3RUHA

Alternative analogs as viable substrates of udp-hexose 4-epimerases
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
341
structure length
336
Chain Sequence
YMSRYEEITQQLIFSPKTWLITGVAGFIGSNLLEKLLKLNQVVIGLDNFSTGHQYNLDEVKTLVSTEQWSRFCFIEGDIRDLTTCEQVMKGVDHVLHQAALGSVPRSIVDPITTNATNITGFLNILHAAKNAQVQSFTYAASSSTYGDHPALPKVEENIGNPLSPYAVTKYVNEIYAQVYARTYGFKTIGLRYFNVFGRRQDPNGAYAAVIPKWTAAMLKGDDVYINGDGETSRDFCYIDNVIQMNILSALAKDSAKDNIYNVAVGDRTTLNELSGYIYDELNLIHHIKYREFRSGDVRHSQADVTKAIDLLKYRPNIKIREGLRLSMPWYVRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternative analogs as viable substrates of UDP-hexose 4-epimerases
rcsb
source organism Plesiomonas shigelloides
molecule tags Isomerase
molecule keywords WbgU
total genus 125
structure length 336
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ruhA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3ruhA02
3WTBA 7MDHA 3ROPA 2GR9A 3D5TA 3GF4A 2HRZA 3F1KA 5T5QA 2Y67A 4R1NA 4XYBA 3H9UA 4E3ZA 3TZQA 4AG3A 1SOVA 1YONA 1B16A 4YT2A 3TNLA 3CZMA 3DZIA 3KTDA 3L6OO 4JXKA 5DCYA 1F8FA 1KY4A 1EVYA 2DM6A 2H1SA 1K2WA 5COAA 3TJRA 1PQWA 1K6IA 1YQGA 2PH3A 2W2KA 5EIOA 3ZNOA 3D5QA 5FWNA 3FF4A 5T8KA 1KEVA 3F6YA 1CWUA 3L9WA 1NHGA 3KETA 3FSRA 2EF1A 2GNAA 3FN4A 4EW6A 2ZATA 3U4IA 2P4QA 4FS3A 4KWHA 4CMEC 1P1RA 3GGOA 3JQEA 2DPHA 3D0OA 1GFSA 3OQ1A 4DQXA 1EDOA 5JPIA 1DLJA 4R5HA 2PLAA 4URFA 4BNGA 5KKCA 5IDYA 1R0LA 2I9PA 4J1NA 4QQRA 4CLXA 4CM9D 3GEMA 4Z6KA 3TL3A 3HB4X 3DHNA 4MVJM 3GQVA 2WEKA 5KJFA 1N2SA 1HZZA 3GAZA 4RO0A 3HNPA 4YA6A 1Z73A 2X9VA 4CMEA 3H3JA 4D46A 1JW9B 4WGGA 2XAAA 3S8MA 1E6UA 5IZ4A 4J1TA 3P5SA 3VH3A 2EJWA 1X1TA 2Z95A 4R01A 1LRLA 1NAHA 3NKLA 4JBIA 4UULA 2C5AA 3JQ8B 2V6BA 1C1XA 1HDZA 4B79A 2GCGA 3FWNA 1IZ9A 3F4BA 4J7UA 5ITWA 3JQCA 4DBVO 1DPGA 1QMGA 1PSDA 1EBUA 5BR7A 7ADHA 3U5TA 2GUGA 1DIHA 2GPTA 5HS4A 4MO2A 2JAPA 3BMQB 1KS9A 4AJOA 2HU2A 3WBBA 2PD4A 1J4AA 2FZWA 2B36A 4Z0PA 1PQUA 4BO6A 5HS6A 1HKUA 3WSVA 1ZIDA 5DOZA 3DZBA 2DPGA 2C7GA 5L3ZA 4BB6A 2DFVA 3JQDA 1P1FA 2NU8A 4KOAA 4BMNA 3FBGA 4E4YA 2Y93A 4E2YA 1GUZA 1HETA 2UYYA 4XIYA 1UUFA 3E1KA 3FPCA 3H5RA 2NV6A 4ZU3A 2JFFA 1N92A 3K8ZA 4A26A 4I5DA 4DXHA 2J3HA 3C24A 4CMJA 2X9NA 4N54A 2HMTA 4DIFA 3WSWA 5I9NA 3ANLA 3UN1A 1VJ1A 4U6QA 3KYDB 2GGSA 3UF0A 5AXAA 3BHMA 3RSHA 1NQ5A 1KVQA 2HK9A 2C7VA 4CV3A 3AI1A 4DC0A 4E13A 4BNXA 4IY1A 3JYLA 3UUWA 1JLLA 1EQUA 1I36A 3NYWA 2W2KB 1DFGA 3AUAA 3WTCA 1DFHA 3SC6A 4W7HA 2Y68A 5THKA 3VVBA 3NT5A 1KVTA 4L76A 2VHYA 2FPGA 5B4VA 1AXGA 1Q1NA 4BNZA 2J3IA 2J5KA 2POQX 2F1KA 1YGYA 5DDIP 2RHCA 4FSHA 4ESOA 1ZO8A 1U2DA 3MTJA 3OJFA 3JYNA 1ENPA 3N7UA 1IHYA 1VKNA 1B2LA 2NU9A 3H9QA 1QRRA 4WASA 4ZQFA 2CVQA 3AY6A 1GAEO 1E0DA 1H2HA 4CL8A 3VH1A 2AEMA 1R0SA 1Z6ZA 4EI2A 3ZHYA 3DBHA 3D4PA 2FHSA 1HDRA 1IL0A 2OFPA 2ZQYA 3OIDA 4RF2A 4YACA 3RROA 3IJRA 1GTMA 4TVOA 4AFNA 1IHXA 5TT1A 1EVZA 4WLNA 2BGMA 4J0FA 1HRDA 3IL2A 1JA9A 1JVBA 3JD0A 4FOSA 4MPDA 1T2CA 1UP7A 1I3LA 3DR3A 4XCVA 4DRYA 2CY0A 2EKLA 1W73A 4BNWA 4XYEA 4JX8A 2Z1NA 4YT5A 4X54A 1NAIA 4IUYA 1R4NB 4CM9A 1N7HA 4RLSA 4ZD6A 3H2ZA 3ZHZA 2RAFA 1LQTA 4EJ6A 2QZ9A 1E7WA 3W4KA 1LLCA 4CMCA 3ASUA 3Q6IA 4WOKA 2BFAA 4J90A 1V6AA 3M1AA 2O48X 4QO8A 2NVWA 4XQ9A 1HLDA 2I6TA 4RPKA 3PWSA 3KO8A 1HE2A 1U4OA 4XDZA 3E03A 1LUAA 5JY6A 4PFJA 4IZIA 5LCXA 4U8GA 3ENKA 1VL6A 1AE1A 2O23A 2PNFA 5CDUA 2GLXA 4YDRA 5B4TA 6ADHA 2Q2VA 4B3HA 2H63A 2UV8A 1W8DA 3D1LA 3PPIA 1X14A 2OHXA 3MZ0A 3DFZA 2DVMA 2HLPA 4JBHA 4OKIA 2OP1A 5JCJD 2C82A 2NVUA 3AOGA 4A5OA 1ZK2A 2PY6A 2ZTUA 4ITUA 1ISMA 4UUPA 3RBXA 1SB9A 3R3JA 3WYBA 4ONEA 4Y6RA 4CUJA 4MVJF 2UDPA 4II3A 4I5EA 2GN4A 3I9OA 2A35A 4PG6A 2VYVD 4II2A 4RF4A 3K9QO 4FJ0A 4CMAA 4J7CA 4MVJE 1U3TA 1OOEA 4W7IA 1S6YA 3D3WA 2YV1A 2VTDA 1UH5A 1GYPA 1KVSA 3GZ4A 3E48A 2Y66A 4GX5A 3UVEA 4OQYA 5DP2A 5L4SA 4B4OA 5CPBA 3INGA 1IY8A 4L73A 4E12A 3JQBA 1C3VA 2Q1TA 3GUCA 4MJLA 1ARZA 3DMYA 4NFSA 5DULA 5IZCC 1BMDA 4XRRA 1PJBA 1UDBA 5H82A 1K6JA 5AXCA 3QWBA 1EVIA 3M6IA 1IUKA 3JQFA 1PR3A 2PGJA 3AM5A 4NMHA 2C0CA 2W98A 2X0JA 4DYVA 4EUEA 4IDBA 2O2YA 3GPDG 1Q7CA 3I9KA 2X0RA 4IDCA 4INAA 4A73A 4XGIA 3BMNA 1J5PA 3T7CA 4GL4A 3D4OA 3OECA 5JCJA 3BTSA 5A9RA 4XR4A 2EWMA 1E7SA 1CEQA 3CUKA 3SC4A 1A71A 6LDHA 4U5QA 4R1SA 4K6CA 3O03A 4QSMA 1CIVA 4YR9A 3ZV4A 1UXJA 2D8AA 1I30A 1NFFA 4RZHA 3L6EA 3FD8A 5IN4A 4Z3DA 4OHUA 4PLCA 5KJ1A 4WLFA 2F00A 1D7OA 3DBVO 5JYEA 5KOIA 1XSEA 1YRLA 2G76A 2PH5A 4ID9A 3ETEA 1T1RA 4GWGA 1E3IA 2DTEA 1NPTO 1LDYA 1PS8A 1GUYA 3CMCO 1NYTA 3GNTA 3SEFA 2OP0A 3Q1LA 5A04A 1LBEA 4TRRA 1EK5A 3UAGA 2YDXA 4BO3A 1MA0A 4ND1A 1MUUA 1LC0A 4HY3A 2VWPA 4YRAA 1PL7A 4WCDA 1ISFA 4PZEA 4CMIB 2BF7A 3RC2A 4BMVA 4W82A 3GEGA 4LSWA 4EYEA 5JBIA 3G79A 3HN2A 3DBRB 3ZV5A 4IINA 2GRAA 4PG5A 3Q2IA 1HZJA 4DL9A 2E48A 2ZB7A 3KLMX 4IQGA 3PFWO 5U4QA 4CQMB 4U0JA 4GH5A 3QVOA 2QYTA 4BS9A 3E8XA 4Q3EA 8LDHA 3DONA 1H2BA 1WNTA 2QIOA 1JWAB 4C4OA 3UCFA 2Y0DA 4J6FA 2JHGA 3E9MA 4MIYA 1U7HA 1PU2A 3V5NA 1FMCA 4Z0HO 3LQFA 4PVDA 5IN5A 2EGHA 1CQIA 4YBZA 4FFLA 2BFOA 5TLSA 1SOWA 3I1JA 3JQ7A 1PS0A 4PLZA 1ZJYA 1IYZA 2TMDA 3CH6A 2PZKA 2AG8A 2P4HX 3HWRA 1EQ2A 2D3TA 4N5NA 9LDTA 3QQPA 3WGTA 2QYSA 1UXKA 2WD8A 5U1PA 4MINA 5DOVA 3QSGA 1IPEA 1ZMOA 4RCVA 3PYLA 4MP3A 1EVJA 4MKRA 5HA5A 2O3TA 2CVZA 3T4XA 2PV7A 3HN7A 3OIGA 3EYWA 1P1IA 3JQBC 4GKBA 4HNGA 1U3UA 4K26A 4F46A 1BXGB 2LDXA 4EUFA 4G65A 1XG5A 3U09A 3N74A 3DBHB 3CINA 3VVCA 5A03A 3LT4A 3RC9A 2EV9A 2A92A 2X22A 2PZJA 2NM0A 4J7XA 4G81A 4FJ1A 1GQ2A 2C29D 1HDOA 1QYCA 4OXYA 3K73O 1ZK4A 2CVOA 3NUGA 4H16A 4AJNA 3A14A 3QVWA 1TVEA 4HBGA 4I08A 4EZBA 1LQUA 3LF1A 2Y0CA 5CHEA 1NBOA 2FR8A 2IZ1A 4DUPA 3EK2A 3OH8A 5GZ3A 4DIBA 5DBIA 2X5OA 2YQ5A 1ZMTA 1U8XX 1I5RA 3GRPA 5FI3A 5K6AC 4J4TA 1U2GA 2G5CA 4OQZA 3C1OA 1WMAA 4NR0A 1NQOA 3G49A 5COBA 5F1PA 1T1SA 4BKRA 1GY8A 1E3JA 1ZVMA 3AOEC 1C1DB 3PDJA 2J5QA 3NEPX 2ZB4A 3FWZA 1E6WA 1KBZA 3PQEA 2CMDA 4NJOA 2D5AA 2NVUB 1NHWA 1VPDA 2HMWA 2WYUA 4HX5A 4CMKA 2VYND 4DC1A 4M8SA 4RL6A 4OYRA 5A05A 2Y1CA 3I6IA 1W6UA 4ND4A 4BV9A 1PGOA 1XDWA 1ULSA 3RAJA 4TKLA 4OOEA 3L4SO 1CQJA 4J43A 3GVHA 2WYWA 3F9IA 3L9XA 4GVXA 2GF2A 3IIEA 4L8VA 4YTEA 4CQMD 1HYGA 4CLRB 2O3SA 1PGNA 3QE3A 4XQEA 1Y7TA 5DNAA 1IE3A 2O3QA 4OH1A 4BO0A 4O1MA 3K30A 4IDFA 4XD2A 5FI5A 3RUHA 3COSA 1C0IA 1YOVB 2PA3A 3TSCA 3AFNA 5JFOA 1N9GA 3HG7A 4E5PA 3TWOA 3UGKA 4NZ9A 2P9GA 3BTVA 4HFJA 1U8FO 4RVGA 4CM1A 1V3TA 3O4RA 1A4UA 2EP5A 3LT2A 1VL0A 1JAXA 1TT7A 3H8VA 3MJEA 3OQ6A 4YQZA 5U9CA 1C0KA 1DSSG 1HT0A 4R51A 4DYDA 3UFXA 1VKOA 3MJSA 1A9YA 3KBOA 5IFLA 3SXPA 2A9FA 2WD7B 4QFDA 3O38A 4TRNA 1ZXBA 3ZNPA 3KYBA 2OGUA 3E5MA 3WWZA 2OZPA 3ON5A 1QKIA 5CP8A 5HRUA 3AK4A 3K96A 4FC7A 2Z1MA 2PD6A 2QG4A 3O26A 4BNFA 5BSEA 3LLVA 1UR5A 4BO2A 1ISJA 2ZYGA 1ADFA 4P4GA 2YYYA 2ZIZA 4WJZA 4HFNA 2VRCD 4PLPA 5I8ZA 4Y6SA 2FR1A 5ER9A 1K0UA 4K28A 1O95A 1LJ8A 4Q3DA 1R66A 3GG2A 4QO7A 3GRKA 4GWKA 4FDAA 1R4MB 2VOEA 4OSOA 1NVTA 3WGGA 4EEZA 1H9AA 2GSDA 5EL0A 2DFDA 1YL6A 4B8ZA 1P9LA 1F17A 3GFGA 1MXFA 2DBQA 3HE3A 1SMKA 2FOIA 2V65A 2ZJ0A 1GUFA 3TPCA 4CLOB 1CETA 2V6MA 3KOUA 1X7DA 4IJWA 1AHHA 5I7SA 3ETGA 4R4JA 4JCOA 3Q3CA 2JD2A 1ID1A 4ZRMA 1YL7A 4CM4A 1O9BA 5DBFA 4ZQBA 4DTIA 4QEDA 3E6AA 4UAGA 5CDGA 1K89A 3CPSA 1EK6A 3SJUA 3NT4A 2HMUA 1NTOA 5JNLA 3S2EA 4UVIA 1WXDA 1JKJA 2DTDA 3RUEA 4AJ2A 3PTZA 3PI7A 5TX7A 1R4MA 4MKZA 2RBEA 1YS4A 2QW8A 4RQUA 3DBLB 4XEHA 4XQGA 1I10A 1X7GA 1HDCA 3PIDA 5COQA 3M2PA 4DLAA 1I2CA 2HAEA 1V3UA 1Q0QA 2VQ3A 2W8ZA 2WMDA 4D3SA 4BMSA 2OBNA 1P1JA 1ADCA 1FDVA 4CLOA 1L7DA 1HDGO 4FR5A 4MVJI 5GZ1A 3K2BA 1LX6A 5JLAA 2PD3A 4ALLA 1E6EA 3G0OA 2XXJA 4MVJH 5A9SA 2IZ0A 5JMPA 3ICPA 2O7QA 5FFFA 2W90A 1T24A 5ICSA 2VZ0A 4DQUA 1QV7A 1YDWA 3PIIA 4TMFA 3V2GA 3GVXA 4D3DA 5KJCA 5BQFA 2VRBA 2XOXA 2NTNA 1LSOA 3NAQA 4CUZA 1BW9A 4J9VA 1Y5MA 4CMGA 1Z7BA 1QYWA 3QJ5A 3BMQA 5TF4A 5A3JA 5ES3A 2JCYA 4IIVA 4QTZA 5L95A 4XX0A 4UUMA 4YJDA 2VT2A 1IPFA 4ALJA 1B7GO 2HK7A 3WS7A 1P0CA 1RJWA 3FCOA 4BL5A 3EW7A 2BI8A 1KOLA 3ITKA 3FTPA 3E5RA 5BNIA 4QUKA 5CPFA 4M86A 4OGWA 1E5LA 1GYRA 1M76A 3WWYA 1EBFA 2GN9A 4PLWA 1SPXA 1VJTA 3BZUA 2HJSA 2HJRA 3FNFA 1GPDG 4Y98A 3C3XA 3JTMA 4PGFA 4XZ3A 4D79A 1T2FA 5A02A 1BGVA 3HB5X 1UAGA 1ZFNA 3MJTA 4DBZA 1YBVA 3QP9A 4YVFA 4FBGA 5I7FA 2B0JA 3NJ8A 5FYDA 2NTVA 1KEWA 3GDFA 2JL1A 5T57A 2X8LA 1P1HA 3VKVA 2Q50A 3TL2A 1GV1A 1ZEMA 5C7OO 4DQVA 4WPGA 4PIVA 5KKAA 4JN6B 2IEBA 5BSGA 4GX0A 3Q11A 1Y8RB 5CG1A 1E92A 3OETA 1NVMB 1F8GA 1R6DA 5TJ9A 1LLDA 1WDKA 2GO1A 3G1TA 1YE3A 3JYPA 4PZCA 4E21A 5K6AA 2FY8A 3I9NA 3TDKA 5AQ1A 3F46A 3DZKA 1DRVA 3KV3O 1PZEA 1U3VA 4WNCA 4RLHA 4BNNA 1OC2A 1P44A 2Y1GA 1I0ZA 3ZW8A 4FB5A 3ADPA 3UXYA 5BSHA 4ROSA 5JE8A 4O0LA 1BVRA 1PJ3A 4HKTA 3F4LA 1SNYA 1PZFA 3BYZA 3O8QA 1FDWA 5A5FA 1C1XB 3H9GA 1Y1PA 5T64A 1HLPA 3H9JA 5J23A 4B3IA 4KQXA 4I8XA 5TNXA 3ZU3A 1T25A 1I3MA 5JC8A 3JQAB 1PQPA 1OFGA 4LK3A 5I7EA 4E5YA 5BT9A 5G0SA 5A9SB 1EUZA 1TB4A 4C7KA 3QV1A 3RCBA 1PJTA 5CG2A 2VTEA 3VKUA 3VH4A 4KMSA 3NGXA 4JP2A 4F6LA 1T2DA 1PJLA 1H6CA 3LC1O 3DAFA 1ISIA 3BHJA 3PJDA 4NBVA 1J6UA 4UVDA 3OBBA 3RFTA 2WJPA 4LW8A 2HO5A 4J4BA 1B15A 3G17A 4LISA 3BMOB 1U5CA 1UZMA 3HUDA 3TF5A 3VPXA 3IS3A 1LTHR 5BNFA 4FCCA 4NHEA 5A9TA 4O6VA 1NFQA 4BNIA 3IUSA 1WW8A 1X15A 2PGDA 2PFGA 1RM0A 2CZCA 1HTBA 3OMLA 3PVZA 5AVOA 1UZLA 1XQ6A 5F1OA 5JW6A 1ADGA 1GZ3A 1UXIA 3INRA 5F5NA 5TGDA 2O7SA 4OOFA 3PYXA 3GUYA 2B83A 4IJKA 5EERA 5KVCA 1X0XA 1YBAA 2OO5A 2WM3A 2J6IA 4BO8A 2FWMX 3I83A 2QHXA 2OMEA 4R9SA 4XDYA 1N7GA 3VPSA 1O5IA 1D4FA 3QHAA 5K9ZA 4CR6A 2EXXA 2JAHA 1DAPA 2Q1SA 1WP4A 4ZN6A 3PYMA 4K9DA 4FW8A 1P77A 1QSGA 3GK3A 4KDFA 4UUNA 1DJNA 4WE3A 5AYVA 4BGIA 2XXBA 1T4DA 3R3SA 3TRIA 1XU7A 2B35A 5G4KB 1DIGA 3DC2A 3QIVA 1TI7A 2EJVA 2PK3A 4J49A 4LN1A 2DU8A 3N58A 1M2WA 4IM7A 3I9LA 4ZICA 1Y8QB 3DBRA 3RJ9A 2D1YA 4BIIA 4WCFB 3WG9A 3WJAA 1QYDA 2X0IA 2WTBA 5C3MA 2Y0EA 3WYCA 1DHTA 2VHWA 2X5JO 2NACA 3UCEA 4BB5A 2P9EA 3WMXA 4JP3A 4GSLA 2O4UX 4B7UA 1XKQA 2RHRA 5CEJA 2RH4A 5JAZA 1B3BA 1GQYA 1E3WA 4CM3A 1R12A 3DAGA 4WOJA 1QR6A 4FFPA 2QZZA 3VPGA 2HKIA 1BVUA 2ZCVA 5IG2A 3IOYA 4FPXA 5A1TA 1Y6JA 1MC4A 4FJ2A 1RYEA 2O2SA 3BA1A 4DPKA 4IPTA 5T67A 4Y9DA 4YYZA 3AM4A 3BMOA 5I8WA 3GH3A 1B8PA 2YDYA 4ZQHA 4FFNA 2YV2A 4KWIA 4ALIA 1E7MA 4ZGWA 2C2YA 4A27A 2VUUA 2NVBA 4PRLA 1M6HA 3ONDA 4NBUA 2AQHA 4EBFA 3MJVA 3KEOA 4MVJG 3DQPA 1I3NA 5CDYA 2I65A 2GDZA 2XPCA 1O6ZA 1P45A 5IXYA 3ITDA 3VPHA 3LSYA 4J3FA 2V6GA 4Z3KA 2AQIA 3EDMA 1NVGA 1VLLA 3GDGA 3GGGA 1B26A 1RWBA 3T7EA 1LEHA 3DMTC 2Q2WA 4R3NA 1Z45A 3QVXA 3EMKA 2D5CA 3AM3A 1B14A 2X0NA 4UEOA 3VHRA 3WGIA 3A9WA 3CXRA 4JBGA 3JQ8A 4IBOA 4PLFA 5JO9A 1TT5B 3KSZO 3STHA 4BNJA 5JDCA 1WZEA 4B4WA 4KUGA 4M49A 1KEPA 4HFMA 3ZU2A 4IXWA 4ND3A 1NQTA 4FOOA 2Q46A 3DZHA 1BSVA 2HK8A 3WNVA 2GZ1A 2PZMA 3AW9A 1NPDA 9LDBA 3OEWA 2H5LA 3DOJA 3PHIA 1YL5A 4OMUA 4PG8A 1O89A 4CL3A 3C1AA 1I24A 3NV9A 1SCUA 4NDNE 4I9NA 3IKTA 1DJQA 4ZQGA 3P2OA 4AJKA 2ZJ1A 4NI5A 3I6QA 4E0BA 5JY1A 1JU9A 4BGUA 3B70A 1ONPA 4LVCA 1NNUA 4FN4A 4P22A 1NR1A 4A7PA 1BXGA 2YQ4A 2QRKA 1A27A 5EPOA 2JJYA 4BKOA 1JDJA 3QA9A 4JK3A 1B3RA 1EUCA 5B37A 1LSSA 4YJGA 3CIFA 1HEUA 3K31A 3BXXA 4IGEA 1I2BA 3KEQA 3FBTA 4UVHA 3WNQA 1RM4A 4Z0TA 3FNHA 5L4NA 1P0FA 1PGQA 2NLOA 3PRJA 2HUNA 1HSOA 2GZ3A 3TOXA 4F45A 5CDSA 4U0KA 3U0BA 1YH3A 3DOCA 1UP4A 1SEVA 3QWAA 4OL9A 4PRKA 4A03A 5KJEA 1DRUA 1GV0A 2BGKA 2P68A 3OSUA 4RPGA 1F0YA 3MWDB 4J0EA 3ONFA 4N5LA 4XKJA 5F1KA 3RFVA 4IDGA 3UICA 2Q3EA 1WPQA 1Y81A 4HUJA 4RDHA 2EIHA 4FGSA 3RASA 3WLEA 3A28A 1E1MA 1ENOA 3GN2A 3IUPA 1KERA 2NUAA 3WGQA 3WX0A 4D45A 2G1UA 4XJSA 4AVYA 2Y1DA 4LMRA 1P33A 1X7HA 2VNAA 1GCOA 1I2ZA 2VCYA 1JWBB 1XR3A 3ZGYA 3PXXA 3ST7A 3E18A 1GL3A 4YRBA 4PLVA 3GNQA 5CEFA 1OAAA 5IDQA 1HXHA 3I52A 5K0ZA 3QWHA 1LXCA 3FNEA 1IULA 1DDOA 2C5EA 3ENNA 3LLSA 4QECA 3ROQA 3GC6A 4J2HA 3VTFA 1DB3A 3R0IA 2C2XA 5KVSA 3EGOA 4NJMA 4E5MA 1TA4A 3T4EA 2GASA 3JCZA 3D3EA 1LLUA 5A4DA 3PQFA 2ZKLA 3IDSA 1YKFA 1MV8A 4TRMA 5MDHA 1AHIA 4I1IA 1V0JA 5KJ6A 1LSUA 3U4CA 4HV4A 4Y6PA 1QLHA 2IE0A 3ZI0A 3L6DA 3CSDA 4A10A 1ZSVA 1KC3A 5DF1A 1N9GB 1QYVA 3AUUA 3LDHA 3PZRA 2X86A 1H6DA 5KNLA 4A0SA 3PHLA 1PJCA 2PWZA 4IS3A 1M67A 1PGJA 2PKRA 3ASVA 3OICA 3DMTA 3NX4A 1NWCA 5B12A 2VYVA 4O5OA 1PGPA 1A4IA 5B4UA 2IDZA 2VRCA 1R4NA 3FRJA 3PK0A 3S2FA 3EZLA 3WGYA 1JKFA 2D4AA 2O3UA 3DTYA 3IJPA 3X2FA 1GZ6A 4JJFA 4CQLB 1G0NA 4PG7A 5JYDA 4IMRA 3NTQA 3JD4A 4XGKA 5KCZA 1MXHA 1UXGA 4BNKA 4FFMA 2W2LD 5F5LA 5JAIA 1E1NA 1C0LA 1MX3A 1YWGO 4ND5A 5DBGA 4D43A 4PN3A 3QY9A 5ER6A 2HQ1A 2HSDA 2D0IA 4M54A 3GHYA 5F21A 1M66A 4CLEA 2HMVA 1WDLA 1Q7BA 1RKXA 2O3RA 1YQDA 4MP8A 2OXIA 4WCFA 4R54A 3WGZA 4YT8A 5I9LA 1E3LA 2QRJA 1P74A 1HYHA 1YXMA 2BI7A 4WEOA 4WNIA 4Z9FA 2CDBA 1Q0LA 3IQDB 4IJVA 1F14A 2ZB8A 1G6KA 5TQVA 1E3WB 1SZJG 1I32A 1H93A 1G1AA 1A7KA 4B7XA 3RUAA 3JQAD 4BO9A 2IYPA 4L74A 3GZNA 3V1YA 3KLPX 1DO8A 1Z82A 4I5FA 2NQ8A 4HXYA 3DWFA 5IXSA 1OC4A 2X23A 3PQDA 5G0WA 3KRTA 2EGGA 2CDCA 3H6KA 2FSVA 2QQ5A 4B4UA 3UCXA 3A1NA 2OUIA 3PWKA 2G82A 4YAIA 8ADHA 4AJ4A 4UREA 2IZZA 3DL2A 4WLUA 2CUKA 4YRDA 1GD1O 1I8TA 4YT4A 1T4BA 3AI2A 3G1UA 3SBOA 3U9LA 2G17A 1PJ2A 2Q4EA 5L7YA 1ZK3A 3P19A 3A4VA 3MEQA 2Q1UA 3QVSA 3WBFA 2YHIB 4TQGA 2QRLA 5T6BA 4CV2A 3SLKA 1DIBA 2OOSA 3FR7A 5LDHA 3W8DA 4IXTA 4HNHA 4IJUA 4A2CA 4TSKA 4QX6A 4RDIA 3ZNQA 3M1LA 4IQ0A 5EQDA 3EVNA 4Y8VA 1H6BA 3I4FA 1DXYA 4KP7A 4CR8A 5L4LA 2JCVA 4LRTB 1WMBA 3F1LA 4OM8A 3OHSX 5EN4A 1LDEA 4OSPA 5AXBA 1MG0A 1HSZA 4BKUA 2PTGA 4DA9A 4YAJA 3QRWA 4RVDA 1IOLA 1KIFA 1LNQA 2EW8A 2RH8A 4GSKA 4KQWA 3PHHA 1VC2A 4PLGA 3WFJA 4EEXA 2DQ4A 4FFRA 5G2OA 2ZB3A 3VZSA 2WYVA 4LSMA 1WLYA 3TOZA 3HHPA 4NQZA 3C7CB 3UW3A 2VUTA 4Q3NA 1F12A 5DZSA 4OXKA 3GMDA 4MOWA 1GCUA 2I5PO 3DZJA 3B1KA 4JNKA 4BO7A 3D3WB 3PGXA 4M87A 1YB1A 2O4CA 1EDZA 1FJHA 3PHGA 3RJ5A 4QT0A 3VZRA 5KVVA 1GEGA 5G0TA 1GPJA 1NR7A 3DO5A 2DTXA 1SB8A 2GYYA 4FIZA 4IDDA 4AJHA 1R0KA 2B37A 4FGWA 3JQ9A 5ICMA 1LI4A 4IDEA 3RUFA 2W4QA 1EFLA 5ENVA 5TSDA 3GDOA 2X7HA 3H9EO 1LRJA 4AJIA 3AU9A 4CJXA 4M1QA 1HE4A 3B20A 3Q0EA 4RV9A 2R00C 1NM5A 4O63O 1QYXA 1XEAA 4ND2A 3SLGA 2GD1O 4CM8B 4ZJUA 4RF5A 3PWZA 4HADA 4TWRA 1GDHA 1Y5RA 5DP1A 4D42A 1E7QA 4F6CA 3LF2A 3U3XA 4BQPA 5EQFA 5KIAA 5AXDA 1KY5A 3DEYX 2B69A 1HDYA 5JAMA 3UOGA 4WLEA 1DLIA 1ENYA 2CF6A 2NTJA 4NU5A 3HDHA 4RPLA 2WE7A 5CEEA 3GNSA 3K6JA 3DAPA 5ILGA 4NFYA 2ET6A 3I23A 3CZRA 4E2XA 3RU9A 1HF3A 5G4LA 1SO8A 4PLYA 3WGOA 1TEHA 3K92A 3GVCA 1FXSA 5GZ6A 2FRDA 3BMCA 4J2OA 3GOHA 1E3SA 4YJFA 4B4VA 3MJ4A 3W6ZA 4D0RA 4E33A 4BO1A 1FDUA 4YAEA 3VOSA 2YFHA 1VM6A 4MVJD 4AICA 4XYLA 5ITVA 4HP8A 3OA2A 3RUIA 4G5HA 2BGLA 2EP7A 2C07A 1H5QA 1K5HA 3HQ4O 1DC3A 1ZW1A 3HDJA 3DB2A 3GMSA 3JQAA 4W9NC 2OBYA 1XHLA 5TT0A 4BNUA 3LU1A 4RVHA 1ZZEA 4U6SA 3V1TC 5L45A 1TT5A 3AJRA 4UUOA 1D8AA 3GZNB 2VHZA 3ZW9A 1V8BA 3ZWBA 1U3WA 3JQ6A 4GBJA 3GA0A 1YJQA 2ZCUA 4L4SA 4BHTA 3L77A 4R1UA 1AUPA 1JKIA 1ML3A 3E9NA 2VYNA 2PKQO 4M89A 3RC7A 1U5AA 1I33A 2J3JA 1CERA 4I5GA 2CNBA 4BGVA 3CE6A 4Q3AA 4DPMA 5TIIA 4CMHA 2WSBA 3OJEA 1MFZA 1GR0A 2JKVA 3X2EA 4BNMA 4RPHA 2Q45A 2FSSA 3JV7A 4JQCA 1P3DA 1M6WA 3DZFA 1RPNA 3H5AA 4ZRNA 3NT2A 4ALNA 3W6UA 1BG6A 1XELA 3TN7A 3EZYA 3BHIA 3WIEA 2BKAA 1BHSA 3D4NA 1J0XO 1GEEA 4CM7A 1XGKA 4AJEA 2YHIA 1V9LA 3WIDA 4OIMA 1YOVA 3DBLA 1CDOA 1E1KA 5GY7A 4XYMA 4AJ1A 4E32A 2PGLA 2QX7A 2E82A 2X9GA 4PG4A 2I76A 3CEAA 2X58A 4CLRA 3B1FA 3KUXA 3DHEA 1A7AA 3QVTA 1N5DA 3GVPA 3DXFA 3I3OA 3JSAA 1CYDA 3L4BA 4PVCA 5H81A 2NNLD 1EMDA 3U4HA 4JJIA 2ZYAA 4LCJA 3ZWVA 2VHVA 4PCVA 2P2SA 3ICCA 2UVDA 4BO5A 4XRGA 2FZEA 2AW5A 3BAZA 5L51A 3MTGA 1PJQA 3U4DA 1HWYA 3JYOA 3OP4A 4XWYA 4CV0A 3GY0A 4GI2A 4GPD1 5C7LO 3C1TA 2GZ2A 1A5ZA 1Q2XA 4YCAA 2NQTA 2JFGA 1ISGA 2DKNA 3FHLA 3GHHA 3NDIA 4R9RA 3TZHA 3RD5A 1DC6A 3VZPA 4JIGA 5L53A 2NSDA 1SC6A 5B1YA 1YVEI 4DVJA 2YW9A 1R37A 1MP0A 2YV3A 1W4ZA 1LDNA 5LC1A 3KB6A 3DOOA 4AJLA 1HE5A 2YUTA 1BW9B 1WVGA 3V2UA 4XJTA 1A72A 2B5WA 4GKVA 4YJFB 4XR9A 3F3SA 2DAPA 3BMCB 5EESA 4W99A 4H15A 3NRCA 3NTRA 2RIRA 3ZDFA 4D44A 2E4AA 2AEFA 1CJCA 3F47A 2EG9A 3VH2A 3AUSA 2VWQA 1OMOA 4CQLA 1ZBQA 2Y1FA 3VC7A 4EDFA 4BOYA 1LDBA 1LDMA 2CFCA 3H4VA 1IZ0A 1U4SA 1ZH8A 4GX1A 3OQBA 5BNTA 3MOIA 1NQAO 4K1LA 4J16A 1OI7A 1WAMA 4UVEA 5IF3A 3PDUA 1Y9AA 4D3FA 5KTKA 2ILTA 2NADA 1ZNQO 2GN8A 2I3GA 2UAGA 2R00A 3L4BC 2H9IA 5AOVA 3PGJA 5THQA 3ULKA 1WDMA 2VZ9A 3OEYA 4KUHA 5H83A 1DIAA 3ROMA 2BH9A 1C14A 3UH1A 4GLLA 4TROA 4IMPA 3GG9A 3PFFA 1D1TA 1LDGA 3LK7A 4OO3A 5ILOA 2Q1WA 4HFRA 4CM4B 4RORA 1PWXA 1XCBA 2BELA 3U62A 4E31A 1LU9A 1ONNA 3RBZA 3GVIA 4RF3A 4KZPA 5G0VA 3AU8A 2O3JA 5GMOA 3VZQA 4E5KA 2E6UX 1NP3A 1ISHA 3KYCA 1ONOA 1YO6A 1R15A 2X4GA 3KVOA 3W4JA 3AOEA 1LRKA 2Y99A 2VT3A 3ABIA 2D2IA 4S3MA 3MCVA 5TJHA 1M75A 4Z9XA 3ORFA 3OIFA 4JJGA 4Q39A 1BTOA 1YB4A 2GN6A 2WWRA 4R16A 2JCXA 2VWGA 3Q9NA 3H7AA 2OORA 3B1JA 4MP6A 1EEHA 4TZTA 2G0TA 1RM5A 4J1QA 3W8FA 4CM8A 3WQRA 1YJ8A 3QWFA 1F06A 1JN0A 4TVBA 4GX2A 3MOGA 4TZKA 4WCFC 4ZHSA 3NTOA 4WLOA 4H3VA 3FI9A 2C20A 1UDAA 4ZVVA 2BFMA 3GFBA 4Q3BA 1MFPA 1IB6A 3GLQA 4R3WA 1D3AA 3PJGA 5DCWA 1BXKA 1KYQA 4Z9YA 4ALMA 4WEQA 4R68A 1HE3A 1K3TA 4HWKA 3BTOA 1SBYA 4IQ8A 4DIOA 3E9QA 4OAQA 4YJGB 5A06A 1Y8RA 1N8KA 1YDEA 2Q99A 1LLQA 3HFGA 1BRMA 1SEPA 5IJZA 4BQRA 1YQXA 4PLHA 4GGOA 3H65A 1ZJZA 5L7WA 5IDWA 1H0KA 3ZWAA 2DBZA 3GPIA 4BNTA 5DT9A 2CSUA 1Z7EA 1ORRA 1C0PA 5MGBA 1MGOA 3V2HA 1J49A 1PIWA 4EGFA 3W1VA 5L7TA 4CPDA 5T8KC 1P31A 2VNSA 3S2GA 1PS9A 3P2YA 4PZDA 2I3AA 2IEDA 2WDZA 4F3YA 2DLDA 3U49A 4CODB 3ZU5A 2VHXA 1NPYA 1FF9A 1Y8QA 3WMWA 4GLOA 1D1SA 5DN9A 1XYGA 3ZH2A 1NXQA 1E77A 1OZAA 4N7RA 1EUDA 2WE8A 3LYLA 4N18A 1X0VA 3OFSA 3ROKA 1S7CA 4WECA 1MLDA 1XLTA 3TZ6A 4LRSB 4RVFA 1ZXLA 2R2GA 4YJHA 4RVSA 3ZWMA 3HFSA 4NJMB 2PZLA 4KTVE 2VWHA 1L1FA 2PKQP 3ETDA 3UKOA 3RKUA 2IXBA 4AJPA 4BVAA 4DLBA 4D41A 1E5QA 3KSUA 1DFIA 4DLLA 1B0AA 4N5MA 4NNJA 5CDTA 5EMHA 1N1EA 4EITA 4CQMA 2I99A 3OJOA 4BKPA 4EJ0A 2AG5A 5JC1A 4R41A 1QV6A 3ZWOA 2X5KO 3HADA 4BV8A 4CM5A 2RCYA 2BRUA 5LDGA 2EW2A 1RM3A 3DZGA 2VZ8A 4CMIA 4YJHB 3PJFA 4B3JA 2HRBA 4NBTA 1TXGA 2AA3A 2UUOA 5JCXA 3OF2A 4NK5A 2J8ZA 2A4KA 3EUWA 4L4XA 3LT1A 3ZNNA 1NWHA 2DBRA 2YY7A 3ZWWA 3WDSA 4J9UE 5JS6A 4W6ZA 2HMSA 3IMFA 1EE9A 4UEKA 3WOHA 3ZWNA 3CMMA 1JTVA 1XU9A 3D7LA 3PLNA 1O8CA 5IDXA 4YEDA 3WFIA 2FMUA 5JO0A 1VRWA 2FPPA 3H5NA 1LC3A 4I9HA 4GMGA 4BO4A 3ZWPA 4YAKA 3JQFC 3WGHA 2DUUA 1HYEA 5L40A 5JSFA 3L0DA 3G3EA 1DOHA 1ADBA 4UVGA 2AHRA 3GR6A 3I4CA 4MKXA 3RI3A 2YZ7A 4AL4A 3AY7A 2B5VA 3FNGA 4L75A 3DDNA 2JD0A 3JQGA 2E49A 3DHYA 2FPIA 3HZZA 1PL6A 4IS2A 5DCUA 1T26A 2CF5A 3HJAA 3V8BA 5BSFA 4MVJP 1ENZA 5CAEA 1NFRA 5HM8A 4CLHA 2AXQA 2FP4A 4GQAA 4YB8A 4NG5A 3TZCA 3FPLA 3WYEA 3R1IA 4Y67A 1ZK0A 3QLJA 4W4TA 4DGSA 3NDJA 2YJZA 2BLLA 3JD2A 3IC5A 4CMBA 1DHRA 2X6TA 1H6AA 3IAHA 4XIJA 3OJLA 3KM0A 3PEFA 5A5EA 2EEZA 3RC1A 1XIVA 4BNLA 1Q0HA 3CTMA 3JD3A 4OKNA 3WICA 4LVUA 4MIEA 1UJMA 2CDAA 3OA0A 3QWIA 3ZHBA 4L9RA 1U9JA 3ANNA 3ZWYA 5HTOA 3RUDA 4QXMA 3WR5A 3ZCXA 4XB1A 1KEUA 3W8EA 1VSUA 3RQSA 3ZV3A 1FDSA 4OJNA 1V35A 4CLDA 4E6PA 3WLFA 1SAYA 2I66A 4P4NA 3KYCB 5HWSA 1PJ4A 2EHDA 5HBRA 1H94A 5JMWA 3ZZNA 3AI3A 3GGPA 3TQHA 4CV1A 2H6EA 4DMLA 4WLVA 4BNYA 2BHLA 1B8VA 1CRWG 5TS3A 3M2TA 4MDHA 1NASA 2B4TO 3GAFA 2Y05A 2NU7A 1XA0A 4I9UA 4BGEA 3LC2O 1HL3A 4FD3A 3ZWXA 1HDXA 4YPOA 4AJJA 3C7AA 5A3VA 4GGPA 3VDRA 3I9JA 3WB9A 4UEJA 3LT0A 1LSJA 1MB4A 2O50A 3I5MA 4JLWA 4O59O 3IP3A 4E30A 3LC7O 5F3RA 4IDAA 1C1DA 4XB2A 1E3EA 1QG6A 4NBWA 4NK4A 1KC1A 3EHEA 1DRWA 4MVJA 3W4IA 3P7MA 4L0QA 3CKYA 1WWKA 1FDTA 3ZU4A 3KHUA 5IZCA 1PJSA 1PZHA 5JDIC 1UP6A 1PWZA 3C85A 4J91A 4NH4A 3GT0A 3SVTA 2X1HA 5L9AA 4IGFA 2EKPA 3S1LA 4LCEA 1K6XA 4E2WA 2P9CA 2DUWA 4LMPA 5FF9A 3L07A 4RQTA 4M55A 1GQQA 1MC5A 3S55A 3RIHA 1O0SA 3VAZA 5G4KA 2FN7A 2C54A 2ZK7A 3RBVA 2IRWA 1QXSA 3ZWCA 4RGBA 3FTNA 1ZKMA 4KUEA 1QLJA 4RJTA 3TZKA 1X13A 2B4RO 2CD9A 4DMMA 1V3VA 3Q9UA 1U1IA 4YQYA 4WKGA 2Q49A 4LGVA 1Z74A 1I01A 1ZSYA 4PLTA 3BIOA 1BXZA 1T2AA 1DIRA 4NBRA 4RZIA 2AEJA 1XQ1A 2AE2A 2DT5A 2HDHA 4NFHA 4B7CA 4BNHA 1U28A 1R16A 4R1TA 3AFMA 4BUCA 2JHFA 3ANMA 3TFOA 2BD0A 1BDBA 3RVDA 1UAYA 3JQGB 5EINA 3WQSB 1MG5A 3Q2KA 2A94A 1ZUD1 4B8WA 1UXHA 4TKMA 1E7YA 2C59A 1GADO 3RU7A 4YXFA 1H9BA 5C5IA 3DTTA 1ULUA 3VDQA 1QP8A 2DC1A 2JD1A 3INTA 4P38A 1KVUA 1GYQA 5FEUA 1PTJA 4E2ZA 1DBVO 3JQ7B 3GN1A 5C7IO 4D7AA 5G0UA 2TMGA 3MWEB 5TRTA 2BMAA 1TLTA 3RWBA 3E82A 5I7VA 1DC5A 3ONEA 4XQCA 2HCTA 4KDEA 5IAAA 1VL8A 1XWFA 3WQQA 1PEDA 3HSKA 1B8UA 1WZIA 3OM9A 2YFQA 3D64A 1LA2A 4Q9NA 1G0OA 1PX0A 2SCUA 4P8RA 4NPCA 5KWEA 2PR2A 1DEHA 4DREA 3WJ7A 2Q4BA 4IZHA 1FK8A 3LVFO 3EVTA 1JQBA 4R5MA 3ZV6A 3KYDA 1L7EA 1CF2O 2IXAA 2Q2QA 2NU6A 5JAQA 1UZNA 1X1EA 2UUPA 4JGBA 1PR9A 4G2NA 3BTUA 1EFKA 4ALKA 1ZCJA 3F5SA 1DC4A 2OL4A 4E5NA 4XA8A 1A9ZA 4YAGA 3PJEA 3ADOA 2LDBA 2VUSA 3KZVA 3OJ0A 3UHAA 2ZTMA 1DAOA 3H3FA 3O8QB 3SX2A 1N1GA 1Q7GA 1ZEJA 4TRJA 4BKQA 1VE9A 4GAEA 2BFPA 4WK6A 1JAYA 3PLRA 4FC6A 4P4LA 1QORA 2VN8A 3S2IA 5C37A 2FR0A 3AWDA 2AMFA 4NIMA 4ZQEA 3DFUA 3HDYA 3B6ZA 4J1SA 2R6JA 3NDRA 4DWVA 5ENDA 1UDCA 1EZ4A 2E37A 3I9MA 4KTTE 5TC4A 3HDQA 2NWQA 4ZA2A 2VOJA 2I67A 4FFOA 3RUCA 2P5UA 3QW2A 1P1KA 2B4QA 3NGLA 3WXBA 2P5YA 2ZQZA 4CUKA 4EUHA 2ZTLA 3C7DB 4C7JA 2D59A 5ADHA 2EKQA 4L4RA 2IYOA 1AXEA 2ZTVA 3IKVA 2J3KA 1OBFO 3RFXA 2Y1EA 3KXDA 5CFZA 3PHJA 4CR7A 4RPJA 4J4HA 5JDCC 1GZ4A 3PP8A 1PL8A 3VTZA 2AQ8A 3NJ4A 3SJ7A 2YHUA 4D0SA 1AN9A 2J5RA 3LZ6A 1E1LA 3AUTA 2Z5LA 1RYDA 2W2LA 1YB5A 3GEDA 5KVQA 3FR8A 1BDMA 2DBVO 1W0CA 1I3KA 4XGNA 1YBMA 3VPFA 1Y9EA 1BWSA 3ZHXA 2JFHA 1PZGA 3BMNB 2P91A 4JROA 1AGNA 5JDIA 1E7RA 1ZSNA 4OXNA 4CM6A 4RVUA 4XYGA 3K2EA 1GU7A 5I9MA 5EJ2A 1VSVA 3TFQA 3V1UA 3EAGA 3JQ9C 4MIOA 4U7WA 4QFCA 1KETA 3C8MA 3R6DA 4GMFA 4DPLA 3K5PA 1U7TA 4FQ8A 2AE1A 1Z75A 4WUVA 4ILKA 1EE2A 1VJ0A 3H2SA 3KSDO 3PZBA 2WD7A 4R69A 2Y1OA 3F5QA 2EERA 1NX6A 2IODA 3IP1A 1O94A 3JD1A 3MJCA 4NU6A 2V7PA 4EJMA 4Q3CA 3JYQA 3RKRA 4BNVA 2V6FA 1ZK1A 4GVLA 3EC7A 1VI2A 4W9NA 4S1VA 1KVRA 3AY3A 2ZYDA 2GERA 4IIUA 4YWJA 4H7PA 1T2EA 1JVSA 3EY4A 5JXWA 4K6FA 2AQKA 3A06A 3O9ZA 2XF8A 3ZN2A
chains in the Genus database with same CATH superfamily
1NUUA 2JZNA 5A4AA 2CV2A 1CR1A 4WKCA 2GR9A 1MX5A 1EUDB 3AEUA 3D5TA 3GF4A 1XTQA 2WWIA 2ISSD 3GW8A 1L4HA 2ZDQA 3HJUA 3F3YA 3MLAA 1R8YA 2B9EA 4B2YA 1SHLA 3TNLA 4MULA 3R0XA 3DZIA 4ZVSA 3H8SA 4KFCA 1F8FA 1KY4A 4ZO8A 4ZVTA 1K2WA 3EWAA 3ZWBA 4H77A 4IVPA 1K6IA 1YQGA 3HCOA 3ZDYB 4AZ0B 4ZEOA 1E5VA 3F6YA 3TGLA 2Q5QA 1F0PA 2R4QA 3L9WA 3UJDA 2ZTHA 5KPJA 3FHOA 2C1XA 2TRSB 1IQPA 3GD7A 4KQMA 4N0DA 3DFIA 5EWMA 5FUXA 4E51A 4JYAB 3TXYA 5CBPB 1NXVA 1XKLA 4S35A 1IEQA 4GYJA 3ASYA 4CMEC 4O4JF 3VNVA 3GP3A 3KT8A 3TH5A 1ZD1A 1GFSA 1OXSC 4I50F 4JXXA 1BX3A 2HSGA 2VTKA 3VO9A 3FMPB 5JPIA 3MS2A 3TXXA 2D2VA 5KKCA 3SSNA 2ZBVA 1BRTA 4C78A 1U7XA 4MYCA 4BP1A 4JYCA 4QQRA 3S44A 2QORA 2WIKA 3HCBA 3OZIA 3OE7A 5SYMA 1OWOA 3ICVA 3SJCA 4NENB 4Z6KA 4CDNA 3GUUA 3HB4X 5JPCA 3UJNA 4GPZA 2WEKA 3OSZA 1HZZA 1NATA 1PFQA 2ONJA 4YA6A 3T6KA 3EPLA 2W2TA 2DPXA 3GJXC 2V7EA 1ZDMA 3UC9A 2AJ8A 3MTDA 1RXSA 1KDOA 1RAIA 3EFBA 1WHSB 5IZ4A 2RD2A 1KRXA 1FYVA 1N32B 4DABA 3P5SA 2D5BA 3TQOA 1DG1G 3E0QA 4YRZA 1RIIA 3QUCA 3W7AA 3BJMA 3OO0A 3JQ8B 3EDYA 3RM3A 4PC7A 3W8RA 1KI2A 3VR0A 3AIOA 3U2QA 2WD9A 1EVLA 3JQCA 4DBVO 1MAHA 3NHYA 2V9CA 4KITB 721PA 2MR6A 1MJNA 1DIHA 2JAPA 2Z09A 3BMQB 1Y8AA 3L7OA 1JG7A 4B3TB 5EXSA 3Q3IA 2ODBA 2IYWA 2Z3VA 1ZIDA 5DOZA 1AC5A 2ZRFA 3WSVA 1UT8A 1GZDA 2C84A 3WWEA 5CLFA 2IY8A 1GCIA 1RE1A 3FKJA 4NBNA 3ZLTA 2C7GA 1JS1X 2E55A 3OOJA 3ELWA 4TN1A 5L3ZA 1QGZA 3WV4A 4BB6A 4TYWA 5F7ZA 2OD9A 4KOAA 2V3VA 4HMQA 3GGSA 2FPWA 1A7JA 5DNCA 4JYBA 1ZGHA 2R44A 1ZCAA 4C06A 2JBAB 4KO2S 1GUZA 1YAJA 3QEBZ 4W8OA 4XD7A 1RXYA 2YV5A 5DHTA 1GGVA 3RJZA 1ZRMA 2JGEA 1WXFA 3E1KA 3WDLA 5FPPA 4TS9A 3D54D 5KHOC 3WL8A 5K3EA 1J39A 3AIMA 5B2FA 4ZU3A 3EA4A 4A0GA 2DRIA 3DF9A 1VDZA 4IJ6A 5D3MB 3ROFA 2J3HA 4AI6A 2X9NA 4N54A 1CQPA 2HHCA 1DG3A 1LPNA 2J48A 3IGFA 2HMTA 4DIFA 1KYTA 1UIRA 3UN1A 5AI6A 4RACA 3UF0A 3C74A 4QU0A 4UTOA 1KVQA 3G5AA 4HH4A 3BPSA 1MO5A 4CV3A 4BLOA 4OQFA 5MGNA 1AQNA 2RBKA 4JCCA 5IC6A 4BNXA 4DARA 2DUJA 1HDEA 5KB3A 3LUAA 3NCHA 3UUWA 3W90A 3LPCA 5DYGA 3VISA 4NOKA 4OHMA 2LP4Y 4K9PA 2INGX 3SC6A 3BDVA 4LYGA 5G1NA 1TM5E 4LI3X 4RSGA 3VVBA 4HLDA 4JQOA 1MOQA 4LQ4A 1LS6A 3FLEA 4QPZA 5DPMA 4M1KA 4CI0B 1J0CA 1O0BA 2P3SA 3O8BA 4BZPA 5AQEA 2J9FB 2DUMA 5J1TB 1Q1NA 1K75A 5C18A 4DV1B 2J5KA 3OZEA 2POQX 4MCAA 3ZY5A 2C83A 5DDIP 4HUQA 1JPUA 1ZD3A 4PAGA 1ENPA 2Y77A 1IHYA 4C20A 1VKNA 5ADWA 1SVOA 2BEUB 1MR3F 4RWEA 3K9GA 1V1JA 1TYAE 3IOCA 3GJQA 5H16A 3VV2A 2VDLB 4U3JA 4ZAVA 2BAGA 1FDRA 4IO1A 2JA2A 1RP7A 2K2WA 1LBTA 4EI2A 1WZUA 2WHPA 4RTMA 2QM3A 4OQMA 1NL3A 4GR9A 1UT5A 1N2JA 1J0BA 2CXPA 3OIDA 4RF2A 4YACA 1U1DA 2ZS9A 3RROA 4ZDJA 1OWLA 2O20A 1NLFA 2IXFA 2WG1A 4HLUA 3BKXA 5EWJB 1OFIA 2QM0A 2AC4A 4AFNA 4V3CA 1R27A 1Z26A 4CDRA 4AG6A 4EG7A 1COWD 2V7BA 4JA2A 2BGMA 2CJYA 2GTIA 4KVGA 5CR9A 1CVLA 1I3LA 2AG1A 4LBVA 2Q62A 1OAKA 3DR3A 1HLFA 3EFHA 4XCVA 2CY0A 2EKLA 4A92A 3ANSA 3H18A 3PUZA 5KAPA 4AURA 3FNQA 3TVYA 221PA 4YT5A 2VRWA 2FYTA 2JLRA 2WUWE 3KSMA 4X54A 3GUHA 3D4IA 1UT6A 3EBLA 3K0FB 3I61A 2QV0A 4CM9A 4D8VA 3QVGA 1D2AA 1P17A 4LJ8A 2RAFA 2UYOA 1RQGA 4V0SA 1IBCA 1SKYE 2JGAA 4MQUA 4P31A 5THXA 1VMIA 3D5EA 3U7RA 3W4KA 4EJ6A 4CMCA 3ASUA 5C51B 2VNKA 4WOKA 5CJ2A 1EUCB 1YCDA 5IVKA 4URUR 3AP3A 4GNKA 2JGJA 2Z2XA 1LY1A 3DE6X 4JEUA 2I6TA 4DCPA 4H0CA 2JGFA 4M46A 2VP6A 1HE2A 1U4OA 5DEIA 2G9QA 4LE0A 3JSXA 2QBYB 3IMGA 2IHZA 3MMSA 3N7AA 3LNCA 4KX3A 3VPAA 4RY0A 5BMVA 5FUMA 1JI0A 2C3PA 1GQFA 1Y63A 1RJGA 1WD7A 1VL6A 1AE1A 2O23A 3D2CA 3W8NA 5HKLA 1R6UA 3R8CA 1YRQA 3IP9A 1LBIA 3D02A 4GUAA 4QAJA 3WHLA 3ZZTA 6ADHA 2HI0A 2NSJA 5HILA 2ECPA 4YROA 5JRZA 1J7JA 1EJ0A 2FV8A 2H63A 5K99A 4EVRA 1DINA 2QT0A 1M2HA 3IEXA 1OJ7A 1BX1A 3F71A 4I1YA 1YCGA 1YD7A 3C7TA 1YQEA 3PPIA 2GN2A 4MGHA 2YVLA 1ZUWA 1UFVA 3R9KA 3DFZA 4D9IA 2HLPA 1TW2A 1LW6E 3SPXA 2VATA 4ITUA 2ZTUA 3G2IA 4DR1B 4QRDA 1RHJA 1OCEA 1WRBA 1U0BB 3BIWA 2QGFA 3FBWA 1SKQA 3WYBA 1FOEB 1W9MA 4OP1A 5EKXA 3TBFA 4GBED 4PG6A 1P2UA 3A4MA 3AYZB 1NKSA 3GRCA 1J2EA 4KZKA 1L6RA 3BGWA 3DW1X 4YRRA 2V8BA 1OOEA 1E79A 1S6YA 4XJVA 5SY6A 2YV1A 2VTDA 1UH5A 1DKOA 3RS9A 1RWOA 2CXXA 5KBYA 3GZ4A 3UWSA 1OWMA 2QAIA 2GZMA 1HURA 4DDUA 2EAUA 2XKKA 4KLAA 1Q14A 3LCMA 5ENZA 5AKJA 5DP2A 1NY6A 1GGNA 5EJIA 4OM7A 3ZXUB 1F8UA 2FXVA 4Q7KA 2ICAA 3JQBA 1I6WA 5FL7D 3SDSA 3JAMA 1TM1E 4MJLA 5B3AA 2IX9A 3UT6A 4NFSA 1G3UA 2NXNA 1FSPA 4MV3A 4HNQA 3F6EX 1GFZA 4EHLA 3FLMA 3ENQA 1KZYC 1W96A 1ZESA 3R5JA 4KAJA 5TDHA 3R7DA 1K6JA 2AOTB 4YV7A 1NVDA 4QNMA 3QWBA 3OURA 3BX1A 4H4EA 4R2WA 2Z6QA 1IUKA 2H0AA 1CUHA 2PGJA 3AM5A 4IIDA 5EZYB 2IOFK 4NMHA 4DMFA 1Y1SA 4PN7A 4QWMA 3GPDG 1KQOA 1NOKA 5CYPA 1OIWA 1W4LA 3BMNA 4Q7LA 1URPA 4GL4A 5H9WA 5LZ4A 1MGPA 1DVRA 3OECA 3BTSA 1JDZA 5A9RA 3OT1B 4WOCA 3STXA 2BJVA 2IIBA 4RMJA 3O8CA 3SC4A 5CGZA 3V33A 3TINA 6LDHA 3SDZA 1SIUA 1YULA 3ZKWB 2R8BA 4U5QA 4R1SA 4B85A 3QMVA 3L5OA 3NHLA 3E7FA 1MT3A 3UZUA 3SMVA 2HHAA 4EPWA 1N2XA 2F67A 1MJGA 1W44A 1YGPA 3FD8A 1GPYA 3OTGA 4OHUA 1LPMA 1XRNA 4PLCA 4XX1A 2R6DA 5TVKA 2PL3A 3K4HA 5HZMA 2C94A 2RHHA 1EBBA 5JCPA 1IBSA 3GT4A 4UCXA 2CXSA 2PGNA 4RX1A 4BTEA 1QZXA 4K46A 1T1RA 4ZDKA 4OLBA 4G09A 5D6NA 4FU0A 5B2ZA 1SHKA 2XE4A 4QTYA 1GNTA 5AKKA 4DJDC 1Q84A 1CJTC 421PA 1J1UA 1AQUA 4LYHA 5HNKA 4TZ0A 4I46A 1NYTA 2BZ0A 5H70A 1THMA 1TYDE 2C9YA 5FBQB 5A04A 1IK4A 1LBEA 1UMBA 2MYNA 2OFXA 2PSFA 3W04A 1TK3A 1J2JA 4E6EA 3UAGA 2D2FA 2WYOA 1MA0A 4GOJA 4MHTA 3VI4B 4EFNA 1OY1A 1P81A 1OPRA 3SVLA 4WSOA 4RA9B 2BJWA 2DSNA 1DAGA 4N6OA 1U0GA 2GD2A 2GN1A 3C5VA 2M98A 2ZUVA 3H5OA 4LE1A 1FC0A 3GEGA 2PRZA 2O8VA 3DMRA 3HN2A 3ZV5A 4BX3A 3LUHA 2AIRA 2GCOA 3CCBA 4IINA 4CW7A 3I42A 4DL9A 2E48A 3FFXA 2ZJ5A 3EGXB 4IQGA 3PFWO 4L4YA 3U7IA 4U0JA 4K9MA 5PGMA 1SBNE 3G8DA 2IE8A 3RRBA 5BN4A 2NYVA 3NBKA 2OXEA 4N01A 3PE6A 1X8KA 1AQYA 1SBIA 1CJSA 3QVOA 4EY8A 4R2JA 4BS9A 2PPLA 3QTLA 4DANA 4ZI7A 3PA8A 3L7LA 1N33B 5HVNA 3RV4A 4Q6WA 3L6CA 4RYDA 3QXGA 3V48A 1Z6GA 3ABOB 3K16A 1RYBA 5AW2A 2Y0DA 3BCHA 2JHGA 3E9MA 1TZ2A 2OCGA 5FHRA 3DP7A 1GGEA 3R3YA 4ZHQF 1QGUB 1L5WA 3V5NA 1GTRA 4K9RA 4L5IA 2GAOA 3I0NA 3FPSA 1ZOIA 4MS3B 4PSCA 2IJGX 1MENA 1XRRA 3IKLA 4PVDA 5IN5A 4FGZA 1QH8B 2A0KA 4XDHA 3SJAA 4H7FA 1XRJA 1SOWA 3KE9A 3M0EA 1FU7A 3BXGA 3ESCA 4TQ9A 4TKVA 3CH6A 2TECE 2NYUA 3E05A 3EC2A 2P4HX 4IYRA 2A7XA 3V4VB 1DP4A 1WBDA 2WW8A 4QUHA 3C3AA 4PCAA 5JH7A 5JQGB 4EA9A 1W4AA 4H60A 4DEYA 3PI6A 1CBUA 1Z16A 4WK2B 4EG0A 1UXKA 5U1PA 4JLUA 1Z4JA 1SXJD 3QSGA 4RULA 1ZMOA 3PD7A 1RLMA 3KJHA 3NS7A 5JD4A 5T4HA 5K0GA 2YS7A 2BGIA 1ZD8A 5HA5A 5TXGA 7AT1A 4XM1A 3EPHA 2CVZA 4DLKA 3AKCA 3WLJA 2ILVA 1E2UA 2GAIA 1QIFA 3D0RA 2BMDA 2PV7A 5FNVF 4D25A 2I54A 5E1DA 5LQSA 5LQJA 1F9AA 4KXVA 4R2XA 3VR5D 4UTZA 2E18A 4OVKA 3U09A 1BE1A 1XG5A 3QUTA 4Z2AA 1Z29A 4LRWA 1YQQA 3OD5A 3PGLA 4HOYA 4OGLA 2X22A 3ES9A 3IPLA 1OB2A 3HKBB 2NO6A 4J7XA 2HDOA 2XADA 1GQ2A 1CNEA 2C29D 2DG2A 3REQA 3KWMA 1F51E 3CUUA 2ZI7A 4XDGA 5DHFA 2B7CA 2H4ZA 2ZI9A 4CEHA 3FAKA 4RE6A 4REMA 5IMSA 3R5FA 1T10A 2WU3A 2I91A 2B21A 3FWKA 3GIDA 4K5QA 1G3QA 4N0MA 5IM4A 1MAWA 2VJLA 2P30A 1SXPA 1ZGBA 4TZ6A 4FCTA 3AJ9A 3C5EA 4IOJA 1CDDA 1LQUA 2Y0CA 5CHEA 4LF6B 1QHIA 2P9FA 4JJZA 1IEWA 3OH8A 4LZWA 5GZ3A 2CLCX 2V8OA 2H5IA 3P71T 1MAUA 2PMEA 2ZRKA 1U8XX 2CCKA 3R2JA 2Y2VA 4PZLA 1OA1A 1LNSA 5FI3A 3O92A 4BLWA 3ADDA 5GGXA 5CMLA 2TSYB 1B74A 5EHXA 2Z30A 1TKAA 1DBPA 1XF9A 1T0JB 3G49A 5FTLA 4TLDA 1GTSA 5EPUA 5CH3A 5EVJA 2AZ4A 1T1SA 4B2LA 4BKRA 4DHEA 1E3JA 4O08A 3AOEC 5H68A 3S68A 5DM1A 4ZI5A 2PQ2A 1E6WA 4UDYX 4CXMA 3LRPA 3L7CA 2HMWA 2WYUA 2VYND 5CT9A 2P2LA 4DC1A 3E2IA 4RL6A 3KXPA 2Y1CA 4N0PA 5K4AA 3P2KA 3I64A 1PGOA 3R76A 3RAJA 1TIKA 3VYRB 1G1MA 3K70D 2GM4A 3G0BA 4ZQCB 3L4SO 2NU7B 2O2GA 3RS3A 2FRDC 3UWOA 1XV5A 4GVXA 4L8VA 2GF2A 1GGKA 1QHNA 3TD9A 4M1ZA 4YP0A 4EYSA 4D8TA 2FWIA 2WHXA 4PY2A 4Z51A 5JWOA 1Y7TA 1C3OB 2ENWA 1D6SA 2GCIA 2R1TA 2WA2A 2X2FA 2QN1A 3QKSA 4L6CA 2ATIA 3N28A 5C2JB 1L7VC 3K30A 1OZHA 1SUBA 1F2DA 5FI5A 3COSA 3RUHA 3T3GA 4M9QA 5ESRA 1XVLA 5EZYF 3ZS9A 2WI8A 3PA6A 3AFNA 5JFOA 1N9GA 4J1TC 5SZKB 1EA5A 3K15A 2QUJA 2RGBA 3UGKA 4JLOA 1DI0A 1RLOA 1U8FO 3PR2B 4PPGA 1ORIA 3WGMA 3UUFA 5BYBA 2XCTB 3FCYA 1KHHA 2C0PA 1QJCA 2GCNA 3NEYA 1IBKB 2C2KA 2R1VB 3LVQE 1ECPA 4JLNA 1OI2A 3EZNA 1ZIPA 3H5WA 8ATCA 1E8MA 1H2ZA 4X60A 3UFXA 4DYDA 3GEBA 4FCWA 1NF2A 2PSJA 1A9YA 1GNRA 2DPLA 3R5TA 4OBBA 4WBNF 3I12A 3PUIA 5B3LA 1I7DA 1WB9A 2ZUCA 3CNBA 4I4CA 3ZK9A 2IF0A 5HPYB 3V8NA 5FOWA 3VMMA 2CFSA 4M3NA 3MWFA 4DBLC 3GCZA 4B4DA 1HOXA 1QKIA 1N6IA 4N8DA 5CP8A 3SIWA 4M7RA 3X0DA 1WMFA 2AXEA 1WOYA 4OHVA 2W58A 4QUJA 4PPNA 5EG5A 1I94B 3P9NA 4XB6B 1U7WA 3LV8A 5BSEA 2V5VA 1ISJA 4G4JA 4D4KA 3R77A 2YYYA 2GPJA 3K6SA 1Y42X 3UW1A 1PEKE 3OCWA 3VKFA 2P65A 2VRCD 3TLJA 3W79A 3WDMA 2D00A 1V41E 4DCMA 4ZYYA 4OY3A 3LYUA 4L4UA 1I4WA 4K28A 4M0EA 2A14A 1LJ8A 2CGEA 2VJDA 3OF5A 4QO7A 3PICA 3IUBA 4GWKA 3VKWA 4LG1A 1R4MB 4FQ5A 4LWPA 2JLWA 1NVTA 2OHVA 3WGGA 1WPXA 4ROTA 2IYXA 2G72A 4U1RA 4UXHA 2DFDA 1SQSA 1L7BA 1P2SA 3A3PA 4L27A 1BCSB 5KNCA 3REOA 5LB2A 1E1CB 3GFGA 3V6LA 1GTG1 4IX9A 1JHYA 3NBZC 2L69A 4C2AA 3ESRA 4FVTA 4JBNA 4KR9A 4G01B 4KQEA 5TPZA 1MQ9A 5C80A 5I7SA 5FDFA 4P7FA 3BOSA 4R4JA 4AZTA 1WXGA 2JFYA 4JCOA 4JI7B 1XTZA 3Q3CA 4ZRMA 2GZRA 1QFZA 1JLLB 5ALUA 4U63A 1F5SA 3IVAA 3A4LA 1JHVA 5DBFA 5EZQA 1SR8A 4M83A 4QEDA 5TS2A 4CM4A 4O2BF 1KPIA 3B3JA 3CPSA 3QMPA 3BICA 3ZXXA 1QRUA 1XZEA 1SRQA 2G36A 2HMUA 1NOJA 3DUWA 3NT4A 1SKYB 1WXDA 4PHFA 4DVGA 1JKJA 3ZJVA 4GG1A 1TF7A 4A0FA 5TX7A 2R751 2GBFA 1MNQA 1YS4A 4WI1A 2QW8A 1L5HA 3DBLB 4XEHA 4Q7QA 3FSJX 1I10A 1X7GA 1E9RA 2XYHA 3B8EA 3LWBA 1I2CA 1BKDR 1VE1A 2ETXA 2JLVA 1MZVA 1L3IA 2NXEA 1KJWA 3IUQA 3JVDA 3R7NA 3SICE 4BMSA 5KWIA 1IMJA 2DR3A 1P1JA 1SFRA 1Z8DA 3P94A 3E1GA 1NVVR 2Z08A 5CT4A 4AUKA 5U4XA 3T1NA 2TMKA 1LX6A 1W19A 2ZWPA 3K2BA 1OBVA 1US8A 3LQ1A 4UHFA 1TDJA 4XX0B 1E6EA 1L3CA 4PW0A 1EHCA 5A6SB 5A9SA 4MVJH 1M6VA 3H97A 1V11B 5JMPA 6REQB 2J33A 5FFFA 4EHKA 3TBKA 5ICSA 1REQB 4LJLA 4KSBA 2PUEA 1UC9A 3PIIA 4BP9A 1K63A 4N6NA 1NBAA 2VRBA 4XE5A 1RI5A 4Z4CA 1WW3A 1YCHA 2NTNA 5FNVB 2QRMA 4KQCA 3W7BA 4ARAA 4J9VA 4CMGA 4EG4A 4FGJA 2XBMA 2UVPB 2CBZA 2FETA 3QJ5A 4HZUA 4IIVA 4L8LA 4XX0A 5EYPB 2H17A 4UUMA 2VT2A 4M60A 2HK7A 1KAHA 4Q21A 5ERYA 3LPAA 3EA5A 2DFTA 3QVJA 1W2WB 3FCOA 4W5WA 3WS7A 3UJ8A 3EW7A 2XNSA 1AKWA 4C89A 2EVWX 3Q4GA 1YZQA 4WGFA 3CU5A 4ENRA 4ZFNA 4QUKA 4IJSA 4OGWA 2J4CA 3WICA 3LGAA 1CRLA 3EFOB 1SQ0A 521PA 5JHGB 2FPOA 2QN8A 2ZRHA 1QANA 2I7VA 3EIWA 3FNFA 4RTPA 4YLGA 3TR0A 2K6GA 1RE0A 3JTMA 3VOBA 3T54A 1ZGZA 1U2RA 3FNRA 3KYJB 3ZE9A 4DBZA 2BKEA 4QGFA 4UM5A 4FBGA 4YVFA 1CHNA 2G1AA 2XA1A 4IQ4A 5BN3A 2I3BA 4G85A 5FYDA 5G41A 3C14C 4YCBA 2IP1A 3RSLA 3QYFA 5JR3A 3ZIAD 3T3NA 2Z8XA 3VKVA 1W1IA 4KPUB 5ESWA 5IASA 1W36C 2R8EA 4DQVA 3R9WA 1L1QA 1ZM2A 4UCQA 2WVJA 5KKAA 5A0VA 1YIAA 2HYDA 1SZCA 2H2DA 1O5OA 5LQUA 2JH3A 4GX0A 1Y8RB 5CG1A 1OXVA 2HREA 3J80A 4U2BA 2IHJA 1VE5A 2R97A 3R3XA 1X80B 4YRGA 1RCTE 5KNCH 1NVMB 4DCVA 1SVMA 4ARZA 5BMOA 2FSUA 4YI3A 1LLDA 3O82A 1AGYA 1WDKA 2GO1A 2AYXA 2HLDA 3SJBA 4PZCA 1KSJA 1KKUA 4GE0A 3K9NA 1YRHA 4H6WA 4D82A 3FYUC 4RSMA 4WNCA 1HNWB 4HPJB 4IICA 4P80A 5EJ2A 3G0CA 3QE0A 3WVNA 4BNNA 3AM1A 2LV8A 3FI0A 1T43A 3FRHA 3L4EA 1TQ6A 4G24A 1I0ZA 3TMYA 3BGSA 3ZW8A 3VZBA 3UXYA 3EDOA 4GC5A 5JE8A 3VX4A 1MO3A 1N9ZA 2Y71A 4JOCA 1BVRA 2OC9A 4UHJA 5K0BA 2QU8A 5EP1A 4EJ2A 1PJ3A 2GK6A 4I2NA 2C2OA 3GGCA 4HWGA 3H9GA 1Z2OX 1RI2A 2FE4A 1HLPA 1V1MA 3JAKB 2FPLA 1EWRA 3K6KA 3K8OE 3QLTA 4HB2A 5J23A 2QXUA 1NW7A 2QRZA 5D87A 1TF2A 2RGNC 2OO3A 4EM6A 1A9SA 2YVKA 3VUFA 4PPYA 1XD2A 2ZYRA 1WQ3A 4LK3A 3V2IA 5I7EA 1RJ9A 1EAYA 1GZHB 3DDSA 2IH2A 2QLJA 5A9SB 4TKUA 1PRYA 4I1OA 1EUZA 1X80A 2FX3A 5GGYA 5HX7A 3WYAA 4C7KA 2EKZA 2XB9A 1PJTA 1UBGA 2IW1A 4MLCA 2VTEA 1SCAA 2A86A 2ZI5A 4FE4A 2BFFA 2Z2JA 3AR8A 3HYRA 3N76A 4H1VA 1T2DA 4P5DA 4RVOA 3RARA 5HSGA 1OH6A 2FRXA 3BHJA 4JLKA 4LYYA 5KSZA 3GJ3A 2ZEJA 4HAYA 5ESXA 4HJXA 2J9ZB 2CFIA 1B8OA 1T9CA 5FA6A 4J1GA 2HO5A 3NO4A 2QN7A 1U9CA 3QFSA 4MKIA 4HLUC 3BMOB 3VPXA 1Z7WA 1S2LA 1XA4A 4JI2B 3HZRA 3DDOA 4Y2SA 1DUSA 2JG3A 2ZSUA 2UUAB 1VLQA 2LVBA 4JC4A 4NHEA 4O6VA 4R2IA 1WETA 1WW8A 2ACEA 2PGDA 3C98A 1WW2A 2H31A 4FMDB 4JLDA 3WP0A 5JW6A 1FBNA 5F5NA 1CY4A 3INRA 3OCCA 4MEJA 5IULC 4XVUA 3OZRA 1UM8A 5DN6D 2KBFA 1PTJC 5BV2P 3F3KA 3PYXA 1QAQA 3HI6A 2B83A 1S3IA 5B6PA 5KQSA 2WTXA 1M6EX 4H7DA 1KJJA 2WOJA 4P32A 4EL5A 4JQZA 2PYDA 2WM3A 1G7TA 3PF8A 5CB6A 2X8AA 3TRKA 1WXEA 1BO6A 2QHXA 2WKPA 5DHUA 7REQB 4OU4A 3L0PA 3L0YA 1U04A 4I4LA 4XDYA 3W0LB 1PG0A 2ID7A 2XMSA 3AESA 1O5IA 3NYQA 5CBKA 2FSFA 1O97D 1JBKA 3AF4A 3HPRA 4AF7A 4AROA 4GLJA 3QU7A 3OOEA 5K0CA 3FYDA 3DL0A 1H3NA 4MS1B 2E5LB 1I3OA 1OSNA 3SC3A 3ZD9A 1F0NA 1MX1A 2YHSA 4F96A 1WQ4A 1PUIA 4K2AA 1DJNA 2BHSA 1FUYB 4KDCA 4KDFA 1V8PA 4ZT2A 5AYVA 4KJZA 1I4EB 3UJ7A 3AKZA 1E3TA 5FH9A 1T4DA 1XCLA 1OIVA 3VR4A 2J09A 5G4KB 1E1DA 5CCDA 3OHMA 1DIGA 1K8QA 3QIVA 1ZNWA 2AFHE 2BV3A 2PSEA 4DFDA 2PK3A 1CV2A 3K2IA 4J49A 4LN1A 4EHDA 3VZDA 4F91B 5JEDA 5AK4A 5C8XA 4CFSA 3VHLB 3G2MA 3LP5A 1Y8QB 1CZHA 2ZRPA 1V5FA 4FK8A 4ZOEA 1A9PA 4OV6B 1RMQA 2RJNA 3RJ9A 2D1YA 5JSZA 2WC1A 3Q3VA 1GTVA 3WG9A 3V6MA 1ZD2P 4KLCA 3BFXA 3N5CA 1KOFA 1KZ9A 2WTBA 3GJ6A 3K1YA 3L0IB 3LRXA 3OPQA 4FFWA 1KKMA 4H7JA 1JFVA 3FM9A 4JJKA 4WKBA 3WYCA 4BB5A 1XMVA 3U7FB 3NIDB 4UE2A 3A05A 1TNDA 5HDBB 1SN7A 3WMXA 1WM1A 3LGSA 5CEJA 1VCHA 2QDXA 3DYVA 2JFXA 4C01A 3TOCA 4B17A 1O1YA 3IP7A 1E3WA 2PXAA 2JPDA 1IXZA 3EDCA 3WZLA 3ROEA 1C7ZA 4DJTA 5H8WA 4IDNA 5DM70 1K4KA 3OCZA 4WOJA 3JWPA 3GJ7A 2QZZA 5EMLA 3SHVA 1A8IA 4AKSA 3Q8XB 2VPWA 4NMLA 2GBPA 1BVUA 2HXGA 1TF5A 4GYWA 2GI4A 3MXOA 3QX9A 1TYEB 3C8UA 3A4IA 4LXGA 5IG2A 2RJ3A 1FJXA 3HCPA 2XI4A 3OU7A 4CL0A 2D5LA 1Z33A 3TZLA 1VKZA 1X8XA 1ECGA 3AEQB 5ETJA 4HPWA 4D9NA 2QE6A 4MYRA 3G0GA 5HRCA 3BA1A 4YPFA 4DWWA 4IPTA 3TEFA 3PD1A 2PQ0A 4A82A 2YIMA 4JX9A 1C8LA 1GCGA 3MMZA 3MT0A 4NXNB 3T3PB 5BN1A 2ERXA 3AM4A 2QV7A 3Q12A 4D57A 4B80A 3LD9A 1IMOA 1MJHA 4FFNA 2NSHA 4PYRA 1HBJA 5GONF 4FDUA 2C2YA 3ECCA 4FYHA 4AXBA 1ZIOA 2AQHA 3GJZA 3EODA 1T8UA 1SXHA 3QKWA 5BV1A 3EVGA 2FLWA 2XPCA 1AV7A 1Y3BE 3BF8A 3LTEA 4MW5A 4U2CA 1R18A 2R68A 5IXYA 2KW5A 1GT6A 4I6GA 4J0JA 2JA1A 1I1OA 1Q7RA 1CUGA 2PZ8A 2RI1A 5AR1A 1NVGA 1VLLA 4IAOA 2C0QA 3UT0A 2UVQA 1TC1A 2ZT6A 4IIFA 3KOWA 4CG1A 5IUNC 3DMTC 4QSHA 2NO4A 4KFRA 2NU9B 3INNA 4RGYA 4WBXC 4Q9DA 3VTAA 4C3ZA 5AM3A 3SWWA 4D26A 1WUHS 1PK8A 2NTEA 3A9WA 3AMVA 2R79A 3GFTA 4JBGA 1MEJA 1T3LA 1SVUA 2R5FA 5HXAA 5JO9A 4IBOA 2JAOA 4IILA 1MRSA 1KEPA 3OC6A 4JNGA 4DQ0A 1JPJA 4F38A 4P6VF 4FMCB 4IXWA 4MV6A 4BFYA 3FETA 2WHQA 1R9MA 3GT7A 1RQNA 4I1PA 1DIOB 3COZA 5LQAA 3ODGA 4JJ7A 4F1KA 5J2TA 2IEAA 3AR7A 9LDBA 1F8YA 3DOJA 2F8MA 3RVLA 2REOA 5NLLA 1JR3A 2LCFA 4DIKA 1OBHA 3ML1A 1WXWA 4QKQA 3FHCB 3TLMA 3CX4A 4U7JA 4I9NA 1E2JA 5MN6A 1U7OA 4G23A 3FSEA 4RPIA 4AJKA 3FYUA 2ZJ1A 3P9IA 3PFKA 4LJ9A 1LPPA 2ZIUB 4JU9A 2XVYA 5AW1A 5E2BA 1EU1A 4RBNA 3JRNA 3I73A 2J3MA 1V7CA 4BGUA 1GNPA 4NJEB 3RBAA 4ZAGA 1ZN7A 3TUJC 3MGGA 4H3HB 4MUNA 2ONKA 4XSVA 2HZBA 3JASB 3NATA 1NR1A 4HDAA 2F3RA 2X41A 3LDAA 1FYEA 2AHOA 4UM8B 1G8JA 2YQ4A 4A7PA 3RAEC 3IERA 3JWIA 1WTAA 4B3CA 4JK3A 3QNMA 5CVVA 1C9KA 1YIOA 3RRMA 4GIBA 4PO9A 3RB8A 1HEUA 3K31A 2ZJ2A 2QPOA 4DTCA 2ZSFA 2FZ4A 3FBTA 3IIIA 4KK3A 1RM4A 3WNQA 3A37A 2XYGA 2OZVA 3AF1A 5L4NA 2WTNA 2WUFA 3EVEA 2X1VA 5LYJF 1HX7A 2CHFA 2JARA 3L8HA 3TOXA 3RVQA 2BE7A 2JGDA 3BRWA 2A33A 5CDSA 1S0UA 2UYQA 3GLFE 1UODA 3QZUA 4QT4A 4J07A 5JMTA 1KJNA 3MWJA 4GOKA 2XNJA 2XVXA 4GMDA 4IIJB 4F3NA 3EZ6A 4A03A 1DRUA 3T7SA 2A3NA 1GV0A 2BGKA 5C5IA 5JSQA 2RGUA 3NU1A 3ONFA 1NRXA 3DAYA 4N5LA 4IDGA 4X97A 3WWOA 1KJYA 2OCLA 2I4TA 2OLJA 3A6HA 3GPLA 2HW8A 1WU8A 1LBHA 2EIHA 2C5LA 1J8YF 4FGSA 1PR4A 3GN2A 3MPUA 4X6XA 3OZTA 5EHNA 4C6HA 5C0OE 3WX0A 1GFWA 4K88A 5HKAA 4XJSA 2ID9A 2GJKA 2RSLA 4LMRA 4ZVLA 2P78A 1A1VA 4HDMB 3ZDXB 4RGVA 2VCYA 1XR3A 2NZVG 5AHOA 3E18A 3UMFA 4GS5A 4QWWA 1V39A 2IIPA 1AJEA 3UPDA 5JAUA 1ACMA 4LNUB 3R7WB 1RXWA 1HXHA 4BVEA 2VP4A 2ZM6B 1LXCA 4TV9B 1ZW6A 2CNWD 3W77A 1VMDA 3U5ZB 4Z9BA 4B4KA 2GILA 2AUMA 4EHHA 5KYKA 2GPAA 3EGOA 1NNSA 4NJMA 4QYSA 2O5CA 5JRDS 5AVJA 3D4LA 4IHKA 1TA4A 3D8HA 2GASA 3NOQA 4MH0R 4LC0A 3D3EA 4LOAA 5IS2A 1SA0A 1PDOA 1Z2AA 2QRHA 5A4DA 5KVVA 3HUFA 2ZKLA 2EZ4A 5MDHA 1AHIA 1X6VA 2FUG6 2V5UA 3NVMB 3CH4B 2SBTA 1V0JA 1JFFA 1JI3A 3P0HA 4QXPA 1F2VA 1LSUA 4RK0A 4RK1A 5KJ6A 4MWOA 2IE0A 3KELA 3ZI0A 4B6RA 4W5QA 1ZSVA 1YB6A 5BMVF 1X42A 1UK9A 2EFCB 1QYVA 2O1XA 3DOFA 1H6DA 3E70C 2XUPA 3DS8A 3PHLA 1PJCA 3PCXA 1TO2E 1PGJA 2PKRA 3UK7A 5TEWA 3GBPA 4BQFA 4CHTA 1RZRD 3O95A 3RC8A 1Y82A 5B12A 2VYVA 1G63A 3K5HA 2FPPB 1KAQA 5IW8A 3C15C 3AR5A 4R1PA 3T7AA 4GR4A 3ACDA 1PGPA 1H4TA 3DW3X 3IPRA 5CVDA 1R4NA 2L42A 4TXJA 3WGYA 3IJPA 2JLSA 1CCWA 3HDVA 4GE3A 1UPXA 4PG7A 4IMRA 3LPDA 3NTQA 1W1WA 4XGKA 1GTL1 1UFRA 2NPIA 2D4HA 1WV1A 5K8TA 2NOAA 2R9VA 1NLZA 2J67A 4YV2A 4GZ5A 4ND5A 3ZPXA 2W6CX 4PN3A 3KPYA 1O9HA 4CCYA 2GEJA 1RQPA 3ANYB 4HDRB 4BZWA 3R8FA 2O6HA 1V43A 4BKMA 4BV2A 1BFUA 2ZIFA 5ER6A 4YRPA 4ARVA 4QUIA 1DCTA 1TTQB 5F7XA 4DT1B 2HGSA 2EFEB 3LX8A 1OYVA 5F21A 4FGKA 4TGLA 5B1IA 2FKAA 1K8YB 2HMVA 4AY3A 1WDLA 1Q7BA 2WF6A 2O3RA 4KAXA 4Z8YA 5DIFA 4BTVA 4DOMA 2X5XA 3BFKA 3C3WA 4P5PA 1KYVA 4ZT5A 4TMZA 1YXMA 2Z56A 4IGKA 4XVQA 4WNIA 1DTSA 2CDBA 1Q0LA 3IQDB 4IJVA 1DKMA 1B0ZA 3AR4A 3I2KA 1TCUA 2XKAA 1PL0A 2GD0A 5EMJA 5I5GA 3OPXA 1SZJG 3SNHA 2GVDC 2R8PA 3OAAD 3V4SA 2O8BB 1LBSA 3RGGA 2PO7A 5F4ZA 4OLAA 1TX4B 4PR0A 4B7XA 1KU0A 2H92A 4MAMA 4BZQA 1Y1LA 4L9SA 1VP3A 1X19A 4KO8A 3OT5A 2ZPAA 2GK4A 2FTKE 1DO8A 2E4WA 1U1GA 1OLXB 4M53A 2NQ8A 4C0BA 3DWFA 5IXSA 4AMZA 1R0BA 2ABWA 2HA4A 2XDQA 4URYR 2FSVA 2XTNA 4G1MB 4GC9A 1J07A 1QKKA 1U2GC 1YKSA 2PKWA 1U0FA 1CSEE 4UHDA 5C4MA 2OUIA 3OO1A 1MN6A 4FFVA 2G82A 1AMNA 2OO5C 2ID4A 2X3UA 4ZP1A 3KPWA 1XXHA 2F3SA 1FMJA 2RHGB 2V96A 3GLSA 3UJ6A 4ER6A 1FRZA 1X7YB 2OAGA 3DL2A 3PX3A 2DOKA 5CYOA 3EIEA 2CUZA 1I8TA 1T4BA 3AI2A 1L5KA 4Q66C 3U9LA 2G17A 2JIDA 3QENA 3OCVA 3MBOA 4YUVA 3HDGA 4IDXA 1SVKA 3JZMA 2FW8A 5CFMA 1XX6A 2OOSA 2Y6UA 4PO3X 2C9ZA 4PYMA 2PNJA 4KO3S 4LUCA 5A4MS 4TSKA 3DDUA 2W2XA 4UQOA 3M1LA 4PWZA 4ZVPA 4EI9A 3I4FA 1ABFA 3O8DA 2LR0A 4F4JA 5I7RA 4G36A 4TKUB 1QAOA 5EE9A 2FP3A 1I6KA 5EN4A 2BZ1A 2F90A 2QL5A 1OVGA 3N0TA 5AVWA 1XNRB 3AHCA 5AXBA 1KFBB 4C0LA 5ES4B 4BKUA 1CUBA 2WFLB 4NSNA 4YIKA 4DA9A 3AB3A 4RVDA 4BBZA 3HJHA 3I1FA 3W9YA 2RAPA 2RH8A 4GM4A 1RAAA 4BEVA 4KQWA 1VC2A 1ORWA 3RWMB 1ZITA 1Q11A 4FEYA 4JMLA 1L4NA 3T5AA 4RH1A 4KVAA 4RXUA 2A67A 5A62A 4KI7A 4M7PA 1HEYA 3CJRA 1F12A 5DZSA 4OXKA 4ZT3A 3GMDA 2C2BA 2A59A 4J0KA 3DZJA 3QNWA 3B1KA 1MRNA 3PGXA 1E20A 3VR5H 2CLDX 3RJ5A 1EDZA 1FJHA 1FYWA 1ZGCA 4BASA 1F7UA 4UBKA 2C2ZA 3FZGA 2BF4A 2JLAA 2ZJ7A 2FMFA 4AJHA 2O2XA 4FMPA 3H11A 2XT0A 2QVLA 2VQSA 4FGWA 4X1YA 5ICMA 1FQWA 3FMOB 1QP0A 4B76A 2J0UA 5ENVA 2J87A 3ESDA 1BNCA 2LIVA 2RCNA 1V37A 4EPRA 1S2DA 4AJIA 1U7UA 2PRYA 3AU9A 4EVSA 4ZOQI 2BM8A 4JSYA 4IG4A 3B20A 4NNPA 5AUOB 5F64A 2R00C 3BH6A 5JS2A 3KJQA 3SLGA 2WJ3A 4CM8B 5HKBA 3OFND 3AJ8A 3ZDRA 5F7OA 3U1BA 4CL2A 4RF5A 4WOBA 3CO5A 4HADA 4RTRA 2GM5A 4A2QA 3BDAA 4D42A 2PUTA 2APJA 4OMDA 4YDSA 4AO8A 4F6CA 5C4IA 4FQ7A 4G25A 4OHCA 1RJEA 1G42A 2GFIA 5DX8A 2B69A 3MQ4A 4W6QA 7YASA 3WAGA 4JHXA 2X4LA 2WZDA 1NZFA 3KLNA 5JAMA 3PR3A 5DLQC 4NU5A 3HDHA 2WE7A 5ALKA 5CEEA 3GNSA 5LXTA 4W1QA 5J4YA 1POWA 1A8HA 4HMPA 5JS6A 2JHPA 5LZ9A 2ET6A 2MT9A 2B8EA 4D6YA 4RS4A 4AQYB 1HF3A 3H83A 2FHPA 3M4XA 2B3TA 1BGWA 3K92A 2W42A 3GVCA 3PSAA 1ZMBA 3HVHA 1IATA 2FRD