3RV1A

Crystal structure of the n-terminal and rnase iii domains of k. polysporus dcr1 e224q mutant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
242
structure length
217
Chain Sequence
b'SNELKVREFYRLHNACVKLKESIKLIYENPLVTDQNVLNLGTAENTIDYTILNTPTLNVAKTLLGNRYSLDLIDLFQSHDFKDSNTDVDMFIKYPVVYDENLENLAFMHKSQLSNERLEFLGDSWLGALVSYIVYTRFPSANEGMLSQMKESIVNNNNLFDWSTKLNFTKRLQGNIAKRYADCVQAYIGALVIDRFGTEFLDIKEWLEELSEKKLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K. polysporus Dcr1
publication title The inside-out mechanism of dicers from budding yeasts.
pubmed doi rcsb
source organism Vanderwaltozyma polyspora
molecule tags Rna binding protein
total genus 79
structure length 217
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3rv1A02
1.20.1270.260 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3rv1A01
2NUEA 2GSLA 1JFZA 3RV0A 1YYWA 2EB1A 2QVWA 2FFLA 1YZ9A 1YYKA 1YYOA 3C4BA 3O2RA 4OUNA 4OOGC 4M30A 2A11A 2NUFA 1I4SA 1RC5A 4M2ZA 1O0WA 2NUGA 1U61A 2EZ6A 3O2RB 3N3WA 3C4TA 3RV1A 1RC7A
chains in the Genus database with same CATH superfamily
4H6IA 1UPXA 4EZTA 2GAFD 2OW7A 1OA0A 2YI8A 3O3OB 3PLTA 1GN9A 3CVRA 4WPEA 3OWGA 1TQSA 2A11A 1DKYA 3B53X 4AZCA 4IM3A 2EZ6A 3DDGA 3M3WA 1HTYA 2C08A 2GSLA 3EJTA 4JLCA 3QNJA 3DPQA 3O3NB 4AZ6A 2GF4A 2YL9A 1TQVA 2YLLA 3D52A 3DX2A 1PS3A 2PY6A 2ELBA 3D2FA 2GA9D 1URUA 2F7OA 1E9VA 4NSWA 1GNLA 3BVXA 1YZ9A 1X03A 3HAHA 3T47A 1ZWWA 2YLAA 3CZNA 1X04A 3ACOA 4AKVA 4IWPA 5E84A 2EFLA 3L3OM 3QWEA 2YL6A 2ND0A 3I04A 1O0WA 2NUGA 3DYTA 3BVUA 4EZOA 1YYWA 4AVMA 3LMFA 4AZIA 4NQIA 1I4TA 5C5BB 2Q12A 3DDFA 2LM0A 2F7QA 3VKHA 3OK8A 1YYKA 4UDYX 2QXLA 4JWIA 2D4CA 3QA8A 3D50A 3Q0KA 1E1DA 3I39X 3N3WA 2Z0VA 4IW0A 2YIBA 3ZEDA 4EZYA 3VEBA 1O7DC 3DX1A 4AZ7A 2WYHA 3KDRA 1R5EA 1I4DA 2PMRA 3O2RA 1YWMA 3ABHA 3D51A 2RAIA 4ATMA 4M2ZA 1GNTA 2X3WA 4EZZA 4HR1B 4DCNC 5KBPA 4EZSA 1DKXA 3CAZA 2EB1A 2QVWA 4IM2A 3VEAA 4R5GA 2EFKA 4JN4A 1TQTA 2Z8YA 4OOGC 2NUFA 2ND1A 2OZNB 4I1QA 3C4TA 1I49A 2V0OA 2OW6A 4H6HA 4FZSA 3T4AG 2RAJA 1YYOA 3DPPA 2KHOA 3T48A 3HAIA 2LXYA 4M30A 4EZUA 4R5IA 1W9MA 3EJSA 1R33A 3HAJA 2OO2A 2YIAA 2OBLA 4FZOA 2Q13A 2FICA 2X5CA 2WINM 1QWNA 4AZCB 4IWOA 3CKDA 2MI7A 4KIKA 3A98A 4EZRA 3QNIA 3Q84A 3F7WA 4EZVA 4NPHA 3RPMA 5FIGA 4F00A 4M0MA 4DYLA 4B9QA 3SYVA 3EJPA 4R5KA 1JFZA 4AZ5A 1Y2OA 3T46A 2FFLA 1E2UA 2O0I1 4HR1A 4JNEA 1LQ7A 1QX1A 2QFFA 4R5JA 2YL5A 1MJGA 3BUDA 4E81A 3LVTA 4IM0A 3OHXM 4H8SA 2N3KA 1DKZA 4JWCA 4F01A 1TQWA 3BUPA 1TQUA 4AZHA 2F1AA 2EWFA 3I01A 1OA1A 2YKTA 4G6QA 3D4YA 1SU8A 2RT6A 2ZXQA 2EX3B 4EZPA 1SU7A 3BLBA 4JWDA 3DX4A 3BVVA 4AZBA 2Z0NA 3G9GA 4HY9A 3EJUA 2RAKA 3BUQA 4IWQA 4FM3A 2D1LA 2ALWA 2YI9A 1U00A 1I4SA 3I2WA 3EJQA 4BNEA 5C5BA 2NCZA 1RC7A 2WYIA 5FLEX 3BVTA 2X3VA 4JWEA 3UITA 4PO2A 2YL8A 3C4BA 1ZYLA 4EZXA 2Z0OA 2X3XA 1WDZA 2F18A 4WPCA 4AZGA 2JNSA 1U61A 3O2RB 3RV1A 4R5LA 2NUEA 1O7DB 3RV0A 3GI7A 4UDXX 1HWWA 2F1BA 4EZWA 2OBMA 2YIVX 3BVWA 4JNFA 4OUNA 2QKWA 1SUFA 3ERCC 3D2EA 3DX3A 4JL9A 4HYBA 1JQKA 3FD9A 1HXKA 3B52X 2F7RA 2FYVA 3B51X 3ER9B 2F7PA 3BUBA 1OAOA 3KAVA 4D8JA 3DX0A 1ZTDA 1RC5A 1QWUA 3CZSA 1I4LA 3T49A 3L3PA 4EZQA 3C7NA 2JNKA 1R34A 3LLLA 3EJRA 3DPOA 3CV5A 4E3CA 3KAWA 3D4ZA 1SU6A 3ER8C 3O3MB 5TKYA 3QE6A 4EZNA 4KIKB 4FZPA 3BUIA 3SOGA
chains in the Genus database with same CATH topology
4H6IA 5FLEX 1UPXA 2X5CA 2WINM 4EZTA 2GAFD 4JWEA 1YYKA 4UDYX 1OA0A 3UITA 2YI8A 4PO2A 4IWOA 2QXLA 4JWIA 3O3OB 4KIKA 3C4BA 1ZYLA 4EZXA 3A98A 1GN9A 4EZRA 3OWGA 3QA8A 3F7WA 4EZVA 2A11A 1DKYA 4NPHA 3B53X 5FIGA 4F00A 2JNSA 1U61A 4IM3A 2EZ6A 3O2RB 1E1DA 3N3WA 3I39X 4M0MA 3RV1A 4IW0A 2YIBA 3ZEDA 4R5LA 4B9QA 4EZYA 3VEBA 2NUEA 2GSLA 4R5KA 1JFZA 3RV0A 3KDRA 3GI7A 4UDXX 3T46A 2FFLA 4JLCA 1E2UA 4EZWA 2OBMA 3DPQA 3QNJA 3O3NB 2YIVX 4HR1A 4JNEA 4JNFA 3O2RA 4OUNA 1SUFA 3ERCC 3D2EA 4JL9A 2QFFA 4R5JA 1MJGA 4M2ZA 1GNTA 4HYBA 2PY6A 3D2FA 2GA9D 1JQKA 3FD9A 4EZZA 4E81A 4HR1B 1E9VA 4IM0A 3OHXM 4EZSA 1DKXA 1GNLA 3B52X 2N3KA 2EB1A 2QVWA 1DKZA 4IM2A 1YZ9A 3VEAA 3B51X 4R5GA 4JWCA 3T47A 4F01A 3ER9B 2EWFA 3I01A 1OA1A 4IWPA 4JN4A 5E84A 2Z8YA 1OAOA 3KAVA 3L3OM 4OOGC 4D8JA 4G6QA 2NUFA 1RC5A 1SU8A 2RT6A 2ND1A 2ND0A 3I04A 2EX3B 4EZPA 1SU7A 1O0WA 2NUGA 4JWDA 3C4TA 4HY9A 4EZOA 1YYWA 3T49A 4H6HA 3T4AG 1YYOA 3C7NA 3DPPA 4EZQA 3LMFA 2KHOA 3DPOA 4IWQA 4FM3A 3T48A 4E3CA 3KAWA 2YI9A 4M30A 1SU6A 1U00A 4EZUA 1I4SA 3ER8C 4R5IA 3O3MB 5TKYA 1W9MA 2LM0A 3VKHA 2YIAA 4EZNA 4KIKB 2OBLA 2NCZA 1RC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUE A;  2GSL A;  1JFZ A;  3RV0 A;  1YYW A;  2EB1 A;  2QVW A;  2FFL A;  1YZ9 A;  1YYK A;  1YYO A;  3C4B A;  3O2R A;  4OUN A;  4OOG C;  4M30 A;  2A11 A;  2NUF A;  1I4S A;  1RC5 A;  4M2Z A;  1O0W A;  2NUG A;  1U61 A;  2EZ6 A;  3O2R B;  3N3W A;  3C4T A;  3RV1 A;  1RC7 A; 
#chains in the Genus database with same CATH topology
 4H6I A;  1UPX A;  4EZT A;  2GAF D;  2OW7 A;  1OA0 A;  2YI8 A;  3O3O B;  3PLT A;  1GN9 A;  3CVR A;  4WPE A;  3OWG A;  1TQS A;  2A11 A;  1DKY A;  3B53 X;  4AZC A;  4IM3 A;  2EZ6 A;  3DDG A;  3M3W A;  1HTY A;  2C08 A;  2GSL A;  3EJT A;  4JLC A;  3QNJ A;  3DPQ A;  3O3N B;  4AZ6 A;  2GF4 A;  2YL9 A;  1TQV A;  2YLL A;  3D52 A;  3DX2 A;  1PS3 A;  2PY6 A;  2ELB A;  3D2F A;  2GA9 D;  1URU A;  2F7O A;  1E9V A;  4NSW A;  1GNL A;  3BVX A;  1YZ9 A;  1X03 A;  3HAH A;  3T47 A;  1ZWW A;  2YLA A;  3CZN A;  1X04 A;  3ACO A;  4AKV A;  4IWP A;  5E84 A;  2EFL A;  3L3O M;  3QWE A;  2YL6 A;  2ND0 A;  3I04 A;  1O0W A;  2NUG A;  3DYT A;  3BVU A;  4EZO A;  1YYW A;  4AVM A;  3LMF A;  4AZI A;  4NQI A;  1I4T A;  5C5B B;  2Q12 A;  3DDF A;  2LM0 A;  2F7Q A;  3VKH A;  3OK8 A;  1YYK A;  4UDY X;  2QXL A;  4JWI A;  2D4C A;  3QA8 A;  3D50 A;  3Q0K A;  1E1D A;  3I39 X;  3N3W A;  2Z0V A;  4IW0 A;  2YIB A;  3ZED A;  4EZY A;  3VEB A;  1O7D C;  3DX1 A;  4AZ7 A;  2WYH A;  3KDR A;  1R5E A;  1I4D A;  2PMR A;  3O2R A;  1YWM A;  3ABH A;  3D51 A;  2RAI A;  4ATM A;  4M2Z A;  1GNT A;  2X3W A;  4EZZ A;  4HR1 B;  4DCN C;  5KBP A;  4EZS A;  1DKX A;  3CAZ A;  2EB1 A;  2QVW A;  4IM2 A;  3VEA A;  4R5G A;  2EFK A;  4JN4 A;  1TQT A;  2Z8Y A;  4OOG C;  2NUF A;  2ND1 A;  2OZN B;  4I1Q A;  3C4T A;  1I49 A;  2V0O A;  2OW6 A;  4H6H A;  4FZS A;  3T4A G;  2RAJ A;  1YYO A;  3DPP A;  2KHO A;  3T48 A;  3HAI A;  2LXY A;  4M30 A;  4EZU A;  4R5I A;  1W9M A;  3EJS A;  1R33 A;  3HAJ A;  2OO2 A;  2YIA A;  2OBL A;  4FZO A;  2Q13 A;  2FIC A;  2X5C A;  2WIN M;  1QWN A;  4AZC B;  4IWO A;  3CKD A;  2MI7 A;  4KIK A;  3A98 A;  4EZR A;  3QNI A;  3Q84 A;  3F7W A;  4EZV A;  4NPH A;  3RPM A;  5FIG A;  4F00 A;  4M0M A;  4DYL A;  4B9Q A;  3SYV A;  3EJP A;  4R5K A;  1JFZ A;  4AZ5 A;  1Y2O A;  3T46 A;  2FFL A;  1E2U A;  2O0I 1;  4HR1 A;  4JNE A;  1LQ7 A;  1QX1 A;  2QFF A;  4R5J A;  2YL5 A;  1MJG A;  3BUD A;  4E81 A;  3LVT A;  4IM0 A;  3OHX M;  4H8S A;  2N3K A;  1DKZ A;  4JWC A;  4F01 A;  1TQW A;  3BUP A;  1TQU A;  4AZH A;  2F1A A;  2EWF A;  3I01 A;  1OA1 A;  2YKT A;  4G6Q A;  3D4Y A;  1SU8 A;  2RT6 A;  2ZXQ A;  2EX3 B;  4EZP A;  1SU7 A;  3BLB A;  4JWD A;  3DX4 A;  3BVV A;  4AZB A;  2Z0N A;  3G9G A;  4HY9 A;  3EJU A;  2RAK A;  3BUQ A;  4IWQ A;  4FM3 A;  2D1L A;  2ALW A;  2YI9 A;  1U00 A;  1I4S A;  3I2W A;  3EJQ A;  4BNE A;  5C5B A;  2NCZ A;  1RC7 A;  2WYI A;  5FLE X;  3BVT A;  2X3V A;  4JWE A;  3UIT A;  4PO2 A;  2YL8 A;  3C4B A;  1ZYL A;  4EZX A;  2Z0O A;  2X3X A;  1WDZ A;  2F18 A;  4WPC A;  4AZG A;  2JNS A;  1U61 A;  3O2R B;  3RV1 A;  4R5L A;  2NUE A;  1O7D B;  3RV0 A;  3GI7 A;  4UDX X;  1HWW A;  2F1B A;  4EZW A;  2OBM A;  2YIV X;  3BVW A;  4JNF A;  4OUN A;  2QKW A;  1SUF A;  3ERC C;  3D2E A;  3DX3 A;  4JL9 A;  4HYB A;  1JQK A;  3FD9 A;  1HXK A;  3B52 X;  2F7R A;  2FYV A;  3B51 X;  3ER9 B;  2F7P A;  3BUB A;  1OAO A;  3KAV A;  4D8J A;  3DX0 A;  1ZTD A;  1RC5 A;  1QWU A;  3CZS A;  1I4L A;  3T49 A;  3L3P A;  4EZQ A;  3C7N A;  2JNK A;  1R34 A;  3LLL A;  3EJR A;  3DPO A;  3CV5 A;  4E3C A;  3KAW A;  3D4Z A;  1SU6 A;  3ER8 C;  3O3M B;  5TKY A;  3QE6 A;  4EZN A;  4KIK B;  4FZP A;  3BUI A;  3SOG A; 
#chains in the Genus database with same CATH homology
 4H6I A;  5FLE X;  1UPX A;  2X5C A;  2WIN M;  4EZT A;  2GAF D;  4JWE A;  1YYK A;  4UDY X;  1OA0 A;  3UIT A;  2YI8 A;  4PO2 A;  4IWO A;  2QXL A;  4JWI A;  3O3O B;  4KIK A;  3C4B A;  1ZYL A;  4EZX A;  3A98 A;  1GN9 A;  4EZR A;  3OWG A;  3QA8 A;  3F7W A;  4EZV A;  2A11 A;  1DKY A;  4NPH A;  3B53 X;  5FIG A;  4F00 A;  2JNS A;  1U61 A;  4IM3 A;  2EZ6 A;  3O2R B;  1E1D A;  3N3W A;  3I39 X;  4M0M A;  3RV1 A;  4IW0 A;  2YIB A;  3ZED A;  4R5L A;  4B9Q A;  4EZY A;  3VEB A;  2NUE A;  2GSL A;  4R5K A;  1JFZ A;  3RV0 A;  3KDR A;  3GI7 A;  4UDX X;  3T46 A;  2FFL A;  4JLC A;  1E2U A;  4EZW A;  2OBM A;  3DPQ A;  3QNJ A;  3O3N B;  2YIV X;  4HR1 A;  4JNE A;  4JNF A;  3O2R A;  4OUN A;  1SUF A;  3ERC C;  3D2E A;  4JL9 A;  2QFF A;  4R5J A;  1MJG A;  4M2Z A;  1GNT A;  4HYB A;  2PY6 A;  3D2F A;  2GA9 D;  1JQK A;  3FD9 A;  4EZZ A;  4E81 A;  4HR1 B;  1E9V A;  4IM0 A;  3OHX M;  4EZS A;  1DKX A;  1GNL A;  3B52 X;  2N3K A;  2EB1 A;  2QVW A;  1DKZ A;  4IM2 A;  1YZ9 A;  3VEA A;  3B51 X;  4R5G A;  4JWC A;  3T47 A;  4F01 A;  3ER9 B;  2EWF A;  3I01 A;  1OA1 A;  4IWP A;  4JN4 A;  5E84 A;  2Z8Y A;  1OAO A;  3KAV A;  3L3O M;  4OOG C;  4D8J A;  4G6Q A;  2NUF A;  1RC5 A;  1SU8 A;  2RT6 A;  2ND1 A;  2ND0 A;  3I04 A;  2EX3 B;  4EZP A;  1SU7 A;  1O0W A;  2NUG A;  4JWD A;  3C4T A;  4HY9 A;  4EZO A;  1YYW A;  3T49 A;  4H6H A;  3T4A G;  1YYO A;  3C7N A;  3DPP A;  4EZQ A;  3LMF A;  2KHO A;  3DPO A;  4IWQ A;  4FM3 A;  3T48 A;  4E3C A;  3KAW A;  2YI9 A;  4M30 A;  1SU6 A;  1U00 A;  4EZU A;  1I4S A;  3ER8 C;  4R5I A;  3O3M B;  5TKY A;  1W9M A;  2LM0 A;  3VKH A;  2YIA A;  4EZN A;  4KIK B;  2OBL A;  2NCZ A;  1RC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...