3RV0A

Crystal structure of k. polysporus dcr1 without the c-terminal dsrbd
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
246
structure length
239
Chain Sequence
b'SNELKVREFYRLHNACVKLKESIKLIYENPLVTDQNVLNLGTAENTIDYTILNTPTLNVAKTLLGNRYSLDLIDLFQSHDFKDSNTDVDMFIKYPVVYDENLENLAFMHKSFPAHLNDAQKTQLSNERLEFLGDSWLGALVSYIVYTRFPSANEGMLSQMKESIVNNNNLFDWSTKLNFTKRLQGNIATPKDKMSKRYADCVEAYIGALVIDRFGTEFLDIKEWLEELSEKKLAKSSQM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K. polysporus Dcr1
publication title The inside-out mechanism of dicers from budding yeasts.
pubmed doi rcsb
source organism Vanderwaltozyma polyspora
molecule tags Rna binding protein
total genus 81
structure length 239
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3rv0A02
1.20.1270.260 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3rv0A01
1JFZA 2EB1A 1YYKA 1U61A 2EZ6A 3O2RA 2NUEA 3RV1A 4M2ZA 4OOGC 1YZ9A 1YYOA 3RV0A 2GSLA 1RC5A 3C4BA 3N3WA 4M30A 2A11A 2NUGA 2NUFA 1RC7A 1I4SA 1O0WA 1YYWA 3C4TA 2QVWA 3O2RB 2FFLA 4OUNA
chains in the Genus database with same CATH superfamily
4EZQA 2Z0NA 1O7DC 3QNIA 1OA0A 4JNEA 4AZGA 3DX3A 1DKYA 1GNLA 1TQUA 2YL8A 4EZSA 4FM3A 3L3OM 4EZTA 4PO2A 4M0MA 3T46A 2EFLA 2Q13A 2NUGA 3I04A 4H6IA 2ZXQA 2ELBA 3F7WA 2FFLA 2EFKA 3C7NA 3RV1A 3ABHA 2YLAA 1QX1A 4AZ7A 3D50A 1PS3A 4IM0A 1UPXA 1E1DA 4AKVA 3DPPA 2F7OA 1HTYA 2JNKA 1RC7A 1SUFA 4D8JA 1O0WA 3VEBA 3D52A 1OAOA 2Z8YA 2X3XA 3I39X 1R5EA 4IM3A 3CAZA 3KAVA 3BVUA 4FZOA 3DDGA 3OWGA 1DKXA 3G9GA 1TQWA 4EZNA 3T48A 3DX2A 1X03A 4H6HA 3C4BA 5TKYA 2A11A 4H8SA 4JLCA 2PY6A 3BUQA 2OBMA 3C4TA 4JWDA 2NUFA 1DKZA 2NUEA 4IWPA 2F7RA 1YZ9A 2X5CA 2YIBA 1SU8A 2ND0A 4R5LA 3ER9B 2F1BA 1E9VA 2QVWA 1YWMA 1I4LA 4OUNA 4KIKA 3O2RA 2OBLA 4M2ZA 4AZ6A 4IM2A 4OOGC 3CZSA 2D4CA 3LMFA 2GA9D 3ERCC 2O0I1 2X3WA 3T4AG 4AZHA 2ALWA 3DX1A 4JNFA 3SOGA 1GNTA 4NSWA 3ER8C 1Y2OA 4WPCA 4AVMA 5C5BA 3EJRA 1R34A 1X04A 3KDRA 2RAJA 2FYVA 2Z0OA 1WDZA 2YI8A 2F7QA 4NQIA 2WINM 2WYHA 1QWNA 2OZNB 4JN4A 2QKWA 4EZYA 1W9MA 4JL9A 1I4SA 3O3MB 4AZCA 3EJUA 4R5JA 1U61A 3EJSA 3VKHA 2YLLA 4DYLA 3GI7A 4AZ5A 4EZZA 3UITA 2OO2A 3RPMA 1OA1A 4DCNC 1JQKA 3CKDA 3HAHA 2FICA 4HY9A 2ND1A 3D2EA 3D51A 2YI9A 3BUDA 3EJPA 3O3NB 2EWFA 4JWCA 4UDYX 4EZRA 1R33A 4IWQA 4FZSA 3D4YA 4KIKB 3O2RB 2RAKA 4F00A 3EJTA 3BVTA 4AZBA 2MI7A 3DDFA 4R5KA 4UDXX 1O7DB 4EZVA 5FIGA 4JWEA 1U00A 2YL9A 3VEAA 4HYBA 2X3VA 3D4ZA 3HAJA 3D2FA 1QWUA 4IW0A 3I01A 3LLLA 2Q12A 3QE6A 1ZTDA 3I2WA 4B9QA 3PLTA 1TQVA 3DYTA 3LVTA 4WPEA 2OW7A 2YL6A 2GF4A 2Z0VA 3DPQA 1TQTA 2RAIA 5E84A 1YYOA 3BUBA 5C5BB 3A98A 3B51X 3Q84A 4EZOA 2YKTA 3ACOA 4FZPA 3HAIA 2EX3B 4HR1A 4EZPA 1MJGA 2EZ6A 2YIAA 1GN9A 3OHXM 2PMRA 4F01A 4G6QA 4ATMA 2D1LA 3BUPA 3OK8A 4AZCB 3DX4A 1I4DA 3CZNA 2EB1A 1YYKA 1I49A 1URUA 3EJQA 3DPOA 1TQSA 3M3WA 2RT6A 3SYVA 2F7PA 2GSLA 3L3PA 3BVWA 2QXLA 5KBPA 3QA8A 3CV5A 1E2UA 2LM0A 3BLBA 1HXKA 4E3CA 2NCZA 3B53X 3BVVA 3Q0KA 3CVRA 4JWIA 4NPHA 3RV0A 1SU6A 1I4TA 3BVXA 4EZUA 3T47A 4I1QA 3QWEA 2OW6A 3B52X 3ZEDA 3FD9A 3DX0A 2C08A 1SU7A 3BUIA 4R5IA 2KHOA 2WYIA 1RC5A 2JNSA 1LQ7A 1ZWWA 4R5GA 4E81A 5FLEX 4EZWA 2QFFA 1ZYLA 2F1AA 4EZXA 1JFZA 4AZIA 2GAFD 3O3OB 2YL5A 2LXYA 2F18A 2YIVX 3T49A 3N3WA 4M30A 4BNEA 3QNJA 4IWOA 1HWWA 2V0OA 1YYWA 4HR1B 3KAWA 2N3KA
chains in the Genus database with same CATH topology
4EZQA 2EB1A 1YYKA 4KIKA 3O2RA 1OA0A 4JNEA 4HY9A 2ND1A 1DKYA 1GNLA 3D2EA 2OBLA 3DPOA 4M2ZA 4EZSA 2YI9A 4FM3A 4IM2A 4OOGC 2RT6A 3O3NB 2EWFA 3L3OM 4JWCA 3LMFA 4UDYX 4M0MA 4EZTA 4PO2A 3T46A 4EZRA 2GA9D 2GSLA 4IWQA 2QXLA 3ERCC 2NUGA 3I04A 4H6IA 3QA8A 1E2UA 3F7WA 3T4AG 4KIKB 2LM0A 3O2RB 2FFLA 3C7NA 4E3CA 4F00A 3RV1A 4JNFA 1GNTA 2NCZA 4R5KA 4UDXX 3B53X 4EZVA 5FIGA 4JWEA 4JWIA 4IM0A 1UPXA 4NPHA 1U00A 3ER8C 1E1DA 3RV0A 3DPPA 4HYBA 1SU6A 3VEAA 4EZUA 3T47A 1RC7A 1SUFA 3D2FA 4D8JA 1O0WA 3KDRA 4IW0A 3VEBA 1OAOA 3I01A 3B52X 2Z8YA 3I39X 3ZEDA 4IM3A 3FD9A 3KAVA 1SU7A 2YI8A 4B9QA 3OWGA 1DKXA 2WINM 3DPQA 4JN4A 5E84A 4R5IA 4EZNA 1YYOA 2KHOA 3T48A 3A98A 4H6HA 1RC5A 3C4BA 1W9MA 2JNSA 5TKYA 4EZYA 4JL9A 3B51X 4EZOA 2A11A 4R5GA 4E81A 5FLEX 4JLCA 4EZWA 1I4SA 2PY6A 2QFFA 3O3MB 1ZYLA 2EX3B 3C4TA 2OBMA 4JWDA 2NUFA 1DKZA 4HR1A 4EZXA 4EZPA 1JFZA 4R5JA 1U61A 1MJGA 2EZ6A 2YIAA 2NUEA 4IWPA 3VKHA 2GAFD 3O3OB 1GN9A 3OHXM 3GI7A 1YZ9A 4F01A 2X5CA 2YIBA 4G6QA 2YIVX 1SU8A 3T49A 3N3WA 2ND0A 4M30A 4EZZA 3QNJA 4R5LA 3UITA 4IWOA 3ER9B 1OA1A 1YYWA 4HR1B 1JQKA 3KAWA 1E9VA 2QVWA 2N3KA 4OUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JFZ A;  2EB1 A;  1YYK A;  1U61 A;  2EZ6 A;  3O2R A;  2NUE A;  3RV1 A;  4M2Z A;  4OOG C;  1YZ9 A;  1YYO A;  3RV0 A;  2GSL A;  1RC5 A;  3C4B A;  3N3W A;  4M30 A;  2A11 A;  2NUG A;  2NUF A;  1RC7 A;  1I4S A;  1O0W A;  1YYW A;  3C4T A;  2QVW A;  3O2R B;  2FFL A;  4OUN A; 
#chains in the Genus database with same CATH topology
 4EZQ A;  2Z0N A;  1O7D C;  3QNI A;  1OA0 A;  4JNE A;  4AZG A;  3DX3 A;  1DKY A;  1GNL A;  1TQU A;  2YL8 A;  4EZS A;  4FM3 A;  3L3O M;  4EZT A;  4PO2 A;  4M0M A;  3T46 A;  2EFL A;  2Q13 A;  2NUG A;  3I04 A;  4H6I A;  2ZXQ A;  2ELB A;  3F7W A;  2FFL A;  2EFK A;  3C7N A;  3RV1 A;  3ABH A;  2YLA A;  1QX1 A;  4AZ7 A;  3D50 A;  1PS3 A;  4IM0 A;  1UPX A;  1E1D A;  4AKV A;  3DPP A;  2F7O A;  1HTY A;  2JNK A;  1RC7 A;  1SUF A;  4D8J A;  1O0W A;  3VEB A;  3D52 A;  1OAO A;  2Z8Y A;  2X3X A;  3I39 X;  1R5E A;  4IM3 A;  3CAZ A;  3KAV A;  3BVU A;  4FZO A;  3DDG A;  3OWG A;  1DKX A;  3G9G A;  1TQW A;  4EZN A;  3T48 A;  3DX2 A;  1X03 A;  4H6H A;  3C4B A;  5TKY A;  2A11 A;  4H8S A;  4JLC A;  2PY6 A;  3BUQ A;  2OBM A;  3C4T A;  4JWD A;  2NUF A;  1DKZ A;  2NUE A;  4IWP A;  2F7R A;  1YZ9 A;  2X5C A;  2YIB A;  1SU8 A;  2ND0 A;  4R5L A;  3ER9 B;  2F1B A;  1E9V A;  2QVW A;  1YWM A;  1I4L A;  4OUN A;  4KIK A;  3O2R A;  2OBL A;  4M2Z A;  4AZ6 A;  4IM2 A;  4OOG C;  3CZS A;  2D4C A;  3LMF A;  2GA9 D;  3ERC C;  2O0I 1;  2X3W A;  3T4A G;  4AZH A;  2ALW A;  3DX1 A;  4JNF A;  3SOG A;  1GNT A;  4NSW A;  3ER8 C;  1Y2O A;  4WPC A;  4AVM A;  5C5B A;  3EJR A;  1R34 A;  1X04 A;  3KDR A;  2RAJ A;  2FYV A;  2Z0O A;  1WDZ A;  2YI8 A;  2F7Q A;  4NQI A;  2WIN M;  2WYH A;  1QWN A;  2OZN B;  4JN4 A;  2QKW A;  4EZY A;  1W9M A;  4JL9 A;  1I4S A;  3O3M B;  4AZC A;  3EJU A;  4R5J A;  1U61 A;  3EJS A;  3VKH A;  2YLL A;  4DYL A;  3GI7 A;  4AZ5 A;  4EZZ A;  3UIT A;  2OO2 A;  3RPM A;  1OA1 A;  4DCN C;  1JQK A;  3CKD A;  3HAH A;  2FIC A;  4HY9 A;  2ND1 A;  3D2E A;  3D51 A;  2YI9 A;  3BUD A;  3EJP A;  3O3N B;  2EWF A;  4JWC A;  4UDY X;  4EZR A;  1R33 A;  4IWQ A;  4FZS A;  3D4Y A;  4KIK B;  3O2R B;  2RAK A;  4F00 A;  3EJT A;  3BVT A;  4AZB A;  2MI7 A;  3DDF A;  4R5K A;  4UDX X;  1O7D B;  4EZV A;  5FIG A;  4JWE A;  1U00 A;  2YL9 A;  3VEA A;  4HYB A;  2X3V A;  3D4Z A;  3HAJ A;  3D2F A;  1QWU A;  4IW0 A;  3I01 A;  3LLL A;  2Q12 A;  3QE6 A;  1ZTD A;  3I2W A;  4B9Q A;  3PLT A;  1TQV A;  3DYT A;  3LVT A;  4WPE A;  2OW7 A;  2YL6 A;  2GF4 A;  2Z0V A;  3DPQ A;  1TQT A;  2RAI A;  5E84 A;  1YYO A;  3BUB A;  5C5B B;  3A98 A;  3B51 X;  3Q84 A;  4EZO A;  2YKT A;  3ACO A;  4FZP A;  3HAI A;  2EX3 B;  4HR1 A;  4EZP A;  1MJG A;  2EZ6 A;  2YIA A;  1GN9 A;  3OHX M;  2PMR A;  4F01 A;  4G6Q A;  4ATM A;  2D1L A;  3BUP A;  3OK8 A;  4AZC B;  3DX4 A;  1I4D A;  3CZN A;  2EB1 A;  1YYK A;  1I49 A;  1URU A;  3EJQ A;  3DPO A;  1TQS A;  3M3W A;  2RT6 A;  3SYV A;  2F7P A;  2GSL A;  3L3P A;  3BVW A;  2QXL A;  5KBP A;  3QA8 A;  3CV5 A;  1E2U A;  2LM0 A;  3BLB A;  1HXK A;  4E3C A;  2NCZ A;  3B53 X;  3BVV A;  3Q0K A;  3CVR A;  4JWI A;  4NPH A;  3RV0 A;  1SU6 A;  1I4T A;  3BVX A;  4EZU A;  3T47 A;  4I1Q A;  3QWE A;  2OW6 A;  3B52 X;  3ZED A;  3FD9 A;  3DX0 A;  2C08 A;  1SU7 A;  3BUI A;  4R5I A;  2KHO A;  2WYI A;  1RC5 A;  2JNS A;  1LQ7 A;  1ZWW A;  4R5G A;  4E81 A;  5FLE X;  4EZW A;  2QFF A;  1ZYL A;  2F1A A;  4EZX A;  1JFZ A;  4AZI A;  2GAF D;  3O3O B;  2YL5 A;  2LXY A;  2F18 A;  2YIV X;  3T49 A;  3N3W A;  4M30 A;  4BNE A;  3QNJ A;  4IWO A;  1HWW A;  2V0O A;  1YYW A;  4HR1 B;  3KAW A;  2N3K A; 
#chains in the Genus database with same CATH homology
 4EZQ A;  2EB1 A;  1YYK A;  4KIK A;  3O2R A;  1OA0 A;  4JNE A;  4HY9 A;  2ND1 A;  1DKY A;  1GNL A;  3D2E A;  2OBL A;  3DPO A;  4M2Z A;  4EZS A;  2YI9 A;  4FM3 A;  4IM2 A;  4OOG C;  2RT6 A;  3O3N B;  2EWF A;  3L3O M;  4JWC A;  3LMF A;  4UDY X;  4M0M A;  4EZT A;  4PO2 A;  3T46 A;  4EZR A;  2GA9 D;  2GSL A;  4IWQ A;  2QXL A;  3ERC C;  2NUG A;  3I04 A;  4H6I A;  3QA8 A;  1E2U A;  3F7W A;  3T4A G;  4KIK B;  2LM0 A;  3O2R B;  2FFL A;  3C7N A;  4E3C A;  4F00 A;  3RV1 A;  4JNF A;  1GNT A;  2NCZ A;  4R5K A;  4UDX X;  3B53 X;  4EZV A;  5FIG A;  4JWE A;  4JWI A;  4IM0 A;  1UPX A;  4NPH A;  1U00 A;  3ER8 C;  1E1D A;  3RV0 A;  3DPP A;  4HYB A;  1SU6 A;  3VEA A;  4EZU A;  3T47 A;  1RC7 A;  1SUF A;  3D2F A;  4D8J A;  1O0W A;  3KDR A;  4IW0 A;  3VEB A;  1OAO A;  3I01 A;  3B52 X;  2Z8Y A;  3I39 X;  3ZED A;  4IM3 A;  3FD9 A;  3KAV A;  1SU7 A;  2YI8 A;  4B9Q A;  3OWG A;  1DKX A;  2WIN M;  3DPQ A;  4JN4 A;  5E84 A;  4R5I A;  4EZN A;  1YYO A;  2KHO A;  3T48 A;  3A98 A;  4H6H A;  1RC5 A;  3C4B A;  1W9M A;  2JNS A;  5TKY A;  4EZY A;  4JL9 A;  3B51 X;  4EZO A;  2A11 A;  4R5G A;  4E81 A;  5FLE X;  4JLC A;  4EZW A;  1I4S A;  2PY6 A;  2QFF A;  3O3M B;  1ZYL A;  2EX3 B;  3C4T A;  2OBM A;  4JWD A;  2NUF A;  1DKZ A;  4HR1 A;  4EZX A;  4EZP A;  1JFZ A;  4R5J A;  1U61 A;  1MJG A;  2EZ6 A;  2YIA A;  2NUE A;  4IWP A;  3VKH A;  2GAF D;  3O3O B;  1GN9 A;  3OHX M;  3GI7 A;  1YZ9 A;  4F01 A;  2X5C A;  2YIB A;  4G6Q A;  2YIV X;  1SU8 A;  3T49 A;  3N3W A;  2ND0 A;  4M30 A;  4EZZ A;  3QNJ A;  4R5L A;  3UIT A;  4IWO A;  3ER9 B;  1OA1 A;  1YYW A;  4HR1 B;  1JQK A;  3KAW A;  1E9V A;  2QVW A;  2N3K A;  4OUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...