3RV0A

Crystal structure of k. polysporus dcr1 without the c-terminal dsrbd
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
246
structure length
239
Chain Sequence
SNELKVREFYRLHNACVKLKESIKLIYENPLVTDQNVLNLGTAENTIDYTILNTPTLNVAKTLLGNRYSLDLIDLFQSHDFKDSNTDVDMFIKYPVVYDENLENLAFMHKSFPAHLNDAQKTQLSNERLEFLGDSWLGALVSYIVYTRFPSANEGMLSQMKESIVNNNNLFDWSTKLNFTKRLQGNIATPKDKMSKRYADCVEAYIGALVIDRFGTEFLDIKEWLEELSEKKLAKSSQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K. polysporus Dcr1
publication title The inside-out mechanism of dicers from budding yeasts.
pubmed doi rcsb
source organism Vanderwaltozyma polyspora
molecule tags Rna binding protein
total genus 81
structure length 239
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3rv0A02
1.20.1270.260 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3rv0A01
2A11A 2EB1A 4M30A 2NUGA 4OOGC 3C4TA 3C4BA 3RV0A 2FFLA 1I4SA 3RV1A 3O2RB 1YYWA 1RC7A 1YYOA 1YZ9A 4M2ZA 2EZ6A 2QVWA 3N3WA 4OUNA 1RC5A 1YYKA 1U61A 2GSLA 2NUEA 3O2RA 1JFZA 1O0WA 2NUFA
chains in the Genus database with same CATH superfamily
2FICA 2KHOA 4M30A 1SUFA 4IWPA 3BVVA 5C5BB 1GNLA 3GI7A 4IWOA 2EX3B 2Q12A 2MI7A 2WINM 3DYTA 4IM3A 1ZWWA 2YI9A 3DPQA 3OHXM 2X3WA 2YL5A 4FZSA 4EZRA 4NQIA 3ER9B 2F18A 4OOGC 4JWDA 4KIKA 2Z0OA 2YLLA 4JLCA 2FYVA 1TQTA 1OA0A 3FD9A 4AZBA 1YZ9A 2O0I1 2F7QA 5C5BA 4R5KA 2YIVX 2GSLA 1X04A 4EZUA 3T47A 2YIBA 3DX4A 1I4LA 1ZTDA 2NUGA 1QWNA 3DPPA 3QWEA 4AZCB 3EJPA 3CV5A 3CZNA 1DKYA 1O7DC 2RAIA 1URUA 1YWMA 3DX2A 5TKYA 2PMRA 3HAHA 1O7DB 1HWWA 1I4TA 2YL6A 4FM3A 1I49A 3BUIA 4BNEA 3KAWA 4IM2A 2NCZA 3D2FA 4H8SA 3SOGA 4JWCA 4F00A 3CAZA 1QX1A 3I39X 4M2ZA 4ATMA 2YL9A 3CVRA 4H6IA 1RC5A 2WYHA 4D8JA 2Q13A 2F1AA 3BVTA 2OW7A 4M0MA 1LQ7A 4AZ5A 5FIGA 4WPCA 2JNSA 2GAFD 1DKXA 3HAJA 2ELBA 3QA8A 4EZVA 4OUNA 4E81A 1HTYA 4EZTA 3CKDA 3DPOA 4EZYA 2F7OA 2YI8A 3A98A 3BUDA 2RAKA 4F01A 2YL8A 2JNKA 1Y2OA 2OBMA 2LM0A 1YYKA 4PO2A 4NSWA 3O2RA 3I04A 1TQWA 2GF4A 3DDFA 4EZZA 4AZ6A 3ZEDA 3RPMA 3DX3A 2QKWA 2ZXQA 1I4SA 3EJTA 1W9MA 4JN4A 2YLAA 2OO2A 4R5GA 3VKHA 1U61A 1UPXA 2D1LA 3DDGA 1OAOA 3B53X 3UITA 3F7WA 2N3KA 3C4TA 4HR1B 3BVUA 1YYWA 4AZHA 3Q0KA 3D50A 4DCNC 1E2UA 1R5EA 3O3OB 4B9QA 3N3WA 2OBLA 3BVWA 3D4ZA 4JWEA 5KBPA 2A11A 2EFKA 2FFLA 1OA1A 4EZXA 4IWQA 2GA9D 2EWFA 3D2EA 3HAIA 2D4CA 3T48A 2YKTA 1WDZA 4EZSA 3ABHA 3T4AG 4AZCA 3OK8A 1R34A 1QWUA 3LMFA 3CZSA 3T46A 3C4BA 2WYIA 3RV0A 4NPHA 4AVMA 3EJUA 1HXKA 4EZOA 4E3CA 4AKVA 1TQSA 2OZNB 3O3MB 2X5CA 2Z8YA 1SU7A 2EB1A 2X3XA 3G9GA 3D52A 2Z0NA 3VEAA 4DYLA 2QFFA 2LXYA 3I01A 3DX0A 1SU8A 2Z0VA 3BVXA 4R5JA 2ND0A 4H6HA 4KIKB 1JFZA 4AZGA 1O0WA 4UDXX 2X3VA 4UDYX 2V0OA 1RC7A 3T49A 3EJRA 3EJSA 2ND1A 2ALWA 2RAJA 1GN9A 3I2WA 3L3PA 1TQVA 3KDRA 1SU6A 5FLEX 3BLBA 4EZWA 4HYBA 1DKZA 4EZPA 1TQUA 3BUBA 1I4DA 4I1QA 2RT6A 1GNTA 3DX1A 3RV1A 3LVTA 4EZNA 2PY6A 4FZPA 3M3WA 2F1BA 3C7NA 4R5IA 4G6QA 4AZ7A 3ERCC 3B51X 2EZ6A 4JNFA 1MJGA 2QXLA 4HR1A 3VEBA 4IW0A 1ZYLA 3SYVA 2NUFA 1U00A 1E9VA 4HY9A 2F7PA 3BUPA 1YYOA 1E1DA 3B52X 2C08A 2EFLA 4AZIA 4R5LA 3QNJA 3ER8C 3Q84A 4WPEA 1R33A 3L3OM 3LLLA 4JL9A 3PLTA 1PS3A 2YIAA 3QNIA 4FZOA 3OWGA 3O2RB 1JQKA 4JNEA 2F7RA 3QE6A 4JWIA 3ACOA 3EJQA 4IM0A 2QVWA 4EZQA 3KAVA 2NUEA 3D4YA 3D51A 3BUQA 3O3NB 5E84A 1X03A 2OW6A
chains in the Genus database with same CATH topology
4EZPA 2A11A 2KHOA 4M30A 1SUFA 5FIGA 4IWPA 2JNSA 2RT6A 1GNLA 2FFLA 1GNTA 3GI7A 3RV1A 1OA1A 2GAFD 4EZXA 4IWOA 2EX3B 2WINM 4EZNA 4IWQA 2PY6A 1DKXA 2GA9D 2EWFA 4IM3A 2YI9A 3DPQA 3OHXM 3D2EA 3QA8A 4EZVA 4OUNA 3T48A 4E81A 4EZSA 3C7NA 4EZTA 3T4AG 4EZRA 3LMFA 3DPOA 3T46A 4EZYA 3ER9B 4R5IA 4OOGC 2YI8A 3C4BA 3A98A 4JWDA 3RV0A 4G6QA 4NPHA 4KIKA 4F01A 4JLCA 4EZOA 4E3CA 3ERCC 3B51X 1OA0A 2OBMA 2LM0A 3FD9A 1YZ9A 2EZ6A 3O3MB 2X5CA 1MJGA 4JNFA 2QXLA 4R5KA 2YIVX 1YYKA 4HR1A 4PO2A 2GSLA 4IW0A 3VEBA 1ZYLA 3O2RA 4EZUA 2Z8YA 3T47A 3I04A 2YIBA 2NUFA 1SU7A 1U00A 1E9VA 4EZZA 2EB1A 4HY9A 2NUGA 3ZEDA 3DPPA 1I4SA 3VEAA 1W9MA 2QFFA 3I01A 1DKYA 1SU8A 1YYOA 1E1DA 4JN4A 3B52X 4R5JA 2ND0A 4R5GA 4H6HA 4KIKB 4R5LA 3VKHA 1U61A 3QNJA 1UPXA 3ER8C 1JFZA 5TKYA 1O0WA 4UDXX 1OAOA 3B53X 3L3OM 4JL9A 3UITA 3F7WA 4UDYX 2N3KA 4FM3A 3C4TA 2YIAA 4HR1B 3OWGA 3O2RB 3KAWA 1YYWA 4IM2A 2NCZA 1JQKA 1RC7A 3D2FA 4JNEA 3T49A 4JWCA 4F00A 4JWIA 2ND1A 4IM0A 1E2UA 3I39X 3O3OB 4M2ZA 1GN9A 2QVWA 4B9QA 4H6IA 3N3WA 4EZQA 3KDRA 1SU6A 1RC5A 3KAVA 2OBLA 2NUEA 5FLEX 4JWEA 4D8JA 3O3NB 5E84A 4EZWA 4HYBA 4M0MA 1DKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A11 A;  2EB1 A;  4M30 A;  2NUG A;  4OOG C;  3C4T A;  3C4B A;  3RV0 A;  2FFL A;  1I4S A;  3RV1 A;  3O2R B;  1YYW A;  1RC7 A;  1YYO A;  1YZ9 A;  4M2Z A;  2EZ6 A;  2QVW A;  3N3W A;  4OUN A;  1RC5 A;  1YYK A;  1U61 A;  2GSL A;  2NUE A;  3O2R A;  1JFZ A;  1O0W A;  2NUF A; 
#chains in the Genus database with same CATH topology
 2FIC A;  2KHO A;  4M30 A;  1SUF A;  4IWP A;  3BVV A;  5C5B B;  1GNL A;  3GI7 A;  4IWO A;  2EX3 B;  2Q12 A;  2MI7 A;  2WIN M;  3DYT A;  4IM3 A;  1ZWW A;  2YI9 A;  3DPQ A;  3OHX M;  2X3W A;  2YL5 A;  4FZS A;  4EZR A;  4NQI A;  3ER9 B;  2F18 A;  4OOG C;  4JWD A;  4KIK A;  2Z0O A;  2YLL A;  4JLC A;  2FYV A;  1TQT A;  1OA0 A;  3FD9 A;  4AZB A;  1YZ9 A;  2O0I 1;  2F7Q A;  5C5B A;  4R5K A;  2YIV X;  2GSL A;  1X04 A;  4EZU A;  3T47 A;  2YIB A;  3DX4 A;  1I4L A;  1ZTD A;  2NUG A;  1QWN A;  3DPP A;  3QWE A;  4AZC B;  3EJP A;  3CV5 A;  3CZN A;  1DKY A;  1O7D C;  2RAI A;  1URU A;  1YWM A;  3DX2 A;  5TKY A;  2PMR A;  3HAH A;  1O7D B;  1HWW A;  1I4T A;  2YL6 A;  4FM3 A;  1I49 A;  3BUI A;  4BNE A;  3KAW A;  4IM2 A;  2NCZ A;  3D2F A;  4H8S A;  3SOG A;  4JWC A;  4F00 A;  3CAZ A;  1QX1 A;  3I39 X;  4M2Z A;  4ATM A;  2YL9 A;  3CVR A;  4H6I A;  1RC5 A;  2WYH A;  4D8J A;  2Q13 A;  2F1A A;  3BVT A;  2OW7 A;  4M0M A;  1LQ7 A;  4AZ5 A;  5FIG A;  4WPC A;  2JNS A;  2GAF D;  1DKX A;  3HAJ A;  2ELB A;  3QA8 A;  4EZV A;  4OUN A;  4E81 A;  1HTY A;  4EZT A;  3CKD A;  3DPO A;  4EZY A;  2F7O A;  2YI8 A;  3A98 A;  3BUD A;  2RAK A;  4F01 A;  2YL8 A;  2JNK A;  1Y2O A;  2OBM A;  2LM0 A;  1YYK A;  4PO2 A;  4NSW A;  3O2R A;  3I04 A;  1TQW A;  2GF4 A;  3DDF A;  4EZZ A;  4AZ6 A;  3ZED A;  3RPM A;  3DX3 A;  2QKW A;  2ZXQ A;  1I4S A;  3EJT A;  1W9M A;  4JN4 A;  2YLA A;  2OO2 A;  4R5G A;  3VKH A;  1U61 A;  1UPX A;  2D1L A;  3DDG A;  1OAO A;  3B53 X;  3UIT A;  3F7W A;  2N3K A;  3C4T A;  4HR1 B;  3BVU A;  1YYW A;  4AZH A;  3Q0K A;  3D50 A;  4DCN C;  1E2U A;  1R5E A;  3O3O B;  4B9Q A;  3N3W A;  2OBL A;  3BVW A;  3D4Z A;  4JWE A;  5KBP A;  2A11 A;  2EFK A;  2FFL A;  1OA1 A;  4EZX A;  4IWQ A;  2GA9 D;  2EWF A;  3D2E A;  3HAI A;  2D4C A;  3T48 A;  2YKT A;  1WDZ A;  4EZS A;  3ABH A;  3T4A G;  4AZC A;  3OK8 A;  1R34 A;  1QWU A;  3LMF A;  3CZS A;  3T46 A;  3C4B A;  2WYI A;  3RV0 A;  4NPH A;  4AVM A;  3EJU A;  1HXK A;  4EZO A;  4E3C A;  4AKV A;  1TQS A;  2OZN B;  3O3M B;  2X5C A;  2Z8Y A;  1SU7 A;  2EB1 A;  2X3X A;  3G9G A;  3D52 A;  2Z0N A;  3VEA A;  4DYL A;  2QFF A;  2LXY A;  3I01 A;  3DX0 A;  1SU8 A;  2Z0V A;  3BVX A;  4R5J A;  2ND0 A;  4H6H A;  4KIK B;  1JFZ A;  4AZG A;  1O0W A;  4UDX X;  2X3V A;  4UDY X;  2V0O A;  1RC7 A;  3T49 A;  3EJR A;  3EJS A;  2ND1 A;  2ALW A;  2RAJ A;  1GN9 A;  3I2W A;  3L3P A;  1TQV A;  3KDR A;  1SU6 A;  5FLE X;  3BLB A;  4EZW A;  4HYB A;  1DKZ A;  4EZP A;  1TQU A;  3BUB A;  1I4D A;  4I1Q A;  2RT6 A;  1GNT A;  3DX1 A;  3RV1 A;  3LVT A;  4EZN A;  2PY6 A;  4FZP A;  3M3W A;  2F1B A;  3C7N A;  4R5I A;  4G6Q A;  4AZ7 A;  3ERC C;  3B51 X;  2EZ6 A;  4JNF A;  1MJG A;  2QXL A;  4HR1 A;  3VEB A;  4IW0 A;  1ZYL A;  3SYV A;  2NUF A;  1U00 A;  1E9V A;  4HY9 A;  2F7P A;  3BUP A;  1YYO A;  1E1D A;  3B52 X;  2C08 A;  2EFL A;  4AZI A;  4R5L A;  3QNJ A;  3ER8 C;  3Q84 A;  4WPE A;  1R33 A;  3L3O M;  3LLL A;  4JL9 A;  3PLT A;  1PS3 A;  2YIA A;  3QNI A;  4FZO A;  3OWG A;  3O2R B;  1JQK A;  4JNE A;  2F7R A;  3QE6 A;  4JWI A;  3ACO A;  3EJQ A;  4IM0 A;  2QVW A;  4EZQ A;  3KAV A;  2NUE A;  3D4Y A;  3D51 A;  3BUQ A;  3O3N B;  5E84 A;  1X03 A;  2OW6 A; 
#chains in the Genus database with same CATH homology
 4EZP A;  2A11 A;  2KHO A;  4M30 A;  1SUF A;  5FIG A;  4IWP A;  2JNS A;  2RT6 A;  1GNL A;  2FFL A;  1GNT A;  3GI7 A;  3RV1 A;  1OA1 A;  2GAF D;  4EZX A;  4IWO A;  2EX3 B;  2WIN M;  4EZN A;  4IWQ A;  2PY6 A;  1DKX A;  2GA9 D;  2EWF A;  4IM3 A;  2YI9 A;  3DPQ A;  3OHX M;  3D2E A;  3QA8 A;  4EZV A;  4OUN A;  3T48 A;  4E81 A;  4EZS A;  3C7N A;  4EZT A;  3T4A G;  4EZR A;  3LMF A;  3DPO A;  3T46 A;  4EZY A;  3ER9 B;  4R5I A;  4OOG C;  2YI8 A;  3C4B A;  3A98 A;  4JWD A;  3RV0 A;  4G6Q A;  4NPH A;  4KIK A;  4F01 A;  4JLC A;  4EZO A;  4E3C A;  3ERC C;  3B51 X;  1OA0 A;  2OBM A;  2LM0 A;  3FD9 A;  1YZ9 A;  2EZ6 A;  3O3M B;  2X5C A;  1MJG A;  4JNF A;  2QXL A;  4R5K A;  2YIV X;  1YYK A;  4HR1 A;  4PO2 A;  2GSL A;  4IW0 A;  3VEB A;  1ZYL A;  3O2R A;  4EZU A;  2Z8Y A;  3T47 A;  3I04 A;  2YIB A;  2NUF A;  1SU7 A;  1U00 A;  1E9V A;  4EZZ A;  2EB1 A;  4HY9 A;  2NUG A;  3ZED A;  3DPP A;  1I4S A;  3VEA A;  1W9M A;  2QFF A;  3I01 A;  1DKY A;  1SU8 A;  1YYO A;  1E1D A;  4JN4 A;  3B52 X;  4R5J A;  2ND0 A;  4R5G A;  4H6H A;  4KIK B;  4R5L A;  3VKH A;  1U61 A;  3QNJ A;  1UPX A;  3ER8 C;  1JFZ A;  5TKY A;  1O0W A;  4UDX X;  1OAO A;  3B53 X;  3L3O M;  4JL9 A;  3UIT A;  3F7W A;  4UDY X;  2N3K A;  4FM3 A;  3C4T A;  2YIA A;  4HR1 B;  3OWG A;  3O2R B;  3KAW A;  1YYW A;  4IM2 A;  2NCZ A;  1JQK A;  1RC7 A;  3D2F A;  4JNE A;  3T49 A;  4JWC A;  4F00 A;  4JWI A;  2ND1 A;  4IM0 A;  1E2U A;  3I39 X;  3O3O B;  4M2Z A;  1GN9 A;  2QVW A;  4B9Q A;  4H6I A;  3N3W A;  4EZQ A;  3KDR A;  1SU6 A;  1RC5 A;  3KAV A;  2OBL A;  2NUE A;  5FLE X;  4JWE A;  4D8J A;  3O3N B;  5E84 A;  4EZW A;  4HYB A;  4M0M A;  1DKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...