3RV1A

Crystal structure of the n-terminal and rnase iii domains of k. polysporus dcr1 e224q mutant
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
242
structure length
217
Chain Sequence
SNELKVREFYRLHNACVKLKESIKLIYENPLVTDQNVLNLGTAENTIDYTILNTPTLNVAKTLLGNRYSLDLIDLFQSHDFKDSNTDVDMFIKYPVVYDENLENLAFMHKSQLSNERLEFLGDSWLGALVSYIVYTRFPSANEGMLSQMKESIVNNNNLFDWSTKLNFTKRLQGNIAKRYADCVQAYIGALVIDRFGTEFLDIKEWLEELSEKKLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K. polysporus Dcr1
publication title The inside-out mechanism of dicers from budding yeasts.
pubmed doi rcsb
source organism Vanderwaltozyma polyspora
molecule tags Rna binding protein
total genus 79
structure length 217
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 3rv1A02
1.20.1270.260 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3rv1A01
2QVWA 1O0WA 4OUNA 1YYWA 2NUFA 3C4BA 2FFLA 3C4TA 3RV1A 2GSLA 3N3WA 4M30A 2NUEA 1I4SA 1RC5A 3O2RB 1YZ9A 2EB1A 2EZ6A 4M2ZA 1YYOA 3RV0A 1YYKA 2A11A 1RC7A 3O2RA 1U61A 2NUGA 4OOGC 1JFZA
chains in the Genus database with same CATH superfamily
4NQIA 2F18A 4F00A 2X5CA 2F7OA 4IWQA 3M3WA 1LQ7A 3ACOA 4PO2A 2FYVA 4B9QA 1OA0A 4JL9A 2QKWA 3BUPA 2X3VA 2C08A 4NSWA 4AZ6A 4WPCA 3BVVA 2A11A 1MJGA 3L3OM 3CAZA 3ERCC 4ATMA 1DKXA 2YL8A 2V0OA 3SOGA 1YZ9A 2EB1A 2PY6A 3DPQA 4JWEA 2KHOA 4H6IA 3O3MB 1HWWA 1TQUA 2JNKA 2ND0A 3DDFA 1E1DA 2ND1A 3BVWA 4IM0A 1TQVA 1ZYLA 1YYOA 3T4AG 4EZUA 1GNTA 3HAIA 4KIKB 2D4CA 1DKZA 3D52A 1O0WA 4I1QA 4OUNA 4KIKA 2Q12A 2OO2A 3KAWA 2YIBA 2Z0VA 4H8SA 4FZOA 1YYKA 3B51X 1RC7A 2Q13A 2X3WA 3B53X 1GN9A 2F7QA 3ZEDA 3VEAA 3A98A 1HXKA 2O0I1 2RAJA 4HYBA 2WINM 1I4SA 2GF4A 4R5KA 3EJRA 3RV0A 4AZBA 4JWIA 4EZVA 4R5JA 3O3NB 4JLCA 4AZHA 3C4BA 3QWEA 2QXLA 1UPXA 1QWUA 2QFFA 1ZWWA 1SU6A 3LVTA 3CKDA 3QE6A 4JWCA 2FICA 1QX1A 2EFKA 4NPHA 3VEBA 1GNLA 3OHXM 2YKTA 2Z0NA 3BLBA 3EJSA 5C5BB 2LXYA 2YL9A 3RPMA 3BUDA 2YLAA 4AZGA 1DKYA 4IM2A 5C5BA 4R5GA 3I04A 2YI9A 1I4TA 3I2WA 3C7NA 3I01A 3Q84A 3T49A 3L3PA 2ZXQA 2MI7A 3D2FA 2RAKA 4R5IA 1E9VA 2F1AA 2RAIA 3T46A 5KBPA 1TQWA 3BUIA 3BUQA 4H6HA 3T48A 3DPPA 2OZNB 2NUGA 2OBLA 1SUFA 3DX2A 3F7WA 4EZTA 2EWFA 4EZPA 3FD9A 4G6QA 5FLEX 2YIAA 1YYWA 3ER9B 4JWDA 2QVWA 2NUFA 4UDYX 3RV1A 3D4ZA 3CVRA 4F01A 3LLLA 3CZSA 2YL6A 3O2RB 1HTYA 1X04A 1O7DB 2RT6A 5FIGA 3LMFA 2ELBA 3O2RA 2EFLA 3GI7A 4JNFA 1YWMA 1O7DC 2JNSA 3QA8A 1Y2OA 3SYVA 2WYHA 1WDZA 2GA9D 3G9GA 4IM3A 4JN4A 4D8JA 4IWOA 3OWGA 4AZ7A 4AZCB 1ZTDA 1SU7A 2OW7A 3DX3A 3KDRA 4EZYA 4AZCA 4EZSA 2ALWA 4FM3A 2GSLA 5E84A 4M30A 4M0MA 1PS3A 1I4LA 4EZWA 3DPOA 4AVMA 3ABHA 1TQTA 4BNEA 1JQKA 2YI8A 4AKVA 4UDXX 4DCNC 4EZQA 3QNJA 4HR1B 3EJQA 1W9MA 3BUBA 1R34A 4EZNA 2OW6A 3DX1A 1R5EA 2F7RA 2N3KA 3DX4A 4WPEA 1OA1A 3O3OB 4HR1A 3BVTA 1U00A 2GAFD 3EJPA 3D2EA 4AZ5A 4R5LA 1I49A 2X3XA 3EJTA 1TQSA 2F1BA 3B52X 1I4DA 1E2UA 4JNEA 4E81A 3D51A 3PLTA 2FFLA 3UITA 1SU8A 4IW0A 3HAHA 4DYLA 4FZPA 4E3CA 3DX0A 1R33A 2OBMA 4EZOA 2EZ6A 4M2ZA 2Z0OA 4EZXA 2YL5A 3ER8C 3QNIA 2PMRA 2YLLA 2YIVX 1U61A 2NCZA 2EX3B 2LM0A 4IWPA 3EJUA 3OK8A 2WYIA 3N3WA 3BVXA 4HY9A 4AZIA 1RC5A 3D4YA 1QWNA 4EZRA 3T47A 2D1LA 3DYTA 3BVUA 1X03A 2Z8YA 2F7PA 5TKYA 4EZZA 3C4TA 3I39X 1OAOA 3D50A 3HAJA 2NUEA 1URUA 3KAVA 3CV5A 3VKHA 3CZNA 3DDGA 3Q0KA 4FZSA 4OOGC 1JFZA
chains in the Genus database with same CATH topology
1W9MA 4F00A 4EZNA 2X5CA 3ZEDA 3VEAA 2OBLA 3A98A 1SUFA 4IWQA 4PO2A 2N3KA 4HYBA 1OA1A 2WINM 4B9QA 3O3OB 3F7WA 4HR1A 4EZTA 1OA0A 1U00A 2GAFD 2EWFA 1I4SA 3D2EA 4JL9A 3FD9A 4EZPA 4R5KA 4R5LA 4G6QA 3RV0A 2A11A 4JWIA 1MJGA 3L3OM 3B52X 5FLEX 1E2UA 4EZVA 2YIAA 1YYWA 3ER9B 4R5JA 4JWDA 4JNEA 3O3NB 4E81A 4JLCA 2QVWA 3ERCC 1DKXA 2NUFA 3C4BA 2FFLA 4UDYX 3UITA 3RV1A 1SU8A 4HR1B 4IW0A 4F01A 2QXLA 1UPXA 3O2RB 4E3CA 1YZ9A 2OBMA 2RT6A 5FIGA 4EZOA 2EB1A 2EZ6A 4M2ZA 2PY6A 3LMFA 2QFFA 4EZXA 1SU6A 3ER8C 3DPQA 4JWEA 2KHOA 4H6IA 4JWCA 2YIVX 3O2RA 3O3MB 1U61A 2NCZA 3GI7A 2EX3B 4NPHA 2LM0A 3VEBA 1GNLA 4IWPA 3OHXM 4JNFA 3N3WA 2ND0A 2JNSA 4HY9A 1E1DA 2ND1A 4IM0A 1RC5A 3QA8A 4EZRA 1DKYA 1YYOA 1ZYLA 2GA9D 3T47A 4IM2A 4IM3A 4JN4A 3T4AG 4EZUA 4D8JA 1GNTA 4R5GA 3I04A 2YI9A 4IWOA 3OWGA 4KIKB 2Z8YA 1SU7A 1DKZA 3C7NA 3I01A 3T49A 5TKYA 1O0WA 3KDRA 4OUNA 4EZYA 4KIKA 4EZSA 4FM3A 3D2FA 4EZZA 3C4TA 3QNJA 4R5IA 2GSLA 1E9VA 5E84A 3I39X 4M30A 1OAOA 3KAWA 4M0MA 3T46A 2YIBA 2NUEA 4EZWA 3DPOA 3KAVA 1YYKA 3VKHA 3B51X 1JQKA 1RC7A 2YI8A 4H6HA 3DPPA 3T48A 4UDXX 3B53X 2NUGA 4OOGC 4EZQA 1JFZA 1GN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVW A;  1O0W A;  4OUN A;  1YYW A;  2NUF A;  3C4B A;  2FFL A;  3C4T A;  3RV1 A;  2GSL A;  3N3W A;  4M30 A;  2NUE A;  1I4S A;  1RC5 A;  3O2R B;  1YZ9 A;  2EB1 A;  2EZ6 A;  4M2Z A;  1YYO A;  3RV0 A;  1YYK A;  2A11 A;  1RC7 A;  3O2R A;  1U61 A;  2NUG A;  4OOG C;  1JFZ A; 
#chains in the Genus database with same CATH topology
 4NQI A;  2F18 A;  4F00 A;  2X5C A;  2F7O A;  4IWQ A;  3M3W A;  1LQ7 A;  3ACO A;  4PO2 A;  2FYV A;  4B9Q A;  1OA0 A;  4JL9 A;  2QKW A;  3BUP A;  2X3V A;  2C08 A;  4NSW A;  4AZ6 A;  4WPC A;  3BVV A;  2A11 A;  1MJG A;  3L3O M;  3CAZ A;  3ERC C;  4ATM A;  1DKX A;  2YL8 A;  2V0O A;  3SOG A;  1YZ9 A;  2EB1 A;  2PY6 A;  3DPQ A;  4JWE A;  2KHO A;  4H6I A;  3O3M B;  1HWW A;  1TQU A;  2JNK A;  2ND0 A;  3DDF A;  1E1D A;  2ND1 A;  3BVW A;  4IM0 A;  1TQV A;  1ZYL A;  1YYO A;  3T4A G;  4EZU A;  1GNT A;  3HAI A;  4KIK B;  2D4C A;  1DKZ A;  3D52 A;  1O0W A;  4I1Q A;  4OUN A;  4KIK A;  2Q12 A;  2OO2 A;  3KAW A;  2YIB A;  2Z0V A;  4H8S A;  4FZO A;  1YYK A;  3B51 X;  1RC7 A;  2Q13 A;  2X3W A;  3B53 X;  1GN9 A;  2F7Q A;  3ZED A;  3VEA A;  3A98 A;  1HXK A;  2O0I 1;  2RAJ A;  4HYB A;  2WIN M;  1I4S A;  2GF4 A;  4R5K A;  3EJR A;  3RV0 A;  4AZB A;  4JWI A;  4EZV A;  4R5J A;  3O3N B;  4JLC A;  4AZH A;  3C4B A;  3QWE A;  2QXL A;  1UPX A;  1QWU A;  2QFF A;  1ZWW A;  1SU6 A;  3LVT A;  3CKD A;  3QE6 A;  4JWC A;  2FIC A;  1QX1 A;  2EFK A;  4NPH A;  3VEB A;  1GNL A;  3OHX M;  2YKT A;  2Z0N A;  3BLB A;  3EJS A;  5C5B B;  2LXY A;  2YL9 A;  3RPM A;  3BUD A;  2YLA A;  4AZG A;  1DKY A;  4IM2 A;  5C5B A;  4R5G A;  3I04 A;  2YI9 A;  1I4T A;  3I2W A;  3C7N A;  3I01 A;  3Q84 A;  3T49 A;  3L3P A;  2ZXQ A;  2MI7 A;  3D2F A;  2RAK A;  4R5I A;  1E9V A;  2F1A A;  2RAI A;  3T46 A;  5KBP A;  1TQW A;  3BUI A;  3BUQ A;  4H6H A;  3T48 A;  3DPP A;  2OZN B;  2NUG A;  2OBL A;  1SUF A;  3DX2 A;  3F7W A;  4EZT A;  2EWF A;  4EZP A;  3FD9 A;  4G6Q A;  5FLE X;  2YIA A;  1YYW A;  3ER9 B;  4JWD A;  2QVW A;  2NUF A;  4UDY X;  3RV1 A;  3D4Z A;  3CVR A;  4F01 A;  3LLL A;  3CZS A;  2YL6 A;  3O2R B;  1HTY A;  1X04 A;  1O7D B;  2RT6 A;  5FIG A;  3LMF A;  2ELB A;  3O2R A;  2EFL A;  3GI7 A;  4JNF A;  1YWM A;  1O7D C;  2JNS A;  3QA8 A;  1Y2O A;  3SYV A;  2WYH A;  1WDZ A;  2GA9 D;  3G9G A;  4IM3 A;  4JN4 A;  4D8J A;  4IWO A;  3OWG A;  4AZ7 A;  4AZC B;  1ZTD A;  1SU7 A;  2OW7 A;  3DX3 A;  3KDR A;  4EZY A;  4AZC A;  4EZS A;  2ALW A;  4FM3 A;  2GSL A;  5E84 A;  4M30 A;  4M0M A;  1PS3 A;  1I4L A;  4EZW A;  3DPO A;  4AVM A;  3ABH A;  1TQT A;  4BNE A;  1JQK A;  2YI8 A;  4AKV A;  4UDX X;  4DCN C;  4EZQ A;  3QNJ A;  4HR1 B;  3EJQ A;  1W9M A;  3BUB A;  1R34 A;  4EZN A;  2OW6 A;  3DX1 A;  1R5E A;  2F7R A;  2N3K A;  3DX4 A;  4WPE A;  1OA1 A;  3O3O B;  4HR1 A;  3BVT A;  1U00 A;  2GAF D;  3EJP A;  3D2E A;  4AZ5 A;  4R5L A;  1I49 A;  2X3X A;  3EJT A;  1TQS A;  2F1B A;  3B52 X;  1I4D A;  1E2U A;  4JNE A;  4E81 A;  3D51 A;  3PLT A;  2FFL A;  3UIT A;  1SU8 A;  4IW0 A;  3HAH A;  4DYL A;  4FZP A;  4E3C A;  3DX0 A;  1R33 A;  2OBM A;  4EZO A;  2EZ6 A;  4M2Z A;  2Z0O A;  4EZX A;  2YL5 A;  3ER8 C;  3QNI A;  2PMR A;  2YLL A;  2YIV X;  1U61 A;  2NCZ A;  2EX3 B;  2LM0 A;  4IWP A;  3EJU A;  3OK8 A;  2WYI A;  3N3W A;  3BVX A;  4HY9 A;  4AZI A;  1RC5 A;  3D4Y A;  1QWN A;  4EZR A;  3T47 A;  2D1L A;  3DYT A;  3BVU A;  1X03 A;  2Z8Y A;  2F7P A;  5TKY A;  4EZZ A;  3C4T A;  3I39 X;  1OAO A;  3D50 A;  3HAJ A;  2NUE A;  1URU A;  3KAV A;  3CV5 A;  3VKH A;  3CZN A;  3DDG A;  3Q0K A;  4FZS A;  4OOG C;  1JFZ A; 
#chains in the Genus database with same CATH homology
 1W9M A;  4F00 A;  4EZN A;  2X5C A;  3ZED A;  3VEA A;  2OBL A;  3A98 A;  1SUF A;  4IWQ A;  4PO2 A;  2N3K A;  4HYB A;  1OA1 A;  2WIN M;  4B9Q A;  3O3O B;  3F7W A;  4HR1 A;  4EZT A;  1OA0 A;  1U00 A;  2GAF D;  2EWF A;  1I4S A;  3D2E A;  4JL9 A;  3FD9 A;  4EZP A;  4R5K A;  4R5L A;  4G6Q A;  3RV0 A;  2A11 A;  4JWI A;  1MJG A;  3L3O M;  3B52 X;  5FLE X;  1E2U A;  4EZV A;  2YIA A;  1YYW A;  3ER9 B;  4R5J A;  4JWD A;  4JNE A;  3O3N B;  4E81 A;  4JLC A;  2QVW A;  3ERC C;  1DKX A;  2NUF A;  3C4B A;  2FFL A;  4UDY X;  3UIT A;  3RV1 A;  1SU8 A;  4HR1 B;  4IW0 A;  4F01 A;  2QXL A;  1UPX A;  3O2R B;  4E3C A;  1YZ9 A;  2OBM A;  2RT6 A;  5FIG A;  4EZO A;  2EB1 A;  2EZ6 A;  4M2Z A;  2PY6 A;  3LMF A;  2QFF A;  4EZX A;  1SU6 A;  3ER8 C;  3DPQ A;  4JWE A;  2KHO A;  4H6I A;  4JWC A;  2YIV X;  3O2R A;  3O3M B;  1U61 A;  2NCZ A;  3GI7 A;  2EX3 B;  4NPH A;  2LM0 A;  3VEB A;  1GNL A;  4IWP A;  3OHX M;  4JNF A;  3N3W A;  2ND0 A;  2JNS A;  4HY9 A;  1E1D A;  2ND1 A;  4IM0 A;  1RC5 A;  3QA8 A;  4EZR A;  1DKY A;  1YYO A;  1ZYL A;  2GA9 D;  3T47 A;  4IM2 A;  4IM3 A;  4JN4 A;  3T4A G;  4EZU A;  4D8J A;  1GNT A;  4R5G A;  3I04 A;  2YI9 A;  4IWO A;  3OWG A;  4KIK B;  2Z8Y A;  1SU7 A;  1DKZ A;  3C7N A;  3I01 A;  3T49 A;  5TKY A;  1O0W A;  3KDR A;  4OUN A;  4EZY A;  4KIK A;  4EZS A;  4FM3 A;  3D2F A;  4EZZ A;  3C4T A;  3QNJ A;  4R5I A;  2GSL A;  1E9V A;  5E84 A;  3I39 X;  4M30 A;  1OAO A;  3KAW A;  4M0M A;  3T46 A;  2YIB A;  2NUE A;  4EZW A;  3DPO A;  3KAV A;  1YYK A;  3VKH A;  3B51 X;  1JQK A;  1RC7 A;  2YI8 A;  4H6H A;  3DPP A;  3T48 A;  4UDX X;  3B53 X;  2NUG A;  4OOG C;  4EZQ A;  1JFZ A;  1GN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...