4BU0A 1SIOA 1HQDA 2PD3A 4DR1B 3LF2A 1OJ7A 4FCCA 3M81A 4NCHA 1PP4A 3CNBA 4X1KB 3GZTB 1NI4A 3A1SA 4Z9YA 2ZUVA 4OHFA 1H0SA 3UJ3X 1GCIA 1C7QA 1MUUA 2FK7A 2Z0MA 5AHKA 4ZODA 5EJ4A 1USUA 5MN6A 2XUOA 2CXPA 1X2BA 1P1HA 2HIGA 2AOXA 4K6MA 1ELOA 4C1NA 2GM5A 4M0KA 4HSEA 1M10A 3RC3A 1TFUA 1ZGHA 2ODTX 4R5MA 4MGKR 1TVCA 2G0AA 4KFRA 4M0PA 1H5UA 2ZIAA 3PX2A 4IHJF 3LCVB 4ZQGA 3HI6A 3PFHA 1XNQB 3LRTA 4ZHSA 1OLUB 1RFGE 2B1RA 3MAJA 1C1XB 1IDN1 5BMVB 5HR5A 2JAUA 4OQDA 2P1DA 2W90A 1SHUX 3AB7A 4TLMB 1RMQA 4LJ9A 1DBQA 2QW1A 2CDAA 4NONA 1BIFA 4I1UA 3EMVA 4OSPA 4QECA 5KVQA 1M8PA 4GX0A 4JJ6A 3PC6A 5JSKA 4JELA 3B1KA 3EMBA 3ADKA 1NXQA 2F8MA 4WHMA 1GRVA 4P7KA 2EJCA 3OETA 1VRVA 2FX2A 1Z9BA 3PUKA 4LFAB 5KCZA 4DV6B 1VE7A 2EZUA 3JQDA 3EOAI 5FWXA 3K8OE 2FGJA 4PSUA 1OTHA 3ZCTA 4BO4A 1ZCFA 3AHJA 5AXBA 2PPVA 2HUNA 4U7GA 1YUBA 1FSGA 5F64A 2D8MA 3B48A 4BIIA 4N49A 4U6SA 4V0QA 2TSYB 3AT1A 2FZGA 3MBOA 3UHPA 3FSGD 3AUTA 1JPVA 3V33A 3MJVA 4X54A 1EFVA 1ORTA 2DQ4A 2PMKA 5IG2A 5TS3A 2FPLA 2P9CA 1CUJA 1GCOA 2BMVA 4PPFA 3C8MA 3ZY6A 4L8VA 4ZVRA 2P6UA 4BFVA 1IJFA 3JTEA 2QN1A 5KOYA 3PUYA 4C05A 3H5VA 4TRJA 5JXWA 4P2BA 5AI0A 4DUYB 3ONFA 1P8AA 2E4VA 1ZXBA 4G9BA 4NZ9A 2JCSA 4CG3A 3O31A 1BN6A 1ZVKA 2BRUA 2WKWA 1HE3A 4BQIA 2AEMA 1ADYA 1T0BA 3PD0A 3RVRA 1OILA 4J0GA 3D7RA 1AJEA 4FFOA 3ZIDA 3UJBA 2H1LA 4NFYA 1E6UA 1KRXA 2O3TA 3R8XA 1Z28A 1Q7CA 1XMPA 4ZANA 2DG2A 1R8JA 4JBIA 4EDFA 1BW9B 5FOQA 1XDUA 1XZFA 3NEYA 4B2YA 1IXYA 2PKQO 4B9AA 1I1QB 4K81B 1FQJA 2PCLA 4KR2A 1KZ9A 5CM8B 2JBAB 2PJUA 2ZBPA 3JYNA 1A8UA 3Q7RA 2GVZC 3COPA 1WKCA 2P2DA 4KSYA 1OE0A 4U39A 5TJ9A 4UBKA 4WK0B 5ALHA 4DSUA 4AJ9A 3Q87B 3ZWBA 2ZIUB 4MVJA 2I7VA 2JK0A 3A6JA 3OCCA 3LUDA 1VPLA 1QZ3A 4JU9A 5ALUA 1CZUA 3HCEA 3JVVA 5ER6A 1Y8RA 1ADFA 1RAAA 2VNHA 4UZSA 4PHGA 1K3FA 2V9CA 2N3ZA 5JZVA 2OZVA 1EESA 3M4YA 2P5YA 5CCDA 4C30A 1Y7PA 2CXQA 4FKZA 3ZNOA 1DC6A 2WYOA 4DSTA 2XCTB 2ILTA 2VDKB 1Z5VA 1T35A 2VZ8A 2X2OA 3PKZA 1NKTA 4MEAA 2Q3CA 4UNQA 4EVSA 1M1NB 2B30A 4YMHA 1LKZA 4N7BA 2O3QA 3SIPA 2XXAB 3GZ4A 3VPCA 4LRSB 1I4EB 1VJDA 2XB9A 3P4UA 1ZAYA 4R01A 1Z07A 2D3TA 1EJ2A 1XMIA 1NC3A 4JIGA 5BWCA 5U1PA 3ASZA 3DV2A 4BVJA 2XYRA 3M6LA 3HR8A 5ICSA 2F17A 3HYSA 3QF4A 1X42A 4S24A 4OG2A 2NO5A 4WNCA 1NLMA 1L5RA 4FC6A 3Q7EA 3KKZA 3EEQA 4N5DA 4AO6A 3P2IA 3QE9Y 4NLLA 5K4HA 5IUKC 4PSAA 4UBJA 5HF5A 1NV8A 2HLNA 3A9WA 4GWLA 4B4WA 5JSFA 3UPTA 3CO0S 2QTRA 4QVIA 3Q0EA 4F38A 5JW6A 1QYIA 2CMHA 4C3ZA 3MHTA 4YV1A 1BD3A 4F56A 1NUPA 3L7CA 1QO7A 3GGSA 5IU6A 2AOVA 3GUZA 3J7AC 4S35A 1MDBA 4MUNA 1MQSA 1M2OB 4L95C 1W0JA 1PGQA 3E5RA 4I6EA 1ZUHA 4UVDA 4N7JA 4X1YA 2V3VA 3I6QA 3EASA 4O0MA 3U7HB 2H5EA 3B13B 4I2VA 4ZHQB 4HLDA 2CK3D 1AO3A 3DMNA 4ZVKA 3ZWVA 3CH5A 2G40A 3IE2A 3IOBA 4OL0A 5C1IA 3HE3A 4J9UE 3KZNA 4Z7NB 2FG7C 1JIIA 1VCHA 2I6TA 4LXIA 3DHVA 3MWEB 4G24A 5BQOA 4M1MA 3E53A 2IUYA 1OZAA 1IM8A 3H2YA 4G25A 4K7JA 2OQ2A 1N6IA 5DI3A 1X2EA 1USGA 1GGJA 2QQEA 2CEKA 4PGFA 4I9UA 4A0FA 4ALJA 1GSIA 1QLHA 2O2ZA 3G89A 3ESQA 4KO2S 3WLOA 6REQA 3KZKA 2GBPA 4EG5A 2C2GA 2VZLA 4W9NC 1AGXA 2ORED 3HLYA 3ZDAA 4CM5A 3WDLA 3EBOA 2PKQP 3M6MD 3R0JA 4EUSA 1QKJA 5DHPA 3ITDA 5KREA 3OZSA 1D7AA 4ZARA 1EAYA 3BGDA 1DINA 3VPHA 3ER8A 1O8CA 5AQ1A 2Q2OA 4YI3A 4Y0AA 4MDHA 5D3MA 4FOOA 4B6OA 2N46A 2ZCVA 4LQCA 1AKWA 3WYFA 3ZYZA 2B37A 1EBBA 4DEYA 4PGGA 4AL4A 2C2HA 3H9CA 5EUQB 3IJPA 3A6HA 3QOFA 5JISA 5AKYA 2EP7A 1TXGA 1ZZGA 1SBQA 5FR2A 1DADA 2FPIB 4L72A 3U48A 3EVCA 2CDCA 1A4XA 1NG1A 4NMMA 3G49A 3BX1A 4O4IF 3RLIA 5LD2B 3ABZA 4DQUA 2GX6A 4AW9A 1SCBA 2Q50A 2JPDA 2OCPA 5C0OE 4CM9D 1VP3A 3CYFA 3N07A 3ZE9A 4NCBA 4ZI7B 3W2FA 1LDEA 2HFKA 1LTHR 3WZ2A 3DDSA 2QBYA 5E9WA 4E5NA 4IWXA 4O1MA 3W5UA 4NPAA 1THZA 4KPFC 4R9UC 2XGSA 2WI8A 3KHKA 1PR2A 1E5XA 2EP5A 4AYXA 4YLYA 1Y6JA 3KSAC 4EJMA 2PRYA 2V0GA 4M8IA 3ILVA 1XP8A 1DFHA 3TBFA 2PTGA 3OU7A 3TO5A 3NFRA 3D8NA 4TOIA 1Q84A 1YRHA 2X5NA 3R0VA 4NBVA 5EN4A 2NNWB 1V6SA 2BCGY 2F48A 1ZUIA 2E48A 4IILA 4GMXA 3T4EA 5BR8B 1TUBB 3OHMA 6ADHA 2OHIA 1NPDA 5H0IA 1HNZB 1BHQ1 2JGRA 3HWWA 1BROA 4WXYB 1H8HA 2BEKA 2VQSA 3LFHA 2ZE8A 2UZIR 1YDGA 1QIHA 4ARZA 3JYHA 2PG3A 5DFAA 1E64A 2AE1A 3ZX4A 3JPWA 3NHZA 3LY7A 1B00A 4JLNA 2P6NA 1BC5A 3C70A 3UK6A 1QGUA 2B8TA 2VSNA 3M9LA 4B31A 4KR3A 1MHPA 1SD5A 1G7RA 1QG0A 3H4TA 4NZOA 3NOQA 3G0IA 4FHCA 3TD2A 4TMFA 1AS0A 4HAZA 5AK4A 2JBHA 3RF6A 5BOVA 3BCSA 3STYA 4BKOA 3HXLA 3F5MA 3ZS8A 1JDJA 3EF0A 4QNRA 3T7AA 4QHTA 3LUCA 4JUAA 2K7FA 1JVBA 4CM3A 1M34E 1EBFA 2ZCUA 4WEOA 3HBMA 5H82A 3EBPA 3PGLA 2FPPB 2VDUE 3LCJA 4E4RA 2QBYB 4QDUA 2XZLA 1HURA 4V24A 2PQ2A 2VP3A 3LBIA 1BU8A 3C3JA 4WXMA 3NCHA 3FSEA 3NHSA 2H11A 2R66A 5KWIA 4RMNA 1YI0A 1Z0AA 1AC5A 1VGVA 2XCOA 2H0AA 2CJWA 1QFMA 2XNKA 2WHYA 3UW1A 1J0DA 1JQ3A 3KVOA 3RW9A 3PJGA 3VNQA 5KTYA 2XYVA 1SIBE 2CD9A 2K7ZA 3ORHA 2WTXA 1E3DA 4WFKA 3KTAA 1AHPA 3DBLB 3PL5A 2DEUA 3O3MB 2IEGA 3RVQA 1HT0A 3U1VA 4F9TA 4R1SA 1UPBA 3I09A 4OATA 1KBOA 5KKCA 1KFKB 2UKDA 3KJXA 1EYZA 1KKLA 2SNIE 1S2LA 2HYDA 1FPQA 2R6R1 1H5QA 2IYEA 1VRWA 1K68A 2BL4A 3MBKA 1WZNA 4GI2A 4IWNA 5LXTA 3S8EA 3KKEA 3RFVA 3ZU6A 1BWSA 1U31A 3USZA 1XJCA 5F1PA 4GECA 2GPSA 2J33A 1M6VA 3OKCA 1Y4UA 3ANMA 4BNKA 3RK4A 1XSEA 4ZZIA 4MWBA 7YASA 5C46F 3R6GA 5JSZA 1JXOA 1NBOA 2ZYGA 3BOSA 1L4KA 3QBEA 5HJ2A 5KU7A 3JSAA 2QTTA 3TPZA 5F1YA 2P3OA 4B40A 1JXQA 4UXIA 3MTBA 2ZBGA 2PH5A 2E37A 4NHOA 5DRYA 2W6OA 3A4YA 1Q15A 5TQVA 1D9XA 2VFAA 3C3PA 1I94B 3QGMA 2CBGA 3RS2A 3M6IA 3UAVA 2O7SA 3W7VA 2FSIA 1HZZA 2WK1A 3ZWDA 5JHGB 1J2YA 4A03A 5DNUA 2C2KA 1ZNZA 3A2KA 3TPCA 1JYFA 1KI1A 2PK3A 5SY6A 5TEWA 4XOUA 1SBHA 3PQEA 3G17A 4K5QA 4EG4A 3FMGA 3I9MA 4RIGA 1K98A 1RC0A 4KQXA 1DKLA 1ZU4A 1NOKA 5AOAA 4D80A 5BUSA 2VYNA 3BE4A 2EEZA 1P19A 1KAGA 1YBHA 3RBAA 1WEHA 3K05A 2A9OA 3QBDA 5CPFA 3FG9A 4AUMA 2QI9C 4TMVA 2R6DA 1KMCA 2EKLA 1AO0A 3R1IA 3STUA 4O3MA 3KOMA 5A5EA 1MX1A 3GLHA 2O8DA 1U7XA 3O73A 4X8OA 3R7BA 4Z1OA 1GCUA 1PZFA 1TD9A 3FYUC 3BTVA 4AAYA 2KYRA 4U2BA 4JLBA 3WLAA 4DDTA 3I2YX 1OH8A 5EEGA 4BN4A 4LTDA 4W63A 1U02A 4YO8A 2Y0EA 4QDZA 2C8JA 3GH3A 4NNOA 5HF9A 4N01A 3FPBA 3S2YA 2PE5A 4L4ZA 3T9CA 2AHOA 4WOCA 4LZOA 3RWMB 5LVAA 2H1SA 3EWSA 4KNWA 1R16A 1IMOA 1HYHA 3OD1A 1BTOA 1SQ6A 2GEVA 4D3DA 4TVSA 1WMEA 2VYFA 2B7LA 4YGYA 3K32A 3PXUA 2Y4NA 4AQDA 1AMOA 1RLTA 1Z5WA 3T3OA 1JEEA 4IIYA 4IAOA 2YL2A 4BKPA 3UTDA 1YQGA 2XB4A 4P54A 4B5LA 1Q1NA 2PU7A 2QTZA 1DRKA 1N9KA 4WPGA 1EJ0A 3G8BA 3IEMA 1ATZA 3CUYA 5EUBA 4OOFA 1HQYE 1XALA 2NTNA 5HZHA 1FTGA 1P7CA 2YASA 2OM2A 4QOIA 4NCIA 1YHYA 4CEJA 4AZ3B 1C30A 4D4KA 2ZTHA 3O4FA 4M7PA 3L7NA 3U44A 3PR2B 4X45A 2ATCA 2J6IA 2XCRB 1WF3A 4IDCA 2R1VB 4TMXA 3BTUA 3FROA 3NTVA 5G3YA 2I4RA 1XRRA 3DL7A 3L06A 3GA5A 3TDKA 1M54A 2HD4A 2H2HA 2HF8A 3JRXA 4A73A 2KHZA 3E6AA 3WKBA 4PIPA 4X9XA 4E7OA 2I76A 5KYXB 2VDLB 4IV5A 3CZ5A 1UJCA 2NXEA 5LA6A 5U4QA 2F3TA 1KKMA 4HS9A 5PNTA 2R8OA 1TCBA 1F8UA 1L7AA 1NT2A 5I4KA 4R8VA 1KJ8A 5JAOA 2E82A 1QFSA 4CIBA 1IN8A 4NDNE 1NKSA 2YXDA 2GVNA 3OTQA 1R8QA 4HMQA 3S2EA 1Y8RB 3VO1A 4WT7A 2PQMA 2P8SA 3AZQA 1O0BA 3ICCA 3IP5A 4OMUA 4KN6A 5BXYA 3ASYA 2FKAA 2WJZB 1RPZA 1E60A 1KPHA 1N57A 3LYUA 3CZMA 3B60A 2VHTA 1LV8A 1XTIA 1F2UA 3V8NA 1DXHA 1MQ8B 3JRNA 1QGYA 4P7FA 1T8UA 1R4NB 2IPLA 3K3PA 3C16C 4H59A 4JAVC 5EVJA 4EEKA 1JMVA 4UDXX 2VWGA 4HTFA 4XLZA 4EW3A 1DKUA 1U6JA 4JBHA 2AN1A 5CA1F 4KYTA 3WJ1A 3QKTA 4HLCA 3OMLA 1KZYC 2IC5A 3BCHA 5H3HA 5D8DA 2F1HA 2RARA 1PR9A 1Q22A 4GMGA 1TEZA 4F5WA 1GM5A 4PQEA 2O9JA 1CVLA 3RASA 4CM4B 3PQ4A 4M49A 2PH1A 4Q00A 4QBFA 4RE6A 4YA6A 2PZKA 2TMDA 3VYVA 2ZCJA 2BBWA 2AXNA 3FFAA 3SD7A 2PZJA 3Q1KA 4UJ3A 4C5CA 3NH9A 1FQWA 4HXYA 1RW4A 4M1KA 1DBVO 4NNPA 3LSYA 2X8JB 2OCDA 3K0KA 2G9VA 2OP1A 4GEKA 4QASA 3U61B 2HRQA 4UHEA 1PEDA 5FTNA 3TM4A 1N6NA 2VYVD 2JLQA 3F6EX 1GKLA 5JD4A 3C8DA 4BAZA 2GCPA 4QBTA 3W3AA 3DBIA 3KWLA 4WMLA 2W2LA 4R2IA 1JG6A 2P90A 4C7KA 2OHFA 2HA6A 3ROMA 1QGZA 1CTQA 1KDOA 3HP7A 2QVZX 4RELA 2NXWA 2JAWA 3VUEA 1V11B 2AFVA 4MKRA 3LDUA 3FR8A 4PIVA 4QRDA 1PZMA 2C29D 2IQIA 1RKUA 5JNVA 1JDVA 5F5LA 3V1YA 5B7PA 1ZVQA 2P2NA 1EX9A 2WJYA 5DTJA 1IVYA 1JDUA 1NW3A 4NL4H 4E1VA 3UHJA 2DE0X 2JGDA 2PBLA 1L1RA 1GZ5A 1FDTA 3AX6A 2GXQA 3BDVA 2AJBA 2FLWA 3L7AA 1MV5A 4OCZA 4YAOA 1JEYA 3HVUA 1P2SA 5BO5A 2ADFA 2BCEA 1E7QA 1T6BY 3K6KA 3H1TA 3HYCA 3KTDA 1DAOA 4LSZA 2QTBA 4KTTE 1XDDA 2J07A 2Q4TA 1XLUA 4H1TA 1C9DB 1E1MA 1Q21A 2Z83A 4H6XA 2CLEB 5HUQA 5IAAA 1PWEA 4L3VA 2BGWA 4BNWA 4L22A 4KSBA 4V0LA 1A76A 1A2BA 2HF2A 4GX1A 4NH0A 4XTCS 3QFRA 1JDZA 4F7WA 3SHOA 3E5HA 4F6RB 3CUSA 1KZGB 4YDHB 3IUQA 3IHTA 3NEPX 4GZMA 3AKDA 4QBGB 2D2VA 3K0EA 1L5LA 3DF9A 5FNVF 1ZNYA 2GHQA 4LCBA 2UDPA 2EX0A 3P0EA 4ZO8A 3U7GA 3N0WA 1OBVA 2QVCA 1FJXA 5CAEB 2JIMA 1TB4A 1J2RA 2QV7A 3BAZA 4ZDWA 4GWKA 3NRCA 2PX4A 1IB0A 2AKYA 2UV8A 4ZVLA 3R5XA 4RZSA 3RIEA 1HFKA 4Q4AB 1FDOA 2GH1A 1QHNA 1S8NA 1G17A 1UZAA 4W7HA 4QBKA 2ZI9A 3Q8MA 3T15A 4FFVA 3PHJA 1ZM4A 4K05A 4R68A 2PXAA 1N0WA 3GRVA 1FFXB 2BGKA 2EFHB 3B1VA 1M67A 3UYKA 1OMOA 3MGAA 2Y93A 4H7JA 3H9QA 4X0EA 4BQOA 3N8GA 1OH5A 5DGIA 2B6NA 3BTOA 3F5DA 3C3KA 3H4MA 4LY3A 3ST7A 1XYVA 3HFGA 4JUBA 5K3OA 3GPBA 3Q8KA 1SVUA 1B7GO 2YV1A 3LX5A 1X1TA 2CE7A 4IOKA 1CC1S 3KEQA 4S1NA 1IH8A 1EK2A 1KK0A 3A70A 3U9SA 5AW1A 5JRDS 4FNMA 4QFBA 1XEAA 3BWBA 2JLXA 2O5EA 1HYQA 1NW6A 3FPCA 1LLQA 4LHVA 4OK6A 1GPYA 2GBFA 1COZA 2J6CA 1HE2A 3LIIA 4UBNA 5KNBA 3W5AA 1C3OB 2NQTA 2DAPA 3EXIB 4BV9A 3ZHUA 4HN4B 1L5GB 3UGJA 4HQKA 3R8FA 4KQMA 5FNZA 1C4KA 3R41A 1TLLA 2ZSFA 3L07A 4FE4A 1TM7E 2PZLA 1VB5A 3DSRA 2FA9A 1K5HA 4RC9A 2VDRB 2E4XA 3K96A 3BB4A 3E7WA 1VCOA 4EKGA 1QP0A 1ZH2A 2HSJA 1VE6A 2H0RA 4DNPA 2ZVJA 1YJBA 3LZ6A 2ETXA 2B4QA 2FUG6 4JLUA 1GTVA 4FUQA 4U2EA 5EC8A 4UQOA 4IDNA 1CQZA 3NIWA 3OICA 3PR3A 4BLUA 4RCVA 3PPIA 1Z4KA 1QH8B 4QUHA 2G09A 5E1MA 4ND4A 1S0UA 3A11A 4MDYA 3WNBA 1X7ZA 3X1WA 5MHTA 4R16A 3CRVA 3GZNA 2ZSBA 1WUJS 4JR2A 3ZWKA 1G38A 3C3EA 5ARCA 3D9QX 4EA6A 1N2HA 5ICMA 2EOAA 3JASA 4AF6A 2FGKA 3BD8A 4YHHB 2OLKA 3AR7A 3FAZA 1C7IA 4LYGA 2SECE 4Q34A 5GOTA 4A7PA 5JAIA 1C3XA 2BKVA 1Q91A 5CIWA 5ELMA 1MAVA 2NXNA 4P98A 1ZVMA 1X3LA 4XH9B 3HM9A 5LM3A 2HIHA 1RE0A 4LAFA 4AKGA 3K5IA 1J56A 1ZH8A 1I32A 2BJVA 1WDLA 3EGEA 4HXEB 3I9OA 1V5EA 3OZAA 4RKQA 3OQOA 2WT8A 3EARA 4JI5B 4S0ZA 2BIFA 5TE9A 2W70A 2ZRIA 1F2DA 3BL8A 2ACEA 1AURA 4RPGA 5LP6F 1LX6A 2ID9A 3OVMA 1SULA 2YMPA 3VJKA 5LB2A 3HDGA 2ZRKA 16PKA 3RIMA 4I19A 4NBRA 3KYDB 3Q40A 4H7EA 5K8JB 2HH9A 5AOBA 4LXQA 4BVGA 4CQMD 5I3ZA 4OP3A 1JLSA 3M49A 3H8SA 2P9YA 4LOHA 4HH1A 2E9SA 3BG5A 5AVZA 1B76A 1D6JA 4KBYA 2FSGA 3ONDA 3LKVA 1D6SA 1DMSA 1NGSA 5EIEA 1JI3A 4R1LA 1RAEA 3SHTA 3IT2A 1P6UA 3WL7A 3BTSA 5AXAA 4WZAE 1K9SA 4JBNA 1SCJA 5ALFA 2ZZNA 2GO7A 3JZIA 3H18A 1VHTA 4EQZA 3QU5A 4MJLA 4ERXA 5IFKA 4BNGA 1VSVA 2V6GA 1DC8A 1K75A 4N7RA 1KWKA 4BX8A 4BQQA 3UKOA 4D9MA 4YASA 3HU2A 3UOWA 1A88A 1E8MA 4RQBA 1W34A 2AK3A 2P6PA 3PRHA 2XOKA 3VSCA 1N2SA 1VCMA 2ZVPX 1OCEA 3IR5A 1D0VA 1Y82A 2C20A 4PG7A 1BHSA 4D57A 2RHTA 7REQB 1E98A 3O1LA 4M6WB 1V7QA 2BELA 1E0AA 4D9KA 4HDSA 5J1SB 5G0TA 1T8PA 3MC1A 5B30A 2Q27A 1G20B 4MR8B 1WIWA 4ZO9A 1G5IA 5F7ZA 1XAIA 5EMHA 1IHDA 1V26A 3ENZA 3GJ3A 4HNAA 3ON5A 4FD3A 1K6MA 4PX9A 5D01A 5DSZA 5LQAA 5LQKA 3IVAA 2WHPA 2AOTB 2QG9A 3JATA 1ZH6A 2ZUTA 5KSYA 2QQ5A 2P27A 2WDZA 4UBOA 1QWSA 3PENA 2KPOA 2W0SA 4HLNA 1M6HA 4UKDA 4DEVA 1LDNA 3LBNA 3QUAA 3EXIA 4BFZA 3QUSA 4Q7QA 3KSMA 1PS8A 3DTNA 5BN1A 4WNIA 5BNTA 3G13A 2VF2A 1CF9A 4B6RA 2FNAA 3EEFA 3ZGNA 4DCVA 4DOMA 2I8AA 1GGHA 3VZPA 4E09A 4E6EA 1DGQA 1IVNA 2O8CB 4RV5A 1DWOA 4UTPA 2C7OA 3DWFA 3LT4A 4PC1A 3DE2X 4BLOA 1UMDB 3FPGA 4J9VA 2Q1XA 3H2SA 4IKOA 2HK8A 2XV1A 1GGVA 3VSDA 3I9NA 5BRJA 4KWIA 1YZHA 2PVCA 3K9FC 3LZDA 1VLJA 3SM3A 1P81A 3E61A 4FJ1A 1V1MA 1PUIA 3O2JA 1U3UA 4EUNA 2W5UA 3KNZA 3KKOA 3CZCA 4F8JA 4MW6A 2CVZA 3GG2A 4ID9A 2RKBA 3TRDA 3WGTA 1GUZA 1WU7A 3C8UA 4Q4HA 1PYDA 4MB6A 3EQ6A 3OM9A 3F4KA 1AGRA 1LBIA 4N3CA 2Q3FA 4G5YA 4OHOA 1TVKA 1LK0A 1CUSA 1IEXA 1NWHA 2WAAA 1U9IA 3QG1A 1FP7A 3N2GA 4OUDB 3AFMA 3A8TA 4FYXA 5JSUA 5KPDA 5I7VA 2AR7A 1LXCA 1YH3A 2XH8A 2XWQA 3MFQA 4L08A 2J5BA 3HC7A 2GBLA 4AF8A 1Z13A 2IHBA 3JVUA 4U1RA 3EZ7A 3WFZA 4IP0A 1NBAA 3QXJA 4B48A 5T64A 1GITA 2YHAA 3QU4A 3ANNA 4BNMA 2WZBA 3PZRA 1HYEA 3G9ZA 1J0AA 4RE5A 2VAVA 3ZCVA 1UR5A 3GFFA 1CRWG 2VSYA 4DMRA 1J8YF 5DH9A 3BRWD 3ZXXA 1FYWA 3KD2A 5AM2A 2DWCA 3QPBA 4JUCA 4C2BA 2VQFB 4PY2A 3WGVA 3MINB 3G0BA 1BKDR 1ICEA 4HLUC 3W5JA 1X1RA 1KMQA 3K1AA 3IP9A 2ZPTX 3L7DA 4RS3A 1M8FA 4X65B 5JCPA 3CH7A 1DEAA 1E62A 1EGHA 2CJPA 1XQ1A 2TECE 4AYWA 3B1YA 2Q29A 3KZXA 5E6SA 3NBFA 3TKYA 1JAZA 1IUNA 3WNDA 4HBGA 3OUUA 2DGDA 4ZVSA 3UXMA 1VLMA 3DT9A 4DV7B 1FFWA 4RJTA 1SVMA 3B8EA 4CL8A 1N8TA 2Z9BA 2AJ8A 1TTTA 2IHZA 4N5NA 3B78A 1G0NA 1AOXA 2EZ4A 2BBOA 3RCBA 4LWZA 4FI3F 1TJ5A 3FZQA 4G1EB 4Y6QA 1JA0A 1T9HA 4KWHA 2EU8A 2PY6A 4FGSA 3UVEA 5A05A 5CT4A 4BJ6A 1P18A 3FNBA 2OG2A 2NXCA 2SKEA 4KDCA 3H6HA 5LB4A 4N3NA 2GKSA 2C3PA 1YS9A 1CFZA 4UJ5A 4G4SP 2AG0A 3V8PA 4BX2A 1M9NA 2NTJA 3MTIA 2HAEA 3D5EA 2QMQA 3IEXA 5KQLA 2I33A 1YDFA 3I72A 3BGSA 2VDOB 3U5ZB 2NAFA 1TAUA 1DC5A 2HY7A 4HDRB 3OZ7A 1OXTA 4I1SA 2BY4A 3WQBA 1VMEA 2PUVA 3P2MA 5HGJA 3H6GA 1I3MA 5KHLB 5I7EA 1NAIA 2G5PA 4FHDA 4MPTA 1MH1A 3IDFA 4NWIA 2O3SA 5L40A 4NY1A 4ZOLA 3D7LA 3ROTA 1RT9A 3V55A 3DZKA 4BMSA 4JNGA 1SBYA 2JW5A 4X64B 3ORSA 2C4VA 4P36A 4BKMA 5CG1A 4HO1X 3V34A 1FSFA 1JSRA 2IDJA 3LHFA 1IULA 4RQAA 4QFDA 5JH7A 2AUNA 5EXSA 1JKIA 5F2EA 3SBXA 4UCXA 3PLNA 3ME5A 1NBWB 2PLFA 2XQVA 4J76A 4LOIA 5BQ3A 1L5QA 1JBKA 3NHAA 4AULA 1B2LA 2R8XA 4ETWA 2Q5JA 2R60A 3SHWA 1N2EA 4D3YA 4E13A 3NPMA 4OH7A 4DWOA 4NR0A 5HIJA 1XVVA 5HX7A 2W2QA 4HG2A 2O20A 2QRVA 3A0UA 1U11A 4ODIA 4IKPA 4RH0A 3QJYA 4V39A 4CR6A 1ZGJA 3I30X 4EVIA 2V6FA 1C9MA 1G21A 1RDFA 4DLBA 2ECFA 3JR3A 4AIIA 4YAKA 3INRA 3IP8A 1KMNA 1MNQA 1U4NA 2C0QA 2D7JA 1C9YA 4MVXA 3NTXA 3SPXA 1GGMA 4P4NA 4QTTB 3BILA 1NBHA 5E8JA 1AE1A 4KP7A 4B7AA 4WN9A 4ZCQA 2GEDA 1T9CA 5SYAA 3LDGA 1ZXLA 4YMLA 1I9GA 1UAYA 2VDWA 1B8PA 2PWAA 3P96A 3Q6NA 2PZMA 1H2YA 3KALA 2Q6VA 5HGXA 4JLOA 4ZU3A 4KGZA 4OLFA 4GQIA 2GAOA 3I0NA 1U2PA 4Q9IA 4B7ZA 5FLYA 3EODA 5JROA 3A6PC 1E5QA 2FFBA 4II7A 4CEIB 1CFJA 1MD9A 1SUCA 1IPFA 1X0XA 2R47A 4FQ5A 4OXNA 3DMTC 2XUPA 3MQ2A 3DDUA 3ZTYA 1MOSA 5LKAA 5KQPA 2JCGA 2GN9A 4JVOA 5BSMA 3VO8A 3AEUB 3VPDA 1ISSA 2I67A 4DCNA 5EHGA 5K2MA 5KU1A 1EQ2A 3UK7A 3THYA 5AJYA 5T8KC 4PSDA 4G01B 4GF5A 4HH0A 5BV0A 2I4TA 1KP9A 2EFJA 1I8TA 3FMIA 1EWQA 2JL1A 4NG5A 5CH3A 3CJTA 1P5HA 4YNBA 1NL3A 3LWNA 4TTPA 3MOSA 5AW4A 4CLRA 1NBMD 1TM4E 3TZKA 3W05A 3U31A 2JCBA 4FT2A 3OJOA 1KYQA 3VDQA 4ARAA 4IJMA 4GSYA 2G9QA 4M0MA 5CLLA 5GTDA 3DLTA 3D4BA 4BE7B 1GXSA 1ZVJA 3AI2A 1YL5A 2PNFA 2HRZA 4XYBA 1NR1A 5DNDA 2DLCX 2W48A 4G56A 5JFTA 4RQTA 1J0CA 5K5EA 3GROA 2VTBB 4NOMA 1NVAA 3DB2A 4UNSA 5DM2A 3B20A 3R77A 2EG9A 5C18A 5I8PA 2FN4A 1LGYA 4UDNA 4EL0A 1EXWA 1GPDG 2XKBA 2IV3A 1T2UA 3TX6A 3OQVA 1J7KA 2PXCA 3PKIA 1O6CA 3IIEA 4YLGA 4LPSA 3O74A 1J21A 3H5NA 3IRVA 3B38A 4PLCA 4MRMB 2JJMA 4MRPA 4KDRA 3SDSA 2PA3A 1MJNA 3NKVA 2I9PA 3MCZA 1W76A 3DFFA 3NT5A 2FXIA 1J8QA 1UC4B 2QVBA 3DAPA 1PR3A 1JPNA 1M2GA 1PS9A 1CP2A 1XFAA 2XOEA 2FY8A 2Z5FA 4P31A 2M6LA 1MN6A 3W34A 3QMMA 4MVYA 1ZG3A 3KS9A 3NMUF 1PR6A 2SKDA 3UWSA 4BOYA 3NO4A 2ICAA 1IUPA 1EP2B 3NYWA 3KB1A 1Q20A 4INOA 3ZZNA 5C8YB 1SRRA 2Q8PA 2HDHA 3MUEA 3ICPA 4RL6A 4C5AA 4R1PA 5JSQA 4QDKA 3M4NA 4IUYA 3LL4A 6Q21A 2C0PA 3R7AA 4EP1A 4EFLA 3J80A 5HE8A 2HREA 4ARIA 3OX2A 1XMOB 1F60A 3KL4A 3PUVA 1Y7TA 1US8A 4DNQA 5TMEA 2FEKA 4Z9BA 3WMXA 4EPXA 1LFDB 1II8A 3P4XA 4LRUA 1O2DA 1UWCA 4JLPA 3K0SA 1GG5A 3BMNB 4I1VA 4CIWA 2HJWA 4YQFA 3OQPA 2Z6AA 5MN5A 3VZSA 3U26A 3R6DA 1L3BA 3OU2A 3NCTA 4RADA 3BREA 5ILQA 1R0ZA 3TM5A 4ZCIA 1SOUA 2C1XA 4CLXA 1G8GA 1QFJA 1WB5A 2QSUA 3AHGA 3LP8A 3PFBA 2YFHA 4NG4A 4YDRA 4DIBA 3E81A 2H3EA 4JN6B 3RVLA 5DLQC 3E03A 5HPYB 1Z45A 4GLBA 3M1YA 3F1LA 3SU8A 1OFUA 2Q4RA 5JBIA 5HBGA 4BAUA 3JAKB 4CCWA 1IZ8A 2AHRA 4AUNA 3L1JA 1XEFA 4EF4A 1DQZA 2E0IA 3FSGA 5EWJB 1ZRHA 1WHSA 1R4NA 4MCJA 1XZGA 3KYCA 2XUHA 5F35A 5A9SB 2M1XA 1JHYA 4A8JA 5DBGA 1XZMA 2D06A 4ETNA 2HDNB 2J9RA 2CNKA 2PQ0A 3I1JA 4HYQA 1WA5A 4KEAA 4PAOA 4WY5A 1VMKA 2GT1A 5LMNB 3HQ4O 3RWOA 1EFKA 1TYAE 3QOYA 2YWDA 1HKHA 1SUDA 3MS7A 3TYXA 3WHIA 1QDUA 3NIBA 4FFDA 2OXTA 3VR5H 1GVNB 2Y0BA 1V5WA 2IJGX 3ACBA 3T1HB 2I34A 1JT9A 5JHHB 3QX8A 1UT8A 1VHQA 4MI1A 1K6XA 3RYFB 1Y9AA 5IDWA 2F43A 4NARA 5B6PA 3PICA 1VSQA 4LYYA 4P38A 3RC1A 1RLJA 2XGMA 4G63A 1NFQA 2QDXA 4XX0B 4DLAA 1CDEA 3GFRA 2P35A 1HG1A 2GKOA 2YW9A 5UKDA 2H00A 4BNNA 3QXHA 5IPFA 3C43A 4GNKA 2ADMA 2QGNA 4U2FA 3A6GA 5BW5A 2BTEA 2YICA 1SIUA 1E3EA 3LV8A 3ORRA 3SIWA 3PC4A 1WJGA 3OP1A 3GJ4A 4XGNA 5EWMB 1YTLA 1B93A 3HP1A 5TGZA 3VVCA 5AFSA 1SVNA 2UZ4A 4IF4A 1PQ4A 3BD6A 4U5QA 2AYXA 1TLTA 2XF8A 1UBJS 5JAHA 3Q5EA 2LE0A 1NIPA 1X38A 4IJQA 1EG2A 1IIRA 3G0CA 4DCGA 4HLUA 3JQQA 4W5NA 1TO2E 5LBUA 1WCWA 4ZYLA 1JDPA 4N5IX 3I39X 2IZZA 5IW8A 4H60A 3F47A 3EQ7A 3AIMA 1TF2A 1ULUA 4HTFB 2NUTA 1XWWA 2XMBA 2FJUA 1R9NA 2V7WA 2Z57A 4H3SA 1ZPDA 2EFGA 3H5LA 1E7SA 1NLZA 3AEXA 3O2SB 4OLJA 4EKIA 4KQEA 5CBPA 1JJFA 2I2WA 3ADOA 4K46A 2Q0QA 4B80A 3GJXC 4F92B 2I6GA 2FSUA 3EZXA 5EL0A 4JFAA 3RRNA 2Y76A 1B6TA 1UMCB 2YVLA 2ZTUA 4MUAA 1E32A 4CJXA 3R3HA 3I28A 1A96A 1N7GA 1RI5A 1SXJC 3DO8A 1E6EA 3GEGA 1PQPA 1I51A 4LYHA 4DMGA 4LF4B 2JLVA 2X40A 1GFZA 4I46A 2XD9A 4LJ4A 1OIVA 1IEVA 4N0DA 5FR1A 3WV5A 3OPNA 1XELA 2HMSA 4BWYA 1ADG