3RVCA

Effector domain of ns1 from influenza a/pr/8/34 containing a w187a mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
118
structure length
118
Chain Sequence
b'ASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEANDNTVRVSETLQRFAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Conservation of a crystallographic interface suggests a role for beta-sheet augmentation in influenza virus NS1 multifunctionality.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Protein binding
total genus 32
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3rvcA00
3P38A 3EE8A 3EE9A 3P39A 3D6RA 3L4QA 3OA9A 4OPAA 3F5TA 4OPHA 3P31A 3KWIA 3O9RA 3O9QA 3KWGA 3O9UA 3RVCA 2GX9A 3O9SA 2RHKA 3O9TA 3M5RA 2KKZA
chains in the Genus database with same CATH superfamily
2PFUA 1QHAA 1N5YA 3MAQA 3LL3A 4CJPA 5LMUK 2F9TA 2V7YA 4H0XB 3NFAA 1QS4A 1BQMA 4FL9A 2H3GX 1O13A 3AAPA 4B9UA 5J2PA 4PUOA 4CJVA 3TAPA 3IAYA 2HNDA 2FLOA 4GNIA 1T44A 1Z25A 4Y0WA 1XC9A 3WXJA 2I5JA 3K5NA 3FFKB 4CE9A 3QNOA 4Z94A 1L3UA 1TYQB 5LMNK 3AY9A 1RTIA 2UYTA 3CYMA 3WXLA 3VQQA 4HCCA 2EX3A 2E5LK 1NGEA 4DFJA 4DUYK 1BI4B 2YHYA 3NF9A 2CGKA 3EYZA 1C0UA 1S3XA 3V1OA 2FXUA 4CZEA 3SV3A 2VQEK 3PSIA 2RPIA 4FWNA 2WONA 1QE1A 1XHXA 1NMDA 3VA3A 3G25A 4CZLA 5I9EB 3NVKA 1VSMA 4LD0A 2P5OA 2BANA 3C7NA 1DKGD 2P9SB 3L3UA 4K25A 1MWMA 2Q3SA 3PLAA 3DXKA 3LANA 3O5BA 1S1UA 1NK5A 4YDUC 3RRGA 4QS7A 4R79A 3QEXA 3NGZA 4CFDA 4B9QA 3T3FA 5JLFA 1NJWA 1EQYA 1YIJN 2QWMA 1WUAA 3KTQA 1QTMA 1VSLA 2F8TA 4CK2A 1BGXT 5FPEA 3CC4N 1HPMA 3OBWA 3DOLA 4K43A 3CJCA 1ATNA 4G1QA 4FK0A 1RT4A 1BU6O 1TKXA 4XH4A 1NK7A 5BN8A 4H4OA 4DV7K 4H8KA 4HUGA 1E4GT 1RILA 3TABA 2XY8A 4B3TK 4BDYA 3PX6A 1U4BA 3OJUA 4O8UA 3CJ1A 5F0XA 1BUPA 2HMPA 4CJEA 4CK1A 4CFBA 3MX5A 4FM2A 3DOKA 4YORA 1VRUA 4NYNA 2VWKA 1U47A 1KLMA 3NH1A 4DTMA 4DSKA 4FLZA 3K57A 3QBWA 3NHGA 3NF6A 2F4VK 1NMNA 4J2DA 3H08A 1RCHA 1Z26A 2WUSA 4M3TA 4CJ4A 1NK0A 5FRNA 2QWRA 2P9IA 1SL2A 4KB1A 4CJ3A 4DS4A 2HBMA 2FF6A 4FJXA 5BPMA 3WNFA 2HOEA 4X66K 3C6HA 3BEXA 5JS1A 3NAEA 1JLQA 2JLEA 1SKSA 1TK0A 2D0PA 3AA4A 1VSJA 3QETA 5AJ3K 3TTFA 1ILYA 3T19A 3HPOA 4N41A 4FJ9A 4BRIA 3VGMA 4JKFA 4B3SK 4IDKA 2B5JA 2XRIA 1FJGK 4YOTA 4M63C 3A5LC 1D9DA 4DV2K 3IRXA 4LH5A 4NCAA 3AA3A 5CE3A 3HO1A 2WC9A 4U7BA 5KGWA 3OTOK 1ZBFA 4WFAL 1KLNA 3PIOL 2NRZA 4EAHD 5C2DA 3TR8A 1IKVA 1XMQK 3CJAA 1HMVA 4OKEA 4M45A 3SUQA 3O80A 3O6WA 3GOIA 4JKAA 1DTQA 2LSNA 4FZZA 3DAWA 4OVLA 1W2BM 3AO5A 5F1XA 4DS5A 5HP1A 1XUPO 1RDAA 3IFRA 4GVMA 5HRPA 1YUWA 4DWIA 2DFHA 2F9WA 4E7LA 1KAYA 1IBLK 5HL7L 1JXEA 1P90A 3P83D 4DFMA 1GOCA 1MWKA 1J6ZA 1JJ2M 4YY3K 3CJ9A 2ZQBA 4DSJA 4AHTA 4AM7A 2Y1JA 1ASVA 1VQON 4DQIA 3SZ2A 1I94K 1XC3A 1CXQA 4BC4A 4LF7K 3IUCA 1IKYA 4FWQA 2GTDA 3SMSA 4I7FA 2IC3A 4I9LA 1FXXA 2NNWA 3CI5A 2JWKA 4BWMA 3ZSRA 4DU3A 3T1HK 3TI0A 4KHUA 1KAZA 3H1QA 3NGYA 4KV8A 1KSPA 1HLUA 4JS5A 3K9JA 3U9ZA 4OLBA 1D9FA 4CBXA 1VSEA 4FZXC 4KKOA 2P5GA 2QTDA 2ZM6K 4YDUA 5AQHA 2BE2A 3OYHA 3OA9A 4DCHA 4BRMA 1QVFM 5BR8K 1TAUA 4M3UA 4RW7A 5B8HA 4GW6A 3OW2M 1Y97A 2GWJA 4QOZB 3VQCA 4WCEL 1SUQA 1MU2A 3AO4A 1HR0K 4B1ZA 3SQ0A 1EWQA 3ASMA 2DFEA 3J8AA 4FJNA 2DPNA 1ASWA 1JLFA 2P9IB 5JVGL 2Z1HA 2NRTA 4H0PA 4FLXA 3VQ8A 4DSEA 4OLAA 1U45A 3WXKA 3KLHA 3AVJA 3C94A 3LDPA 3DRRA 4YOUA 1VQKN 4CEAA 1NKCA 2WOMA 4FPBA 4LF8K 2YHWA 3CCEN 5KTQA 2KZZA 2W6LA 5AQMA 2Z1IA 4BC5A 3QEWA 1UA0A 3HPHA 2O8DB 1WB9A 4BR5A 3DM2A 4NLBA 4DFKA 2KZMA 4M41A 1RBVA 1RBSA 3MXJA 4CEOA 2ASOA 2W41A 3O8MA 5CZ2A 3EZ5A 3M8RA 2Q36A 4KHPK 1LW2A 2GUPA 4WE1A 4WF9L 4IOAL 2ZF5O 1SAZA 2BDPA 4F3TA 1HYVA 3ENOA 4U67L 3CCUN 3V9WA 4O55A 2AJQA 3KVGA 5A2QO 3U3YA 4C8LA 2OZMA 5CY4A 2ZGYA 4JI5K 5JLHA 2F8SA 4UQGA 4NCGA 5LL6Z 2E6LA 4LSNA 3IDHA 3H45C 3MWTA 2E6MA 3ZYYX 1FKOA 4NXMK 1C1BA 3O9UA 4WQ4C 3W3DA 5TKWA 4DTOA 3KLEA 2HHTA 3I33A 2B6AA 5IWAK 3OJSA 5JVHL 2AP1A 5AQFA 3H3OB 5M1FA 3JYTA 4IWVA 4BRQA 4CEDA 1XWLA 2D4WA 3MK6A 2VWBA 4CZJA 1L3SA 4FJIA 2YHBA 4CF2A 2HF3A 2KFZA 3WNEA 4I9QA 1IV0A 3V9ZA 4FJ7A 3DWLA 4M3XA 4DFPA 4CFAA 5AZJB 1JLCA 4Z4FA 3CHWA 1YAGA 5C25A 4DR2K 4Z4IA 3BY5A 1NG9A 1BL3A 4RWTA 4J2EA 4CJQA 3ENBA 4ZHRA 4MDBA 5H1SQ 4KAZA 1RDUA 3VQ4A 3AVFA 2YI1A 3U6FA 3LAKA 4CGFA 2CH5A 3LDOA 3LM2A 3MN7A 1H1VA 1P8ZA 3KWIA 4FO0A 1R0AA 4BR9A 4CJLA 1W7AA 4X62K 1WOQA 4BRPA 1NGJA 3L2UA 5GAGP 3MXIA 2IAJA 4M3YA 1KTQA 4KHQA 2G8WA 4H0OA 1ITGA 2HBJA 3KLGA 5SWMA 4DV0K 4M3WA 1JXBA 3IKMA 4H03B 3ZSXA 3VTHA 3ZX0A 5C42A 4BRGA 4JKCA 4XIUA 3K5OA 3PX4A 3CFOA 1D4XA 4KTWA 3OYGA 3DMJA 1NJYA 3VQ9A 3DXMA 5M1PA 3QESA 4PWDA 2YHXA 2WTUA 3ZSYA 4B1YB 1BI4A 4HVJA 1TV6A 3EE9A 4BACA 1IKWA 2YNFA 1BIZA 3NF7A 3BZCA 5LY3A 4FPAA 4FLWA 3TPQA 1QZ5A 2KW4A 3FZMA 3LPTA 2P9SA 1WSGA 2Q0UA 4Q5VA 5HRNA 3NF8A 4BRLA 2HF4A 1TK5A 4N76A 4A61A 1SQKA 1RT7A 3QIOA 2IVPA 5AZIB 1BCMA 4C1NI 3THYA 3CETA 1BISA 1TKTA 1TKZA 3PY8A 2FC0A 3HRGA 4IJNA 3D0PA 4EFHA 2CH6A 4MQ3A 2YNGA 4M3RA 4DTXA 4I2PA 2QI2A 1HKGA 3VETA 3QO9A 1NKBA 3LPUA 4ICLA 3J80O 4LF5K 4X64K 4YOXA 3AVHA 5EXWA 1UWBA 1X3MA 4E7KA 3CC2N 3PX0A 1KVCA 3VGKA 1HJRA 2YX6A 2FSJA 5EOYA 3MN9A 4CJ5A 3P31A 2G8UA 3OYDA 1J9AA 1NGGA 2HVIA 5BRFA 3DLBA 4E1JA 1OH6A 4CJKA 3HTVA 4CERA 3GG4A 2OANA 3TTCA 2GX9A 3E1YA 3H3NO 4KHSA 3KK1A 2PYJA 1YVUA 3WNGA 4W5QA 3QIPA 3JS6A 4IG0A 3I0RA 3EY1A 3U3GA 5AQNA 4CGIA 1GLBG 4A5AA 4E89A 4KH4A 1DEJA 1S9EA 2VG7A 3K2PA 3VPZA 2XY6A 4JI1K 1HNVA 3WQTA 1DT9A 5EX5A 4CJUA 1RT6A 1S6QA 3V81A 1A5WA 4BWJA 1SL1A 2OCEA 1L3TA 1YJNN 1ZBSA 4LF9K 3NGIA 4WQ4A 3RTVA 5BREA 5KPRA 1VSKA 3DYAA 1VQ5N 2IDOA 4FWMA 2IOCA 2QWNA 3C65A 4CEEA 4H0VB 1YT3A 1SZ2A 3BGRA 4BRHA 2P9PB 1S1TA 3O1BA 1Q18A 4DQ8A 4DR5K 3S3NA 1XHZA 3VQPA 1NM1A 3DLHA 4A59A 3KK7A 1MDUB 4OKKA 3AVCA 1U6ZA 1GOBA 1HNIA 2OYQA 4O44A 3ZSOA 1S1WA 5M1KA 1YJWN 3QDKA 4QS9A 1Y64A 3UKRB 1VQ7N 4W5RA 3J7ZO 3AVGA 3V1RA 4A2AA 3DXMB 4PQUA 4LC9B 5AQVA 4W5OA 4DLGA 3VQAA 2E2PA 3EE8A 3OS2A 3CQ8A 4WQ5C 1XNRK 2ZE2A 3JSMA 3SQ4A 4JKDA 4QS8A 5K14A 5AQSA 3F2KA 3RSEA 2OPSA 1VQ9N 3KIOA 1BCOA 3SAHA 4B1XB 3HJFA 2HHUA 3A2FA 3TSQA 1I3AA 3LP2A 3O9QA 3KWGA 3QFUA 1X1PA 3OYCA 3V9SA 2E4LA 4DKWA 1W0HA 1EWRA 4CF0A 1TVRA 1WLJA 3O9SA 1YITN 3RMCA 3THYB 1NJZA 1ASUA 5CYMA 1IG9A 3FGUA 2FBXA 1EKEA 5TKYA 3KZBA 5JS2A 1S9GA 3AARA 4AM6A 3HOTA 3SPZA 2G8HA 1IBMK 1RBTA 4CJRA 3C0BA 2Q1NA 3THXA 1QQNA 3EL2A 3HM8A 3LM9A 1UA1A 4YOYA 3MX2A 3HSTB 1E4FT 3E66A 3L3VA 4NB4A 1YJ9N 4FM1A 4Q0BA 5AQOA 2V52B 3HK2A 2KQ2A 5C15A 1NK8A 2VGNA 3O4QA 4MDAA 4HWIA 1SV5A 1IO2A 3FFIA 3V1QA 5ELZA 3O4NA 3B6OA 1WN7A 2OTJN 3RMDA 3AVNA 1YTAA 2Q0RA 3EN9A 3P39A 5T7BA 1TL1A 2Q97A 2QK9A 3AVBA 4BE0A 3SUPA 4CJ7A 4A62A 3B6PA 1NLVA 1KCFA 1QZ6A 1V4TA 4LH4A 4DV1K 3I0SA 1KRPA 1M90O 4PKGA 3RVCA 4FJMA 1QHTA 2FSNA 3SJHA 1ZXOA 4DU4A 2BGGA 1LOTB 1GLDG 3DLGA 1RBRA 1T6CA 2E88A 3VQBA 3SNNA 1GOAA 2GELA 4CZIA 2HHSA 4WFNL 4C8MA 2O8DA 3BF1A 4BC2A 1UOCA 1W9HA 4MO5A 2IGIA 4PL8A 4NLCA 4BVPA 2O8EA 4IO8A 2PY5A 1JKHA 3R6MA 5GADP 1S5JA 3NMUA 2QWLA 4DMNA 3RRHA 4AQYK 2GUIA 1VQNN 2YNHA 3E9PA 3VEYA 4JS4A 2ATQA 3Q7CA 3EO3A 4LY7A 1GLFO 3ATVA 4BGAA 1QVGM 2P9UB 5MLCQ 2VGMA 4IG3A 1RDCA 3VQ5A 4AHVA 3AGRA 4CIEA 3FZKA 2HBLA 3HP6A 2YJEA 1M1KO 1X9SA 3ZT3A 4GMJB 3DRSA 1XI1A 4BC3A 5E84A 1TGOA 4KBOA 4R5PA 3N4PA 3FLCO 1REVA 3RSEB 1KVAA 3MN6A 2HHWA 4DTPA 4B8AB 3ZT1A 1C6VA 4LF6K 1C0FA 3FR0A 1YHQN 5FROA 3AVIA 2A1SA 4RG8A 1CZAN 3SUOA 4DTRA 2UXBK 5AZJA 1VQLN 3HL8A 4HUEA 3P38A 4PL7A 4FLYA 1NGIA 2UU9K 4B9TA 4DF8A 4H5NA 4ELUA 3NBPA 4RW4A 1FKPA 2GEMA 3ZSQA 3QB0A 2QKKA 2OA8A 2QWPA 1T7PA 3UKUB 1JL2A 4BR2A 3CMAN 3C6TA 3THXB 4WQ5A 2A5XA 5BN9A 1RDWX 3VEOA 3VMFB 1JLAA 1SS6A 1ZC6A 4OPJA 3SPYA 5KRTA 3IG1A 2EHGA 4QAGA 4CHYA 4JNEA 5BRDA 1KXPA 5KPZA 3K0SA 3CQYA 4YHHK 4JI7K 2D0OA 2UXDK 4FWOA 2E1YA 5C10A 4CBWA 3D2FA 5C12A 1ZYQA 1JCGA 1QSLA 4JV5K 1VQ4N 5KGXA 3UE5A 4RW9A 2HMIA 3MEDA 3R1XA 4N56A 4AHSA 3EEQA 4KPYA 1RFQA 4E19A 4KO0A 2A40A 5D3GA 1HYSA 1K8KA 1T6DA 1N8RO 4KI4A 2G8KA 3V9UA 2ZJQL 3QINA 3VEWA 1W97L 2V51B 3TSUA 3NH2A 2ITGA 4BRNA 5GAEP 1JL1A 5J2MA 1NJXA 1S6PA 3MECA 3RR7A 3WQUA 2QXFA 5BRHA 2FBVA 3AGKA 1S22A 2ZJPL 4ELTA 1BG3A 4M42A 3E01A 1TAQA 1OH7A 4B3MK 3GDQA 2YHAA 1X9MA 4KREA 3O3HA 2HB5A 2HHXA 1IJJA 1WSJA 3QMLA 5CZ1A 3VA0A 3DLKA 3OS1A 2VQFK 3M8QA 4JRPA 2O8EB 5AZIA 1U49A 4K8ZA 1X9JA 1E3MA 4CIFA 2HHQA 4OX9K 4JLHA 4F2RA 2YKMA 5FPDA 3LDQA 3VF6A 4BGBA 3FE1A 4CHZA 3ZEUB 2VG5A 1Q9YA 3U9DA 4FWSA 4H5VA 5HLFA 3AVAA 2XO7A 3ZSWA 5DM6L 2P9LB 3L2WA 1C1CA 4GV3A 3TAGA 4CJSA 3HXMA 3U4LA 5CHIA 3LDNA 4IZ9A 4CVNE 3OS0A 4CHNA 2O4IA 2X6SA 3J81O 1HNWK 5DK5A 4EZ6A 1IG8A 3CCLN 3AO3A 3CCQN 3CCSN 5I42A 4Z4HA 3PO4A 2W42A 1VHXA 2O8BB 4IFEA 5AQXA 2Z1GA 3A8YA 2VG6A 3D6RA 4L8RB 1CZBA 2D0AA 2DFFA 4Z4EA 1NK6A 1K8AO 3WEEB 1HQUA 3GE1A 1WSIA 2FBTA 3ATUA 5HRRA 4CD1A 3VOVA 4EHUA 2GWKA 2RHKA 4J2AA 1NJIO 3F73A 2OPQA 4CJWA 2KKZA 1XMOK 2V7ZA 2E2QA 4X65K 4F3OA 4IKFA 3M1FA 4CEZA 3CCMN 4JK8A 4GV9A 5BPNA 3VENA 5HRSA 2YKNA 3KK2A 3JXUA 4BROA 3AO1A 5AFUA 4CZKA 4FLVA 3PO5A 3I8DA 3ZX3A 1S1VA 4B1VA 1NOZA 1NGCA 2P9PA 3I56N 5J2NA 3S9HA 1G15A 1L3VA 3NVMA 4BDPA 2RN2A 2E20A 1Q9XA 4B9MA 4B08A 3P5JA 3LDLA 4E7HA 4JRQA 3D2FB 3DLRA 4EHTA 1EP4A 3CM6A 4O5FA 4DR6K 4CJFA 5FDLA 1IBKK 5FPNA 3HSCA 1BHLA 3D7EO 1VRTA 3O9RA 3SK3A 1XNQK 2DTUA 3SV4A 3UKRA 3CXCM 3TWHA 4ID5A 3V9XA 1K8KB 3VN5A 3VF2A 3CJ7A 4BR0A 4ZTFA 4BRDA 4F4KA 4AILC 4F9OA 3ZX2A 4KHWA 1TL3A 3KJVA 2PZSA 3LAMA 4DV5K 2D0BA 4E3SA 1WSEA 1A5VA 1B9DA 5I3UA 4B9NA 3CCJN 3VQDA 1CXUA 2VYPA 5KI6A 4NXNK 2P9NA 3OYJA 1TKDA 1VSHA 4GY2B 3GL1A 2AA4A 3CM5A 4JI0K 4M3ZA 1QQMA 4CECA 3V6DA 2E2NA 4C23A 1L5UA 4DHYA 1K9MO 1D8YA 2A42A 3ZSZA 3TARA 2NLXA 4JI8K 1GLJO 3SLCA 5J2QA 3WXMB 1OH8A 4E1NA 4CHQA 4I2QA 4LFCK 4CHPA 4EP5A 1R59O 3HVRA 1B9FA 4DQRA 5AQWA 3SBGA 2UUBK 1RT2A 3VERA 4CZFA 5AQRA 1JLBA 2F96A 4C8OA 2A6AA 3MEEA 4ZTJA 5CR4A 3K58A 2EWSA 4CD3A 5AQZA 4OGEA 4HTUA 4Y1DA 3KKRA 3VQEA 3O1WA 3D2EB 4FWPA 1JLEA 1J53A 2P9KB 4BDZA 3PUFA 1C0GA 5FPMA 4KI6A 1YF5L 4DU1A 3ZT0A 4MO4A 1Q81O 1HKBA 3L8BA 4E0DA 1F21A 4PKHA 4C8NA 3QERA 1EX4A 3TTDA 3ZSVA 2UUAK 2QEXN 2QWOA 3DLLL 1BDGA 4JK9A 1YXQA 3LZIA 1HPZA 4BQLA 3MXMA 1J5OA 2BH1A 5KRSA 3DRPA 4PHTX 2PBDA 3OYNA 3KK3A 1UAXA 4BE2A 1IH7A 5AQUA 4E1MA 5AQKA 1OKJA 3K9KA 4AHUA 1V4SA 4O5BA 4I6MB 2OTLN 1WAJA 1VQ8N 1Z6RA 4E7IA 3OHRA 3CPWM 1TK8A 5EY4A 4DV6K 2YJFA 4YNQA 1LAVA 3SAFA 2A3ZA 3S3OA 4YOWA 3WXIA 2QW9A 4K0KK 2QKBA 3G4SN 4OKJA 1U2VA 1K6YA 1Q7YO 3HYFA 1DLOA 2D0CA 1NWKA 5BR9A 1LV5A 5HOOA 4GV6A 3HM9A 1YI2N 1NBWA 3G71N 1VQMN 1RDDA 3OBYA 3FZHA 3OYIA 1HNZK 2IVNA 4AHCA 4KH5A 2E2OA 4BR4A 1RTDA 4QCLA 3ID8A 1NGBA 5AR0A 2P9UA 3TAFA 4FYDA 5C2FA 1HRHA 4AF1A 3U8XA 4FSVA 1WBDA 5EU7A 4A57A 4DR1K 4ILJA 4J8FA 5LJVA 3KHYA 3KLIA 4CF1A 4KHNA 2ASPA 4DR3K 4B9LA 3R8EA 4OPKA 2PAVA 5M1QA 3CQXA 1KFSA 5C24A 3P4IA 5IT9O 2HNZA 3IMXA 3UIQA 1HYZA 2E1ZA 2P9NB 1GLLO 3ITHA 3O4WA 4OPHA 3TSPA 1BQNA 4E7JA 3THVA 1NOYA 1Q86O 1NGHA 3JAMO 4FLTA 3CD6N 2J4RA 3LWMA 4EP4A 1RTHA 4ILHA 3THWA 3CFRA 4JK7A 5J1EA 4F8RA 3P1GA 3HOSA 1FW6A 4KFBA 3HVTA 5F2RA 3WT0A 1KC8O 3PSFA 4YFUA 2W6KA 2CGLA 2NUBA 4OPAA 1ATSA 3LDSA 3CFPA 1DTTA 1BOTO 1LAWA 2HSTA 5KQ8A 3AVKA 4FW2A 1N32K 3UKUA 3L0QA 3L4IA 2VWJA 1VSFA 2Y1IA 3E9OA 5GIOA 4JKGB 4DSIA 4M7YA 3M5RA 5KQDA 3ULEB 4N47A 4IO9L 3T1YK 2NRHA 4PA1A 4UY8O 3AAQA 2KLAA 1QSYA 4CBUA 1LWFA 4CEFA 5AQQA 1HJOA 5HBMA 3A5OC 1NK9A 3SQ2A 1C0TA 2FBYA 4JD2A 4RCHA 4FLUA 2ITMA 2XY7A 3L2VA 1C1AA 5AQTA 5AFUH 4DLEA 1WSFA 2QWQA 3SUNA 4KH6A 4FJJA 3RMAA 4DQPA 4HUFA 3TAQA 3B8AX 4DSLA 2VCPA 3O3GA 2R7YA 3ZT4A 1VQPN 4MFBA 4DR7K 4FM0A 4BY9C 2QM1A 3CF5L 4CZMA 4ISGA 3KD5E 4CGJA 4MLHA 4N5SA 4FVUA 3O08A 4CW7B 1G99A 4BRCA 3MN5A 2OZSA 5AQGA 3OYAA 1LCUA 1HX1A 5KPTA 3NCIA 4HTLA 4DQQA 4B9VA 1EXQA 1VSIA 3FZLA 3QNNA 4CIGA 4CESA 1BWFO 1HQEA 3PV8A 3VF4A 1QQCA 3H1VX 4O0JA 4B1UB 4CEBA 3SQ1A 3T1AA 1I39A 1U2VB 2XHBA 3G6EN 3M3ZA 3LP1A 1ESVA 4B3RK 3K59A 1N36K 5FRMA 4FZYA 4BREA 3F9KA 4FWRA 4JKEA 3CCVN 1X3NA 1HUXA 3BDPA 1JLGA 1RDBA 3ZEUA 1KD1O 2O4GA 3IS9A 2CGJA 4BE1A 2FF3B 1U48A 2P9LA 2UXCK 5ADXA 5CYQA 4O0IA 1NNEA 3L2QA 4JI6K 4B3OA 1OVYA 1OVQA 3M6GA 3V4IA 2RF2A 3BUZB 2Q31A 4OO1J 1JCEA 2DY4A 4K41A 2IIRA 3M8PA 4B8CA 3GBTA 4BG8A 3A5MC 4CF9A 1CLQA 4OJRA 1KVBA 4BQZA 4CHOA 3OYBA 3VGLA 4ILGB 4FK4A 1TUYA 4CGHA 4B9SA 3HPGA 4LSLA 4DB3A 2O8BA 4JN4A 1NKEA 3QEVA 4JKHA 1BA0A 1TUUA 2D1KA 3WEEA 3THWB 2QXLA 3MCAB 3EKSA 4C1NK 4DV3K 3ULDA 4V19S 1RT5A 3HZ6A 3C7NB 1SKRA 4DSFA 4KTQA 4JI4K 5M1NA 3DXKB 4H0YB 3MMVA 4O8KA 1B92A 2YCHA 2O8CA 3M8SA 1ZBIA 4DV4K 1MA9B 5M1OA 4AHRA 3OY9A 3A0IX 3T7ZA 5E41A 1ZBUA 2XY5A 4FOEA 3F9MA 2IVOA 1K73O 3S3MA 1RTJA 4Z0UA 4DQSA 1A5XA 4JD2B 4IEEA 5JMVA 3ISNC 4A5BA 4NCBA 1U04A 1T05A 1S1XA 4K42A 5FLXO 1ZBHA 2P51A 4O4GA 1CZ9A 4ISFA 1T3VA 3J7YP 3L6QA 3C6UA 2HVHA 3BF3A 1T03A 2HHHK 3SYZA 4DUZK 3BZKA 1BO5O 4IFVA 4KRFA 3TU5A 3WNHA 4CZHA 3MWPA 4XH5A 4JAXA 4GVEA 4XH1A 3AV9A 1NK4A 2G8IA 5DMRA 3OYMA 4IOCL 3WUHA 3ALYA 1KQSM 3OVNA 4TSXA 3LP0A 4DTUA 2NRRA 4ID1A 4HCBA 2I7NA 1NGAA 4JI2K 3ZETA 4FWLA 3LP3A 4YOVA 4CI6A 5LJWA 4BR7A 3T69A 2ZGZA 3LWLA 3F5TA 4ELVA 3QEIA 1EO1A 4BRFA 3I8BA 5GIPA 4DTSA 2W40A 4IBNA 4DTJA 5AQYA 1Q82O 4FJGA 5C0YA 3OYLA 3G0ZA 3QFPA 4NO7A 4IFYA 3CCRN 3MCPA 4IOXA 3PIPL 1LWCA 3Q7BA 2RE2A 1ZBLA 1GLCG 2RKIA 5SZTA 3RWUA 1SL0A 1D5AA 2ZJRL 3S41A 3K5MA 2F7TA 5E26A 2D5RA 4J2BA 4AH9A 1Z05A 2NRXA 3CJBA 1RBUA 2NRVA 3RR8A 3UB5A 2ASMA 3RMBA 3D2EA 3HP9A 1YTUA 2P9KA 4B1WB 2NRWA 3N4QA 3OYFA 1T8EA 3SCXA 5GAHP 4JEPA 3KD1E 4WYBA 2X78A 1FK9A 4G9ZA 4BVOA 5HROA 3VESA 4FXDA 2ETJA 5JICA 3ZCMA 2KTQA 5DM7L 3D45A 4JHDA 4FW1A 1VAZA 3VQ6A 1S72N 2B4JA 3VQ7A 3HT3A 4LFAK 3G10A 1XQSC 2E8AA 4IJAA 3AO2A 4DF4A 1Q8IA 4Y1CA 3J7AP 2O8CB 1GLAG 3DJCA 3TAMA 4I6MA 4OGCA 3DI6A 1RT1A 3BP8A 4H5RA 4CCHA 2BUPA 1NGFA 3CIPA 1QQOA 3MDQA 3MEGA 3CG7A 3NH0A 3I55N 1GLEG 2UUCK 1SKWA 2O8FA 1ATRA 4KB0A 4CK3A 4HHTA 1C0MA 3C95A 4WFBL 4LF4K 2IS3A 3CERA 4BG9A 4BRAA 3ZLJA 2P1JA 3KKSA 1WSHA 4ISEA 2NZTA 3TAEA 2YNIA 3ZT2A 1J5EK 2GV9A 4A2BA 4IDHA 4FJHA 1N34K 4C8KA 3AVMA 1RGIA 4IEIA 3VEVA 4FOIA 5GINA 3O3FA 2OPRA 2I7PA 2OPPA 4LFBK 4H4MA 1HKCA 3QEPA 2HHVA 4MLEA 2ZD1A 1KFDA 3HI0A 2JWLA 2KHOA 3E9LA 3OYKA 4PY5A 3VTIA 4RW6A 2Z1JA 1TYQA 4CFCA 4FJ5A 3DLEA 1VK0A 3K5LA 3LZJA 2QA4N 2G8FA 4CJTA 3QLHA 3W0LA 3SMPA 5AQLA 4W5TA 3R3LA 5ADXH 4H5WA 1RNHA 3ZETB 2HNYA 3AA5X 4Z4GA 1LW0A 4FK2A 3CC7N 3L4QA 1DGKN 3CPEA 2JGUA 3SAGA 2X6NA 1QSSA 4Z4CA 4FJLA 3QICA 4DTNA 2ZWHA 4JI3K 3LALA 2G8VA 1JCFA 2FSKA 1HNXK 3R9PA 1J54A 3AA2A 3NDKA 3ID6A 4RW8A 4FCYA 4FJKA 1N33K 4JKBA 4JKGA 4L3QA 4K8XA 1WNSA 3ULEA 4IXCA 4DR4K 5BPLA 3NE6A 3C6AA 4FJ8A 4PKIA 4RTFD 2PYLA 1KAXA 4BRKA 1RT3A 2BTFA 1X9WA 3EZWA 4H5TA 2KFNA 1LWEA 4KHYA 3KLFA 3EKUA 4EIAA 4EZ9A 3FZFA 3QBXA 4JHDB 1VQ6N 1BIUA 4FWKA 4XEIA 4JYAK 5EVZA 1WAFA 3SI6A 4NYFA 3SJJA 2YV0X 4KTZA 1OH5A 5AQPA 1IKXA 3L2RA 1YVNA 2HW3A 3AVLA 1WBBA 1NGDA 4W5NA 3ENHA 1NU0A 1VSDA 2Q2RA 4GKJK 2A41A 4FVMA 4M7XA 3VEZA 3VEXA 3A5NC 4CEQA 3H46O 4CF8A 1EETA 5AQIA 1N6QA 2GBZA 3H6EA 2WBNA 4H0TB 4CGGA 2O8FB 2X74A 1O1WA 3TANA 4F2SA 3SBTA 4CGDA 3OYEA 4GKKK 3HBTA 4DG1A 5AQJA 1BA1A 2HBKA 3CMEN 2WFBA 3O9TA 2A1RA 4CZGA
chains in the Genus database with same CATH topology
2PFUA 1K8KA 1QHAA 1T6DA 1BWFO 5GAGP 1N8RO 3LL3A 2F9TA 2V7YA 4H0OA 4H0XB 2ZJQL 3VF4A 2HBJA 3VEWA 1W97L 3H1VX 2V51B 3IKMA 4H03B 4FL9A 3TSUA 4B1UB 3VTHA 3ZX0A 1U2VB 4BRNA 5GAEP 2H3GX 1O13A 3AAPA 4BRGA 3G6EN 4JKCA 3M3ZA 1ESVA 2FLOA 4GNIA 3WQUA 1D4XA 1T44A 4Y0WA 5BRHA 3AGKA 3WXJA 1S22A 2ZJPL 1BG3A 3DXMA 5M1PA 2YHXA 3FFKB 4BREA 4B1YB 4FWRA 4JKEA 3CCVN 1X3NA 3GDQA 1HUXA 3EE9A 4Z94A 1IJJA 1TYQB 3QMLA 3ZEUA 1KD1O 3AY9A 2CGJA 2FF3B 5LY3A 4FPAA 2UYTA 3WXLA 2P9LA 3TPQA 5AZIA 1QZ5A 5ADXA 1NGEA 3FZMA 1X9JA 2P9SA 1OVYA 2Q0UA 3M6GA 5FPDA 2YHYA 3LDQA 3VF6A 3BUZB 2CGKA 4BRLA 2HF4A 4BGBA 3FE1A 1S3XA 2Q31A 2FXUA 3ZEUB 4CZEA 4OO1J 1JCEA 4K41A 4A61A 2IIRA 4BG8A 1SQKA 3GBTA 4FWSA 3U9DA 4FWNA 3A5MC 4H5VA 1NMDA 4BQZA 5DM6L 2IVPA 3G25A 4CZLA 2P9LB 5I9EB 5AZIB 4C1NI 3NVKA 3VGLA 3C7NA 3CETA 1DKGD 1TUYA 4ILGB 4GV3A 4BRPA 4DB3A 2P9SB 4JN4A 3U4LA 4IJNA 3HRGA 4K25A 1MWMA 3LDNA 4IZ9A 5CHIA 4EFHA 2CH6A 3PLAA 3DXKA 3O5BA 4JKHA 1BA0A 1IG8A 3CCLN 1TUUA 2D1KA 3WEEA 2QXLA 2QI2A 3CCQN 3MCAB 1HKGA 3EKSA 3CCSN 4YDUC 4C1NK 3VETA 4QS7A 4R79A 3HZ6A 3C7NB 4B9QA 5JLFA 4IFEA 5AQXA 1EQYA 3A8YA 4YOXA 5M1NA 3D6RA 1YIJN 3DXKB 4H0YB 5EXWA 2QWMA 3MMVA 4O8KA 1X3MA 2YCHA 1WUAA 3CC2N 1K8AO 3VGKA 3WEEB 2YX6A 2FSJA 5EOYA 3MN9A 3P31A 1MA9B 1NGGA 3GE1A 5M1OA 5BRFA 4E1JA 5FPEA 3CC4N 1HPMA 3OBWA 3ATUA 4K43A 3CJCA 3HTVA 4CD1A 1ATNA 3A0IX 3GG4A 3VOVA 2OANA 3T7ZA 2GX9A 3E1YA 3H3NO 3TTCA 4EHUA 2GWKA 2RHKA 1NJIO 2KKZA 1BU6O 2V7ZA 3JS6A 2E2QA 3F9MA 2IVOA 4FOEA 4XH4A 1K73O 5BN8A 3M1FA 3CCMN 4JK8A 5AQNA 4GV9A 1GLBG 5BPNA 1E4GT 4A5AA 4KH4A 1DEJA 3VENA 4JD2B 4IEEA 3VPZA 5JMVA 3JXUA 4A5BA 4BROA 5AFUA 4CZKA 4O8UA 3CJ1A 5F0XA 3WQTA 1DT9A 5EX5A 1BUPA 2HMPA 4K42A 3MX5A 3ZX3A 4YORA 4B1VA 1NGCA 2P9PA 3I56N 4ISFA 1YJNN 1T3VA 1ZBSA 3NVMA 3L6QA 2E20A 3BF3A 3QBWA 4WQ4A 5BREA 3LDLA 3D2FB 4EHTA 5KPRA 1BO5O 4O5FA 1VQ5N 4FWMA 3TU5A 2WUSA 3MWPA 4XH5A 2QWNA 3C65A 4CZHA 4H0VB 1SZ2A 4JAXA 4BRHA 2P9PB 4GVEA 4XH1A 5FPNA 3HSCA 3O1BA 1Q18A 3D7EO 2QWRA 3O9RA 4DQ8A 2P9IA 3SK3A 4IOCL 3UKRA 3WUHA 2HBMA 2FF6A 3CXCM 1NM1A 5BPMA 4A59A 3KK7A 1KQSM 2HOEA 1K8KB 1MDUB 3C6HA 3BEXA 1U6ZA 2NRRA 3VF2A 2I7NA 3CJ7A 4BR0A 1NGAA 4BRDA 4F9OA 3ZX2A 3ZETA 4FWLA 5M1KA 1YJWN 2D0PA 4YOVA 3QDKA 4CI6A 1ILYA 5LJWA 3TTFA 4BR7A 3T69A 2ZGZA 4QS9A 1Y64A 3UKRB 1VQ7N 3F5TA 4BRIA 3VGMA 3CCJN 1EO1A 3J7ZO 4BRFA 3I8BA 5GIPA 2W40A 4JKFA 2VYPA 5AQYA 1Q82O 4A2AA 3DXMB 2P9NA 5C0YA 4GY2B 4YOTA 4M63C 3A5LC 3GL1A 3QFPA 4NO7A 2AA4A 4LC9B 5AQVA 3CCRN 3MCPA 2E2PA 4IOXA 3PIPL 3Q7BA 1QQMA 2RE2A 1GLCG 2E2NA 4C23A 3EE8A 4DHYA 4WQ5C 1K9MO 2A42A 5CE3A 2WC9A 2ZJRL 4U7BA 4JKDA 4QS8A 3S41A 2F7TA 2NLXA 5E26A 1GLJO 5AQSA 3SLCA 3F2KA 4WFAL 3RSEA 3WXMB 3PIOL 1Z05A 1VQ9N 2NRXA 3CJBA 2NRVA 3SAHA 4B1XB 3UB5A 2ASMA 1R59O 3TSQA 2NRZA 3D2EA 3KWGA 3O9QA 3QFUA 4EAHD 5C2DA 5AQWA 3SBGA 2P9KA 4B1WB 2NRWA 4DKWA 3N4QA 5GAHP 3VERA 3CJAA 3O9SA 4JEPA 4CZFA 5AQRA 1YITN 4WYBA 3O80A 3O6WA 2A6AA 5CR4A 3GOIA 4JKAA 4G9ZA 3FGUA 4BVOA 2EWSA 5TKYA 3KZBA 5AQZA 4CD3A 3DAWA 3VESA 1W2BM 3AARA 4AM6A 3HOTA 5F1XA 5JICA 1XUPO 3IFRA 3D2EB 3O1WA 4FWPA 1YUWA 5DM7L 2F9WA 2P9KB 4JHDA 1KAYA 1C0GA 1VAZA 1S72N 3C0BA 2Q1NA 5FPMA 1P90A 5HL7L 1YF5L 1QQNA 1MWKA 4MO4A 1Q81O 1HKBA 1J6ZA 3EL2A 3HM8A 3LM9A 1JJ2M 4PKHA 4YOYA 1XQSC 2E8AA 3CJ9A 4IJAA 3MX2A 4AM7A 1E4FT 3TTDA 3E66A 4NB4A 1VQON 1YJ9N 2QEXN 2QWOA 3DLLL 1BDGA 4JK9A 1GLAG 3DJCA 5AQOA 2V52B 1XC3A 1YXQA 4I6MA 4BQLA 4BC4A 5C15A 3IUCA 4FWQA 2BH1A 2GTDA 3SMSA 3BP8A 4H5RA 2PBDA 4PHTX 2VGNA 2BUPA 1NGFA 4MDAA 4HWIA 3CIPA 1QQOA 2NNWA 3CI5A 2JWKA 3MDQA 5AQUA 3I55N 1GLEG 5AQKA 1ATRA 1KAZA 1OKJA 3H1QA 3K9KA 5ELZA 1HLUA 3K9JA 4WFBL 3U9ZA 3CERA 1V4SA 4CBXA 2OTJN 4BG9A 4I6MB 4BRAA 2OTLN 2Q0RA 3EN9A 1VQ8N 3P39A 1Z6RA 3OHRA 2QTDA 4ISEA 5EY4A 2NZTA 2Q97A 3CPWM 4YDUA 5AQHA 4CJ7A 2YJFA 3OA9A 4A62A 4DCHA 4BRMA 4A2BA 1NLVA 4IDHA 1QVFM 3SAFA 1QZ6A 2A3ZA 1V4TA 4YOWA 3WXIA 2QW9A 3G4SN 1U2VA 5B8HA 1RGIA 1Q7YO 4IEIA 1M90O 4PKGA 4FOIA 3RVCA 3VEVA 5GINA 3OW2M 2FSNA 1NWKA 2I7PA 3SJHA 5BR9A 5HOOA 4GV6A 2GWJA 1ZXOA 4WCEL 1HKCA 1YI2N 1NBWA 4MLEA 3G71N 3HI0A 1VQMN 4B1ZA 1LOTB 1GLDG 2JWLA 2KHOA 3E9LA 3OBYA 3FZHA 1T6CA 2E88A 2IVNA 4KH5A 2E2OA 2GELA 3VTIA 4BR4A 3J8AA 4CZIA 2DPNA 4WFNL 1VQ6N 1TYQA 3ID8A 1NGBA 3BF1A 4BC2A 4MO5A 2P9IB 5AR0A 5JVGL 4H0PA 2NRTA 4PL8A 2QA4N 2P9UA 4NLCA 3WXKA 4BVPA 4IO8A 5C2FA 3R6MA 5GADP 3NMUA 2QWLA 3W0LA 4AF1A 3U8XA 3LDPA 3SMPA 4FSVA 5AQLA 4A57A 4YOUA 1VQKN 3R3LA 5ADXH 4H5WA 1VQNN 4ILJA 4FPBA 3ZETB 3E9PA 2YHWA 4J8FA 3VEYA 3KHYA 5LJVA 3CCEN 5AQMA 4BC5A 3Q7CA 3EO3A 2ASPA 1GLFO 4NLBA 3ATVA 4BGAA 4BR5A 1QVGM 3CC7N 3L4QA 1DGKN 2P9UB 3R8EA 5MLCQ 2VGMA 2PAVA 5M1QA 3CQXA 3CPEA 3SAGA 3P4IA 2ASOA 2W41A 3IMXA 3O8MA 2E1ZA 2P9NB 3AGRA 1GLLO 4OPHA 3O4WA 2Q36A 3TSPA 3FZKA 2GUPA 2HBLA 4WF9L 3QICA 2YJEA 1Q86O 1M1KO 1NGHA 2ZWHA 4IOAL 2ZF5O 3CD6N 2J4RA 1SAZA 1JCFA 4BC3A 4ILHA 3ENOA 2FSKA 5E84A 4KBOA 3R9PA 4U67L 4JK7A 3N4PA 3CCUN 3ID6A 3HOSA 3FLCO 3KVGA 4JKBA 4JKGA 3RSEB 4L3QA 5F2RA 3WT0A 3MN6A 1KC8O 3ULEA 4IXCA 2ZGYA 5JLHA 2CGLA 4OPAA 1ATSA 5BPLA 1BOTO 2HSTA 1C0FA 3C6AA 3FR0A 3IDHA 3H45C 5KQ8A 1YHQN 4PKIA 3MWTA 4RTFD 3ZYYX 3UKUA 1KAXA 1CZAN 3L0QA 3L4IA 3O9UA 4WQ4C 4BRKA 2BTFA 3W3DA 3EZWA 4H5TA 5TKWA 3I33A 3E9OA 5AZJA 5GIOA 1VQLN 3EKUA 4EIAA 5JVHL 2AP1A 4JKGB 5AQFA 4M7YA 3M5RA 3FZFA 3H3OB 5KQDA 5M1FA 3QBXA 3P38A 3ULEB 4PL7A 1NGIA 4IO9L 2NRHA 4IWVA 4UY8O 3AAQA 4BRQA 4H5NA 2KLAA 4CBUA 2GEMA 2D4WA 4JHDB 4FWKA 3MK6A 3QB0A 4XEIA 2VWBA 4CZJA 5AQQA 5EVZA 1HJOA 2HF3A 2QWPA 3A5OC 3UKUB 4BR2A 3CMAN 4WQ5A 3DWLA 2A5XA 4JD2A 5AQPA 4RCHA 5BN9A 5AZJB 1YVNA 1RDWX 3VEOA 3VMFB 3CHWA 2ITMA 1YAGA 1SS6A 1ZC6A 1NGDA 3ENHA 5AQTA 2Q2RA 4JNEA 5AFUH 5BRDA 2A41A 1KXPA 2QWQA 5KPZA 4RWTA 4KH6A 4M7XA 3ENBA 4MDBA 3VEZA 3VEXA 3A5NC 5H1SQ 3H46O 3B8AX 2VCPA 3CQYA 1RDUA 5AQIA 2YI1A 1VQPN 2D0OA 3H6EA 4BY9C 4FWOA 2WBNA 2E1YA 2QM1A 5C10A 3CF5L 4CZMA 4ISGA 3D2FA 4H0TB 2CH5A 4MLHA 4CBWA 3LDOA 3LM2A 5C12A 3MN7A 1JCGA 4FVUA 1H1VA 1P8ZA 3KWIA 3O08A 1G99A 4FO0A 1VQ4N 3UE5A 3SBTA 4BRCA 3MN5A 5AQGA 3R1XA 1LCUA 4BR9A 1RFQA 3HBTA 5AQJA 1BA1A 2HBKA 3CMEN 2A40A 1HX1A 2WFBA 3O9TA 5KPTA 4HTLA 1WOQA 4CZGA 1NGJA 3FZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P38 A;  3EE8 A;  3EE9 A;  3P39 A;  3D6R A;  3L4Q A;  3OA9 A;  4OPA A;  3F5T A;  4OPH A;  3P31 A;  3KWI A;  3O9R A;  3O9Q A;  3KWG A;  3O9U A;  3RVC A;  2GX9 A;  3O9S A;  2RHK A;  3O9T A;  3M5R A;  2KKZ A; 
#chains in the Genus database with same CATH topology
 2PFU A;  1QHA A;  1N5Y A;  3MAQ A;  3LL3 A;  4CJP A;  5LMU K;  2F9T A;  2V7Y A;  4H0X B;  3NFA A;  1QS4 A;  1BQM A;  4FL9 A;  2H3G X;  1O13 A;  3AAP A;  4B9U A;  5J2P A;  4PUO A;  4CJV A;  3TAP A;  3IAY A;  2HND A;  2FLO A;  4GNI A;  1T44 A;  1Z25 A;  4Y0W A;  1XC9 A;  3WXJ A;  2I5J A;  3K5N A;  3FFK B;  4CE9 A;  3QNO A;  4Z94 A;  1L3U A;  1TYQ B;  5LMN K;  3AY9 A;  1RTI A;  2UYT A;  3CYM A;  3WXL A;  3VQQ A;  4HCC A;  2EX3 A;  2E5L K;  1NGE A;  4DFJ A;  4DUY K;  1BI4 B;  2YHY A;  3NF9 A;  2CGK A;  3EYZ A;  1C0U A;  1S3X A;  3V1O A;  2FXU A;  4CZE A;  3SV3 A;  2VQE K;  3PSI A;  2RPI A;  4FWN A;  2WON A;  1QE1 A;  1XHX A;  1NMD A;  3VA3 A;  3G25 A;  4CZL A;  5I9E B;  3NVK A;  1VSM A;  4LD0 A;  2P5O A;  2BAN A;  3C7N A;  1DKG D;  2P9S B;  3L3U A;  4K25 A;  1MWM A;  2Q3S A;  3PLA A;  3DXK A;  3LAN A;  3O5B A;  1S1U A;  1NK5 A;  4YDU C;  3RRG A;  4QS7 A;  4R79 A;  3QEX A;  3NGZ A;  4CFD A;  4B9Q A;  3T3F A;  5JLF A;  1NJW A;  1EQY A;  1YIJ N;  2QWM A;  1WUA A;  3KTQ A;  1QTM A;  1VSL A;  2F8T A;  4CK2 A;  1BGX T;  5FPE A;  3CC4 N;  1HPM A;  3OBW A;  3DOL A;  4K43 A;  3CJC A;  1ATN A;  4G1Q A;  4FK0 A;  1RT4 A;  1BU6 O;  1TKX A;  4XH4 A;  1NK7 A;  5BN8 A;  4H4O A;  4DV7 K;  4H8K A;  4HUG A;  1E4G T;  1RIL A;  3TAB A;  2XY8 A;  4B3T K;  4BDY A;  3PX6 A;  1U4B A;  3OJU A;  4O8U A;  3CJ1 A;  5F0X A;  1BUP A;  2HMP A;  4CJE A;  4CK1 A;  4CFB A;  3MX5 A;  4FM2 A;  3DOK A;  4YOR A;  1VRU A;  4NYN A;  2VWK A;  1U47 A;  1KLM A;  3NH1 A;  4DTM A;  4DSK A;  4FLZ A;  3K57 A;  3QBW A;  3NHG A;  3NF6 A;  2F4V K;  1NMN A;  4J2D A;  3H08 A;  1RCH A;  1Z26 A;  2WUS A;  4M3T A;  4CJ4 A;  1NK0 A;  5FRN A;  2QWR A;  2P9I A;  1SL2 A;  4KB1 A;  4CJ3 A;  4DS4 A;  2HBM A;  2FF6 A;  4FJX A;  5BPM A;  3WNF A;  2HOE A;  4X66 K;  3C6H A;  3BEX A;  5JS1 A;  3NAE A;  1JLQ A;  2JLE A;  1SKS A;  1TK0 A;  2D0P A;  3AA4 A;  1VSJ A;  3QET A;  5AJ3 K;  3TTF A;  1ILY A;  3T19 A;  3HPO A;  4N41 A;  4FJ9 A;  4BRI A;  3VGM A;  4JKF A;  4B3S K;  4IDK A;  2B5J A;  2XRI A;  1FJG K;  4YOT A;  4M63 C;  3A5L C;  1D9D A;  4DV2 K;  3IRX A;  4LH5 A;  4NCA A;  3AA3 A;  5CE3 A;  3HO1 A;  2WC9 A;  4U7B A;  5KGW A;  3OTO K;  1ZBF A;  4WFA L;  1KLN A;  3PIO L;  2NRZ A;  4EAH D;  5C2D A;  3TR8 A;  1IKV A;  1XMQ K;  3CJA A;  1HMV A;  4OKE A;  4M45 A;  3SUQ A;  3O80 A;  3O6W A;  3GOI A;  4JKA A;  1DTQ A;  2LSN A;  4FZZ A;  3DAW A;  4OVL A;  1W2B M;  3AO5 A;  5F1X A;  4DS5 A;  5HP1 A;  1XUP O;  1RDA A;  3IFR A;  4GVM A;  5HRP A;  1YUW A;  4DWI A;  2DFH A;  2F9W A;  4E7L A;  1KAY A;  1IBL K;  5HL7 L;  1JXE A;  1P90 A;  3P83 D;  4DFM A;  1GOC A;  1MWK A;  1J6Z A;  1JJ2 M;  4YY3 K;  3CJ9 A;  2ZQB A;  4DSJ A;  4AHT A;  4AM7 A;  2Y1J A;  1ASV A;  1VQO N;  4DQI A;  3SZ2 A;  1I94 K;  1XC3 A;  1CXQ A;  4BC4 A;  4LF7 K;  3IUC A;  1IKY A;  4FWQ A;  2GTD A;  3SMS A;  4I7F A;  2IC3 A;  4I9L A;  1FXX A;  2NNW A;  3CI5 A;  2JWK A;  4BWM A;  3ZSR A;  4DU3 A;  3T1H K;  3TI0 A;  4KHU A;  1KAZ A;  3H1Q A;  3NGY A;  4KV8 A;  1KSP A;  1HLU A;  4JS5 A;  3K9J A;  3U9Z A;  4OLB A;  1D9F A;  4CBX A;  1VSE A;  4FZX C;  4KKO A;  2P5G A;  2QTD A;  2ZM6 K;  4YDU A;  5AQH A;  2BE2 A;  3OYH A;  3OA9 A;  4DCH A;  4BRM A;  1QVF M;  5BR8 K;  1TAU A;  4M3U A;  4RW7 A;  5B8H A;  4GW6 A;  3OW2 M;  1Y97 A;  2GWJ A;  4QOZ B;  3VQC A;  4WCE L;  1SUQ A;  1MU2 A;  3AO4 A;  1HR0 K;  4B1Z A;  3SQ0 A;  1EWQ A;  3ASM A;  2DFE A;  3J8A A;  4FJN A;  2DPN A;  1ASW A;  1JLF A;  2P9I B;  5JVG L;  2Z1H A;  2NRT A;  4H0P A;  4FLX A;  3VQ8 A;  4DSE A;  4OLA A;  1U45 A;  3WXK A;  3KLH A;  3AVJ A;  3C94 A;  3LDP A;  3DRR A;  4YOU A;  1VQK N;  4CEA A;  1NKC A;  2WOM A;  4FPB A;  4LF8 K;  2YHW A;  3CCE N;  5KTQ A;  2KZZ A;  2W6L A;  5AQM A;  2Z1I A;  4BC5 A;  3QEW A;  1UA0 A;  3HPH A;  2O8D B;  1WB9 A;  4BR5 A;  3DM2 A;  4NLB A;  4DFK A;  2KZM A;  4M41 A;  1RBV A;  1RBS A;  3MXJ A;  4CEO A;  2ASO A;  2W41 A;  3O8M A;  5CZ2 A;  3EZ5 A;  3M8R A;  2Q36 A;  4KHP K;  1LW2 A;  2GUP A;  4WE1 A;  4WF9 L;  4IOA L;  2ZF5 O;  1SAZ A;  2BDP A;  4F3T A;  1HYV A;  3ENO A;  4U67 L;  3CCU N;  3V9W A;  4O55 A;  2AJQ A;  3KVG A;  5A2Q O;  3U3Y A;  4C8L A;  2OZM A;  5CY4 A;  2ZGY A;  4JI5 K;  5JLH A;  2F8S A;  4UQG A;  4NCG A;  5LL6 Z;  2E6L A;  4LSN A;  3IDH A;  3H45 C;  3MWT A;  2E6M A;  3ZYY X;  1FKO A;  4NXM K;  1C1B A;  3O9U A;  4WQ4 C;  3W3D A;  5TKW A;  4DTO A;  3KLE A;  2HHT A;  3I33 A;  2B6A A;  5IWA K;  3OJS A;  5JVH L;  2AP1 A;  5AQF A;  3H3O B;  5M1F A;  3JYT A;  4IWV A;  4BRQ A;  4CED A;  1XWL A;  2D4W A;  3MK6 A;  2VWB A;  4CZJ A;  1L3S A;  4FJI A;  2YHB A;  4CF2 A;  2HF3 A;  2KFZ A;  3WNE A;  4I9Q A;  1IV0 A;  3V9Z A;  4FJ7 A;  3DWL A;  4M3X A;  4DFP A;  4CFA A;  5AZJ B;  1JLC A;  4Z4F A;  3CHW A;  1YAG A;  5C25 A;  4DR2 K;  4Z4I A;  3BY5 A;  1NG9 A;  1BL3 A;  4RWT A;  4J2E A;  4CJQ A;  3ENB A;  4ZHR A;  4MDB A;  5H1S Q;  4KAZ A;  1RDU A;  3VQ4 A;  3AVF A;  2YI1 A;  3U6F A;  3LAK A;  4CGF A;  2CH5 A;  3LDO A;  3LM2 A;  3MN7 A;  1H1V A;  1P8Z A;  3KWI A;  4FO0 A;  1R0A A;  4BR9 A;  4CJL A;  1W7A A;  4X62 K;  1WOQ A;  4BRP A;  1NGJ A;  3L2U A;  5GAG P;  3MXI A;  2IAJ A;  4M3Y A;  1KTQ A;  4KHQ A;  2G8W A;  4H0O A;  1ITG A;  2HBJ A;  3KLG A;  5SWM A;  4DV0 K;  4M3W A;  1JXB A;  3IKM A;  4H03 B;  3ZSX A;  3VTH A;  3ZX0 A;  5C42 A;  4BRG A;  4JKC A;  4XIU A;  3K5O A;  3PX4 A;  3CFO A;  1D4X A;  4KTW A;  3OYG A;  3DMJ A;  1NJY A;  3VQ9 A;  3DXM A;  5M1P A;  3QES A;  4PWD A;  2YHX A;  2WTU A;  3ZSY A;  4B1Y B;  1BI4 A;  4HVJ A;  1TV6 A;  3EE9 A;  4BAC A;  1IKW A;  2YNF A;  1BIZ A;  3NF7 A;  3BZC A;  5LY3 A;  4FPA A;  4FLW A;  3TPQ A;  1QZ5 A;  2KW4 A;  3FZM A;  3LPT A;  2P9S A;  1WSG A;  2Q0U A;  4Q5V A;  5HRN A;  3NF8 A;  4BRL A;  2HF4 A;  1TK5 A;  4N76 A;  4A61 A;  1SQK A;  1RT7 A;  3QIO A;  2IVP A;  5AZI B;  1BCM A;  4C1N I;  3THY A;  3CET A;  1BIS A;  1TKT A;  1TKZ A;  3PY8 A;  2FC0 A;  3HRG A;  4IJN A;  3D0P A;  4EFH A;  2CH6 A;  4MQ3 A;  2YNG A;  4M3R A;  4DTX A;  4I2P A;  2QI2 A;  1HKG A;  3VET A;  3QO9 A;  1NKB A;  3LPU A;  4ICL A;  3J80 O;  4LF5 K;  4X64 K;  4YOX A;  3AVH A;  5EXW A;  1UWB A;  1X3M A;  4E7K A;  3CC2 N;  3PX0 A;  1KVC A;  3VGK A;  1HJR A;  2YX6 A;  2FSJ A;  5EOY A;  3MN9 A;  4CJ5 A;  3P31 A;  2G8U A;  3OYD A;  1J9A A;  1NGG A;  2HVI A;  5BRF A;  3DLB A;  4E1J A;  1OH6 A;  4CJK A;  3HTV A;  4CER A;  3GG4 A;  2OAN A;  3TTC A;  2GX9 A;  3E1Y A;  3H3N O;  4KHS A;  3KK1 A;  2PYJ A;  1YVU A;  3WNG A;  4W5Q A;  3QIP A;  3JS6 A;  4IG0 A;  3I0R A;  3EY1 A;  3U3G A;  5AQN A;  4CGI A;  1GLB G;  4A5A A;  4E89 A;  4KH4 A;  1DEJ A;  1S9E A;  2VG7 A;  3K2P A;  3VPZ A;  2XY6 A;  4JI1 K;  1HNV A;  3WQT A;  1DT9 A;  5EX5 A;  4CJU A;  1RT6 A;  1S6Q A;  3V81 A;  1A5W A;  4BWJ A;  1SL1 A;  2OCE A;  1L3T A;  1YJN N;  1ZBS A;  4LF9 K;  3NGI A;  4WQ4 A;  3RTV A;  5BRE A;  5KPR A;  1VSK A;  3DYA A;  1VQ5 N;  2IDO A;  4FWM A;  2IOC A;  2QWN A;  3C65 A;  4CEE A;  4H0V B;  1YT3 A;  1SZ2 A;  3BGR A;  4BRH A;  2P9P B;  1S1T A;  3O1B A;  1Q18 A;  4DQ8 A;  4DR5 K;  3S3N A;  1XHZ A;  3VQP A;  1NM1 A;  3DLH A;  4A59 A;  3KK7 A;  1MDU B;  4OKK A;  3AVC A;  1U6Z A;  1GOB A;  1HNI A;  2OYQ A;  4O44 A;  3ZSO A;  1S1W A;  5M1K A;  1YJW N;  3QDK A;  4QS9 A;  1Y64 A;  3UKR B;  1VQ7 N;  4W5R A;  3J7Z O;  3AVG A;  3V1R A;  4A2A A;  3DXM B;  4PQU A;  4LC9 B;  5AQV A;  4W5O A;  4DLG A;  3VQA A;  2E2P A;  3EE8 A;  3OS2 A;  3CQ8 A;  4WQ5 C;  1XNR K;  2ZE2 A;  3JSM A;  3SQ4 A;  4JKD A;  4QS8 A;  5K14 A;  5AQS A;  3F2K A;  3RSE A;  2OPS A;  1VQ9 N;  3KIO A;  1BCO A;  3SAH A;  4B1X B;  3HJF A;  2HHU A;  3A2F A;  3TSQ A;  1I3A A;  3LP2 A;  3O9Q A;  3KWG A;  3QFU A;  1X1P A;  3OYC A;  3V9S A;  2E4L A;  4DKW A;  1W0H A;  1EWR A;  4CF0 A;  1TVR A;  1WLJ A;  3O9S A;  1YIT N;  3RMC A;  3THY B;  1NJZ A;  1ASU A;  5CYM A;  1IG9 A;  3FGU A;  2FBX A;  1EKE A;  5TKY A;  3KZB A;  5JS2 A;  1S9G A;  3AAR A;  4AM6 A;  3HOT A;  3SPZ A;  2G8H A;  1IBM K;  1RBT A;  4CJR A;  3C0B A;  2Q1N A;  3THX A;  1QQN A;  3EL2 A;  3HM8 A;  3LM9 A;  1UA1 A;  4YOY A;  3MX2 A;  3HST B;  1E4F T;  3E66 A;  3L3V A;  4NB4 A;  1YJ9 N;  4FM1 A;  4Q0B A;  5AQO A;  2V52 B;  3HK2 A;  2KQ2 A;  5C15 A;  1NK8 A;  2VGN A;  3O4Q A;  4MDA A;  4HWI A;  1SV5 A;  1IO2 A;  3FFI A;  3V1Q A;  5ELZ A;  3O4N A;  3B6O A;  1WN7 A;  2OTJ N;  3RMD A;  3AVN A;  1YTA A;  2Q0R A;  3EN9 A;  3P39 A;  5T7B A;  1TL1 A;  2Q97 A;  2QK9 A;  3AVB A;  4BE0 A;  3SUP A;  4CJ7 A;  4A62 A;  3B6P A;  1NLV A;  1KCF A;  1QZ6 A;  1V4T A;  4LH4 A;  4DV1 K;  3I0S A;  1KRP A;  1M90 O;  4PKG A;  3RVC A;  4FJM A;  1QHT A;  2FSN A;  3SJH A;  1ZXO A;  4DU4 A;  2BGG A;  1LOT B;  1GLD G;  3DLG A;  1RBR A;  1T6C A;  2E88 A;  3VQB A;  3SNN A;  1GOA A;  2GEL A;  4CZI A;  2HHS A;  4WFN L;  4C8M A;  2O8D A;  3BF1 A;  4BC2 A;  1UOC A;  1W9H A;  4MO5 A;  2IGI A;  4PL8 A;  4NLC A;  4BVP A;  2O8E A;  4IO8 A;  2PY5 A;  1JKH A;  3R6M A;  5GAD P;  1S5J A;  3NMU A;  2QWL A;  4DMN A;  3RRH A;  4AQY K;  2GUI A;  1VQN N;  2YNH A;  3E9P A;  3VEY A;  4JS4 A;  2ATQ A;  3Q7C A;  3EO3 A;  4LY7 A;  1GLF O;  3ATV A;  4BGA A;  1QVG M;  2P9U B;  5MLC Q;  2VGM A;  4IG3 A;  1RDC A;  3VQ5 A;  4AHV A;  3AGR A;  4CIE A;  3FZK A;  2HBL A;  3HP6 A;  2YJE A;  1M1K O;  1X9S A;  3ZT3 A;  4GMJ B;  3DRS A;  1XI1 A;  4BC3 A;  5E84 A;  1TGO A;  4KBO A;  4R5P A;  3N4P A;  3FLC O;  1REV A;  3RSE B;  1KVA A;  3MN6 A;  2HHW A;  4DTP A;  4B8A B;  3ZT1 A;  1C6V A;  4LF6 K;  1C0F A;  3FR0 A;  1YHQ N;  5FRO A;  3AVI A;  2A1S A;  4RG8 A;  1CZA N;  3SUO A;  4DTR A;  2UXB K;  5AZJ A;  1VQL N;  3HL8 A;  4HUE A;  3P38 A;  4PL7 A;  4FLY A;  1NGI A;  2UU9 K;  4B9T A;  4DF8 A;  4H5N A;  4ELU A;  3NBP A;  4RW4 A;  1FKP A;  2GEM A;  3ZSQ A;  3QB0 A;  2QKK A;  2OA8 A;  2QWP A;  1T7P A;  3UKU B;  1JL2 A;  4BR2 A;  3CMA N;  3C6T A;  3THX B;  4WQ5 A;  2A5X A;  5BN9 A;  1RDW X;  3VEO A;  3VMF B;  1JLA A;  1SS6 A;  1ZC6 A;  4OPJ A;  3SPY A;  5KRT A;  3IG1 A;  2EHG A;  4QAG A;  4CHY A;  4JNE A;  5BRD A;  1KXP A;  5KPZ A;  3K0S A;  3CQY A;  4YHH K;  4JI7 K;  2D0O A;  2UXD K;  4FWO A;  2E1Y A;  5C10 A;  4CBW A;  3D2F A;  5C12 A;  1ZYQ A;  1JCG A;  1QSL A;  4JV5 K;  1VQ4 N;  5KGX A;  3UE5 A;  4RW9 A;  2HMI A;  3MED A;  3R1X A;  4N56 A;  4AHS A;  3EEQ A;  4KPY A;  1RFQ A;  4E19 A;  4KO0 A;  2A40 A;  5D3G A;  1HYS A;  1K8K A;  1T6D A;  1N8R O;  4KI4 A;  2G8K A;  3V9U A;  2ZJQ L;  3QIN A;  3VEW A;  1W97 L;  2V51 B;  3TSU A;  3NH2 A;  2ITG A;  4BRN A;  5GAE P;  1JL1 A;  5J2M A;  1NJX A;  1S6P A;  3MEC A;  3RR7 A;  3WQU A;  2QXF A;  5BRH A;  2FBV A;  3AGK A;  1S22 A;  2ZJP L;  4ELT A;  1BG3 A;  4M42 A;  3E01 A;  1TAQ A;  1OH7 A;  4B3M K;  3GDQ A;  2YHA A;  1X9M A;  4KRE A;  3O3H A;  2HB5 A;  2HHX A;  1IJJ A;  1WSJ A;  3QML A;  5CZ1 A;  3VA0 A;  3DLK A;  3OS1 A;  2VQF K;  3M8Q A;  4JRP A;  2O8E B;  5AZI A;  1U49 A;  4K8Z A;  1X9J A;  1E3M A;  4CIF A;  2HHQ A;  4OX9 K;  4JLH A;  4F2R A;  2YKM A;  5FPD A;  3LDQ A;  3VF6 A;  4BGB A;  3FE1 A;  4CHZ A;  3ZEU B;  2VG5 A;  1Q9Y A;  3U9D A;  4FWS A;  4H5V A;  5HLF A;  3AVA A;  2XO7 A;  3ZSW A;  5DM6 L;  2P9L B;  3L2W A;  1C1C A;  4GV3 A;  3TAG A;  4CJS A;  3HXM A;  3U4L A;  5CHI A;  3LDN A;  4IZ9 A;  4CVN E;  3OS0 A;  4CHN A;  2O4I A;  2X6S A;  3J81 O;  1HNW K;  5DK5 A;  4EZ6 A;  1IG8 A;  3CCL N;  3AO3 A;  3CCQ N;  3CCS N;  5I42 A;  4Z4H A;  3PO4 A;  2W42 A;  1VHX A;  2O8B B;  4IFE A;  5AQX A;  2Z1G A;  3A8Y A;  2VG6 A;  3D6R A;  4L8R B;  1CZB A;  2D0A A;  2DFF A;  4Z4E A;  1NK6 A;  1K8A O;  3WEE B;  1HQU A;  3GE1 A;  1WSI A;  2FBT A;  3ATU A;  5HRR A;  4CD1 A;  3VOV A;  4EHU A;  2GWK A;  2RHK A;  4J2A A;  1NJI O;  3F73 A;  2OPQ A;  4CJW A;  2KKZ A;  1XMO K;  2V7Z A;  2E2Q A;  4X65 K;  4F3O A;  4IKF A;  3M1F A;  4CEZ A;  3CCM N;  4JK8 A;  4GV9 A;  5BPN A;  3VEN A;  5HRS A;  2YKN A;  3KK2 A;  3JXU A;  4BRO A;  3AO1 A;  5AFU A;  4CZK A;  4FLV A;  3PO5 A;  3I8D A;  3ZX3 A;  1S1V A;  4B1V A;  1NOZ A;  1NGC A;  2P9P A;  3I56 N;  5J2N A;  3S9H A;  1G15 A;  1L3V A;  3NVM A;  4BDP A;  2RN2 A;  2E20 A;  1Q9X A;  4B9M A;  4B08 A;  3P5J A;  3LDL A;  4E7H A;  4JRQ A;  3D2F B;  3DLR A;  4EHT A;  1EP4 A;  3CM6 A;  4O5F A;  4DR6 K;  4CJF A;  5FDL A;  1IBK K;  5FPN A;  3HSC A;  1BHL A;  3D7E O;  1VRT A;  3O9R A;  3SK3 A;  1XNQ K;  2DTU A;  3SV4 A;  3UKR A;  3CXC M;  3TWH A;  4ID5 A;  3V9X A;  1K8K B;  3VN5 A;  3VF2 A;  3CJ7 A;  4BR0 A;  4ZTF A;  4BRD A;  4F4K A;  4AIL C;  4F9O A;  3ZX2 A;  4KHW A;  1TL3 A;  3KJV A;  2PZS A;  3LAM A;  4DV5 K;  2D0B A;  4E3S A;  1WSE A;  1A5V A;  1B9D A;  5I3U A;  4B9N A;  3CCJ N;  3VQD A;  1CXU A;  2VYP A;  5KI6 A;  4NXN K;  2P9N A;  3OYJ A;  1TKD A;  1VSH A;  4GY2 B;  3GL1 A;  2AA4 A;  3CM5 A;  4JI0 K;  4M3Z A;  1QQM A;  4CEC A;  3V6D A;  2E2N A;  4C23 A;  1L5U A;  4DHY A;  1K9M O;  1D8Y A;  2A42 A;  3ZSZ A;  3TAR A;  2NLX A;  4JI8 K;  1GLJ O;  3SLC A;  5J2Q A;  3WXM B;  1OH8 A;  4E1N A;  4CHQ A;  4I2Q A;  4LFC K;  4CHP A;  4EP5 A;  1R59 O;  3HVR A;  1B9F A;  4DQR A;  5AQW A;  3SBG A;  2UUB K;  1RT2 A;  3VER A;  4CZF A;  5AQR A;  1JLB A;  2F96 A;  4C8O A;  2A6A A;  3MEE A;  4ZTJ A;  5CR4 A;  3K58 A;  2EWS A;  4CD3 A;  5AQZ A;  4OGE A;  4HTU A;  4Y1D A;  3KKR A;  3VQE A;  3O1W A;  3D2E B;  4FWP A;  1JLE A;  1J53 A;  2P9K B;  4BDZ A;  3PUF A;  1C0G A;  5FPM A;  4KI6 A;  1YF5 L;  4DU1 A;  3ZT0 A;  4MO4 A;  1Q81 O;  1HKB A;  3L8B A;  4E0D A;  1F21 A;  4PKH A;  4C8N A;  3QER A;  1EX4 A;  3TTD A;  3ZSV A;  2UUA K;  2QEX N;  2QWO A;  3DLL L;  1BDG A;  4JK9 A;  1YXQ A;  3LZI A;  1HPZ A;  4BQL A;  3MXM A;  1J5O A;  2BH1 A;  5KRS A;  3DRP A;  4PHT X;  2PBD A;  3OYN A;  3KK3 A;  1UAX A;  4BE2 A;  1IH7 A;  5AQU A;  4E1M A;  5AQK A;  1OKJ A;  3K9K A;  4AHU A;  1V4S A;  4O5B A;  4I6M B;  2OTL N;  1WAJ A;  1VQ8 N;  1Z6R A;  4E7I A;  3OHR A;  3CPW M;  1TK8 A;  5EY4 A;  4DV6 K;  2YJF A;  4YNQ A;  1LAV A;  3SAF A;  2A3Z A;  3S3O A;  4YOW A;  3WXI A;  2QW9 A;  4K0K K;  2QKB A;  3G4S N;  4OKJ A;  1U2V A;  1K6Y A;  1Q7Y O;  3HYF A;  1DLO A;  2D0C A;  1NWK A;  5BR9 A;  1LV5 A;  5HOO A;  4GV6 A;  3HM9 A;  1YI2 N;  1NBW A;  3G71 N;  1VQM N;  1RDD A;  3OBY A;  3FZH A;  3OYI A;  1HNZ K;  2IVN A;  4AHC A;  4KH5 A;  2E2O A;  4BR4 A;  1RTD A;  4QCL A;  3ID8 A;  1NGB A;  5AR0 A;  2P9U A;  3TAF A;  4FYD A;  5C2F A;  1HRH A;  4AF1 A;  3U8X A;  4FSV A;  1WBD A;  5EU7 A;  4A57 A;  4DR1 K;  4ILJ A;  4J8F A;  5LJV A;  3KHY A;  3KLI A;  4CF1 A;  4KHN A;  2ASP A;  4DR3 K;  4B9L A;  3R8E A;  4OPK A;  2PAV A;  5M1Q A;  3CQX A;  1KFS A;  5C24 A;  3P4I A;  5IT9 O;  2HNZ A;  3IMX A;  3UIQ A;  1HYZ A;  2E1Z A;  2P9N B;  1GLL O;  3ITH A;  3O4W A;  4OPH A;  3TSP A;  1BQN A;  4E7J A;  3THV A;  1NOY A;  1Q86 O;  1NGH A;  3JAM O;  4FLT A;  3CD6 N;  2J4R A;  3LWM A;  4EP4 A;  1RTH A;  4ILH A;  3THW A;  3CFR A;  4JK7 A;  5J1E A;  4F8R A;  3P1G A;  3HOS A;  1FW6 A;  4KFB A;  3HVT A;  5F2R A;  3WT0 A;  1KC8 O;  3PSF A;  4YFU A;  2W6K A;  2CGL A;  2NUB A;  4OPA A;  1ATS A;  3LDS A;  3CFP A;  1DTT A;  1BOT O;  1LAW A;  2HST A;  5KQ8 A;  3AVK A;  4FW2 A;  1N32 K;  3UKU A;  3L0Q A;  3L4I A;  2VWJ A;  1VSF A;  2Y1I A;  3E9O A;  5GIO A;  4JKG B;  4DSI A;  4M7Y A;  3M5R A;  5KQD A;  3ULE B;  4N47 A;  4IO9 L;  3T1Y K;  2NRH A;  4PA1 A;  4UY8 O;  3AAQ A;  2KLA A;  1QSY A;  4CBU A;  1LWF A;  4CEF A;  5AQQ A;  1HJO A;  5HBM A;  3A5O C;  1NK9 A;  3SQ2 A;  1C0T A;  2FBY A;  4JD2 A;  4RCH A;  4FLU A;  2ITM A;  2XY7 A;  3L2V A;  1C1A A;  5AQT A;  5AFU H;  4DLE A;  1WSF A;  2QWQ A;  3SUN A;  4KH6 A;  4FJJ A;  3RMA A;  4DQP A;  4HUF A;  3TAQ A;  3B8A X;  4DSL A;  2VCP A;  3O3G A;  2R7Y A;  3ZT4 A;  1VQP N;  4MFB A;  4DR7 K;  4FM0 A;  4BY9 C;  2QM1 A;  3CF5 L;  4CZM A;  4ISG A;  3KD5 E;  4CGJ A;  4MLH A;  4N5S A;  4FVU A;  3O08 A;  4CW7 B;  1G99 A;  4BRC A;  3MN5 A;  2OZS A;  5AQG A;  3OYA A;  1LCU A;  1HX1 A;  5KPT A;  3NCI A;  4HTL A;  4DQQ A;  4B9V A;  1EXQ A;  1VSI A;  3FZL A;  3QNN A;  4CIG A;  4CES A;  1BWF O;  1HQE A;  3PV8 A;  3VF4 A;  1QQC A;  3H1V X;  4O0J A;  4B1U B;  4CEB A;  3SQ1 A;  3T1A A;  1I39 A;  1U2V B;  2XHB A;  3G6E N;  3M3Z A;  3LP1 A;  1ESV A;  4B3R K;  3K59 A;  1N36 K;  5FRM A;  4FZY A;  4BRE A;  3F9K A;  4FWR A;  4JKE A;  3CCV N;  1X3N A;  1HUX A;  3BDP A;  1JLG A;  1RDB A;  3ZEU A;  1KD1 O;  2O4G A;  3IS9 A;  2CGJ A;  4BE1 A;  2FF3 B;  1U48 A;  2P9L A;  2UXC K;  5ADX A;  5CYQ A;  4O0I A;  1NNE A;  3L2Q A;  4JI6 K;  4B3O A;  1OVY A;  1OVQ A;  3M6G A;  3V4I A;  2RF2 A;  3BUZ B;  2Q31 A;  4OO1 J;  1JCE A;  2DY4 A;  4K41 A;  2IIR A;  3M8P A;  4B8C A;  3GBT A;  4BG8 A;  3A5M C;  4CF9 A;  1CLQ A;  4OJR A;  1KVB A;  4BQZ A;  4CHO A;  3OYB A;  3VGL A;  4ILG B;  4FK4 A;  1TUY A;  4CGH A;  4B9S A;  3HPG A;  4LSL A;  4DB3 A;  2O8B A;  4JN4 A;  1NKE A;  3QEV A;  4JKH A;  1BA0 A;  1TUU A;  2D1K A;  3WEE A;  3THW B;  2QXL A;  3MCA B;  3EKS A;  4C1N K;  4DV3 K;  3ULD A;  4V19 S;  1RT5 A;  3HZ6 A;  3C7N B;  1SKR A;  4DSF A;  4KTQ A;  4JI4 K;  5M1N A;  3DXK B;  4H0Y B;  3MMV A;  4O8K A;  1B92 A;  2YCH A;  2O8C A;  3M8S A;  1ZBI A;  4DV4 K;  1MA9 B;  5M1O A;  4AHR A;  3OY9 A;  3A0I X;  3T7Z A;  5E41 A;  1ZBU A;  2XY5 A;  4FOE A;  3F9M A;  2IVO A;  1K73 O;  3S3M A;  1RTJ A;  4Z0U A;  4DQS A;  1A5X A;  4JD2 B;  4IEE A;  5JMV A;  3ISN C;  4A5B A;  4NCB A;  1U04 A;  1T05 A;  1S1X A;  4K42 A;  5FLX O;  1ZBH A;  2P51 A;  4O4G A;  1CZ9 A;  4ISF A;  1T3V A;  3J7Y P;  3L6Q A;  3C6U A;  2HVH A;  3BF3 A;  1T03 A;  2HHH K;  3SYZ A;  4DUZ K;  3BZK A;  1BO5 O;  4IFV A;  4KRF A;  3TU5 A;  3WNH A;  4CZH A;  3MWP A;  4XH5 A;  4JAX A;  4GVE A;  4XH1 A;  3AV9 A;  1NK4 A;  2G8I A;  5DMR A;  3OYM A;  4IOC L;  3WUH A;  3ALY A;  1KQS M;  3OVN A;  4TSX A;  3LP0 A;  4DTU A;  2NRR A;  4ID1 A;  4HCB A;  2I7N A;  1NGA A;  4JI2 K;  3ZET A;  4FWL A;  3LP3 A;  4YOV A;  4CI6 A;  5LJW A;  4BR7 A;  3T69 A;  2ZGZ A;  3LWL A;  3F5T A;  4ELV A;  3QEI A;  1EO1 A;  4BRF A;  3I8B A;  5GIP A;  4DTS A;  2W40 A;  4IBN A;  4DTJ A;  5AQY A;  1Q82 O;  4FJG A;  5C0Y A;  3OYL A;  3G0Z A;  3QFP A;  4NO7 A;  4IFY A;  3CCR N;  3MCP A;  4IOX A;  3PIP L;  1LWC A;  3Q7B A;  2RE2 A;  1ZBL A;  1GLC G;  2RKI A;  5SZT A;  3RWU A;  1SL0 A;  1D5A A;  2ZJR L;  3S41 A;  3K5M A;  2F7T A;  5E26 A;  2D5R A;  4J2B A;  4AH9 A;  1Z05 A;  2NRX A;  3CJB A;  1RBU A;  2NRV A;  3RR8 A;  3UB5 A;  2ASM A;  3RMB A;  3D2E A;  3HP9 A;  1YTU A;  2P9K A;  4B1W B;  2NRW A;  3N4Q A;  3OYF A;  1T8E A;  3SCX A;  5GAH P;  4JEP A;  3KD1 E;  4WYB A;  2X78 A;  1FK9 A;  4G9Z A;  4BVO A;  5HRO A;  3VES A;  4FXD A;  2ETJ A;  5JIC A;  3ZCM A;  2KTQ A;  5DM7 L;  3D45 A;  4JHD A;  4FW1 A;  1VAZ A;  3VQ6 A;  1S72 N;  2B4J A;  3VQ7 A;  3HT3 A;  4LFA K;  3G10 A;  1XQS C;  2E8A A;  4IJA A;  3AO2 A;  4DF4 A;  1Q8I A;  4Y1C A;  3J7A P;  2O8C B;  1GLA G;  3DJC A;  3TAM A;  4I6M A;  4OGC A;  3DI6 A;  1RT1 A;  3BP8 A;  4H5R A;  4CCH A;  2BUP A;  1NGF A;  3CIP A;  1QQO A;  3MDQ A;  3MEG A;  3CG7 A;  3NH0 A;  3I55 N;  1GLE G;  2UUC K;  1SKW A;  2O8F A;  1ATR A;  4KB0 A;  4CK3 A;  4HHT A;  1C0M A;  3C95 A;  4WFB L;  4LF4 K;  2IS3 A;  3CER A;  4BG9 A;  4BRA A;  3ZLJ A;  2P1J A;  3KKS A;  1WSH A;  4ISE A;  2NZT A;  3TAE A;  2YNI A;  3ZT2 A;  1J5E K;  2GV9 A;  4A2B A;  4IDH A;  4FJH A;  1N34 K;  4C8K A;  3AVM A;  1RGI A;  4IEI A;  3VEV A;  4FOI A;  5GIN A;  3O3F A;  2OPR A;  2I7P A;  2OPP A;  4LFB K;  4H4M A;  1HKC A;  3QEP A;  2HHV A;  4MLE A;  2ZD1 A;  1KFD A;  3HI0 A;  2JWL A;  2KHO A;  3E9L A;  3OYK A;  4PY5 A;  3VTI A;  4RW6 A;  2Z1J A;  1TYQ A;  4CFC A;  4FJ5 A;  3DLE A;  1VK0 A;  3K5L A;  3LZJ A;  2QA4 N;  2G8F A;  4CJT A;  3QLH A;  3W0L A;  3SMP A;  5AQL A;  4W5T A;  3R3L A;  5ADX H;  4H5W A;  1RNH A;  3ZET B;  2HNY A;  3AA5 X;  4Z4G A;  1LW0 A;  4FK2 A;  3CC7 N;  3L4Q A;  1DGK N;  3CPE A;  2JGU A;  3SAG A;  2X6N A;  1QSS A;  4Z4C A;  4FJL A;  3QIC A;  4DTN A;  2ZWH A;  4JI3 K;  3LAL A;  2G8V A;  1JCF A;  2FSK A;  1HNX K;  3R9P A;  1J54 A;  3AA2 A;  3NDK A;  3ID6 A;  4RW8 A;  4FCY A;  4FJK A;  1N33 K;  4JKB A;  4JKG A;  4L3Q A;  4K8X A;  1WNS A;  3ULE A;  4IXC A;  4DR4 K;  5BPL A;  3NE6 A;  3C6A A;  4FJ8 A;  4PKI A;  4RTF D;  2PYL A;  1KAX A;  4BRK A;  1RT3 A;  2BTF A;  1X9W A;  3EZW A;  4H5T A;  2KFN A;  1LWE A;  4KHY A;  3KLF A;  3EKU A;  4EIA A;  4EZ9 A;  3FZF A;  3QBX A;  4JHD B;  1VQ6 N;  1BIU A;  4FWK A;  4XEI A;  4JYA K;  5EVZ A;  1WAF A;  3SI6 A;  4NYF A;  3SJJ A;  2YV0 X;  4KTZ A;  1OH5 A;  5AQP A;  1IKX A;  3L2R A;  1YVN A;  2HW3 A;  3AVL A;  1WBB A;  1NGD A;  4W5N A;  3ENH A;  1NU0 A;  1VSD A;  2Q2R A;  4GKJ K;  2A41 A;  4FVM A;  4M7X A;  3VEZ A;  3VEX A;  3A5N C;  4CEQ A;  3H46 O;  4CF8 A;  1EET A;  5AQI A;  1N6Q A;  2GBZ A;  3H6E A;  2WBN A;  4H0T B;  4CGG A;  2O8F B;  2X74 A;  1O1W A;  3TAN A;  4F2S A;  3SBT A;  4CGD A;  3OYE A;  4GKK K;  3HBT A;  4DG1 A;  5AQJ A;  1BA1 A;  2HBK A;  3CME N;  2WFB A;  3O9T A;  2A1R A;  4CZG A; 
#chains in the Genus database with same CATH homology
 2PFU A;  1K8K A;  1QHA A;  1T6D A;  1BWF O;  5GAG P;  1N8R O;  3LL3 A;  2F9T A;  2V7Y A;  4H0O A;  4H0X B;  2ZJQ L;  3VF4 A;  2HBJ A;  3VEW A;  1W97 L;  3H1V X;  2V51 B;  3IKM A;  4H03 B;  4FL9 A;  3TSU A;  4B1U B;  3VTH A;  3ZX0 A;  1U2V B;  4BRN A;  5GAE P;  2H3G X;  1O13 A;  3AAP A;  4BRG A;  3G6E N;  4JKC A;  3M3Z A;  1ESV A;  2FLO A;  4GNI A;  3WQU A;  1D4X A;  1T44 A;  4Y0W A;  5BRH A;  3AGK A;  3WXJ A;  1S22 A;  2ZJP L;  1BG3 A;  3DXM A;  5M1P A;  2YHX A;  3FFK B;  4BRE A;  4B1Y B;  4FWR A;  4JKE A;  3CCV N;  1X3N A;  3GDQ A;  1HUX A;  3EE9 A;  4Z94 A;  1IJJ A;  1TYQ B;  3QML A;  3ZEU A;  1KD1 O;  3AY9 A;  2CGJ A;  2FF3 B;  5LY3 A;  4FPA A;  2UYT A;  3WXL A;  2P9L A;  3TPQ A;  5AZI A;  1QZ5 A;  5ADX A;  1NGE A;  3FZM A;  1X9J A;  2P9S A;  1OVY A;  2Q0U A;  3M6G A;  5FPD A;  2YHY A;  3LDQ A;  3VF6 A;  3BUZ B;  2CGK A;  4BRL A;  2HF4 A;  4BGB A;  3FE1 A;  1S3X A;  2Q31 A;  2FXU A;  3ZEU B;  4CZE A;  4OO1 J;  1JCE A;  4K41 A;  4A61 A;  2IIR A;  4BG8 A;  1SQK A;  3GBT A;  4FWS A;  3U9D A;  4FWN A;  3A5M C;  4H5V A;  1NMD A;  4BQZ A;  5DM6 L;  2IVP A;  3G25 A;  4CZL A;  2P9L B;  5I9E B;  5AZI B;  4C1N I;  3NVK A;  3VGL A;  3C7N A;  3CET A;  1DKG D;  1TUY A;  4ILG B;  4GV3 A;  4BRP A;  4DB3 A;  2P9S B;  4JN4 A;  3U4L A;  4IJN A;  3HRG A;  4K25 A;  1MWM A;  3LDN A;  4IZ9 A;  5CHI A;  4EFH A;  2CH6 A;  3PLA A;  3DXK A;  3O5B A;  4JKH A;  1BA0 A;  1IG8 A;  3CCL N;  1TUU A;  2D1K A;  3WEE A;  2QXL A;  2QI2 A;  3CCQ N;  3MCA B;  1HKG A;  3EKS A;  3CCS N;  4YDU C;  4C1N K;  3VET A;  4QS7 A;  4R79 A;  3HZ6 A;  3C7N B;  4B9Q A;  5JLF A;  4IFE A;  5AQX A;  1EQY A;  3A8Y A;  4YOX A;  5M1N A;  3D6R A;  1YIJ N;  3DXK B;  4H0Y B;  5EXW A;  2QWM A;  3MMV A;  4O8K A;  1X3M A;  2YCH A;  1WUA A;  3CC2 N;  1K8A O;  3VGK A;  3WEE B;  2YX6 A;  2FSJ A;  5EOY A;  3MN9 A;  3P31 A;  1MA9 B;  1NGG A;  3GE1 A;  5M1O A;  5BRF A;  4E1J A;  5FPE A;  3CC4 N;  1HPM A;  3OBW A;  3ATU A;  4K43 A;  3CJC A;  3HTV A;  4CD1 A;  1ATN A;  3A0I X;  3GG4 A;  3VOV A;  2OAN A;  3T7Z A;  2GX9 A;  3E1Y A;  3H3N O;  3TTC A;  4EHU A;  2GWK A;  2RHK A;  1NJI O;  2KKZ A;  1BU6 O;  2V7Z A;  3JS6 A;  2E2Q A;  3F9M A;  2IVO A;  4FOE A;  4XH4 A;  1K73 O;  5BN8 A;  3M1F A;  3CCM N;  4JK8 A;  5AQN A;  4GV9 A;  1GLB G;  5BPN A;  1E4G T;  4A5A A;  4KH4 A;  1DEJ A;  3VEN A;  4JD2 B;  4IEE A;  3VPZ A;  5JMV A;  3JXU A;  4A5B A;  4BRO A;  5AFU A;  4CZK A;  4O8U A;  3CJ1 A;  5F0X A;  3WQT A;  1DT9 A;  5EX5 A;  1BUP A;  2HMP A;  4K42 A;  3MX5 A;  3ZX3 A;  4YOR A;  4B1V A;  1NGC A;  2P9P A;  3I56 N;  4ISF A;  1YJN N;  1T3V A;  1ZBS A;  3NVM A;  3L6Q A;  2E20 A;  3BF3 A;  3QBW A;  4WQ4 A;  5BRE A;  3LDL A;  3D2F B;  4EHT A;  5KPR A;  1BO5 O;  4O5F A;  1VQ5 N;  4FWM A;  3TU5 A;  2WUS A;  3MWP A;  4XH5 A;  2QWN A;  3C65 A;  4CZH A;  4H0V B;  1SZ2 A;  4JAX A;  4BRH A;  2P9P B;  4GVE A;  4XH1 A;  5FPN A;  3HSC A;  3O1B A;  1Q18 A;  3D7E O;  2QWR A;  3O9R A;  4DQ8 A;  2P9I A;  3SK3 A;  4IOC L;  3UKR A;  3WUH A;  2HBM A;  2FF6 A;  3CXC M;  1NM1 A;  5BPM A;  4A59 A;  3KK7 A;  1KQS M;  2HOE A;  1K8K B;  1MDU B;  3C6H A;  3BEX A;  1U6Z A;  2NRR A;  3VF2 A;  2I7N A;  3CJ7 A;  4BR0 A;  1NGA A;  4BRD A;  4F9O A;  3ZX2 A;  3ZET A;  4FWL A;  5M1K A;  1YJW N;  2D0P A;  4YOV A;  3QDK A;  4CI6 A;  1ILY A;  5LJW A;  3TTF A;  4BR7 A;  3T69 A;  2ZGZ A;  4QS9 A;  1Y64 A;  3UKR B;  1VQ7 N;  3F5T A;  4BRI A;  3VGM A;  3CCJ N;  1EO1 A;  3J7Z O;  4BRF A;  3I8B A;  5GIP A;  2W40 A;  4JKF A;  2VYP A;  5AQY A;  1Q82 O;  4A2A A;  3DXM B;  2P9N A;  5C0Y A;  4GY2 B;  4YOT A;  4M63 C;  3A5L C;  3GL1 A;  3QFP A;  4NO7 A;  2AA4 A;  4LC9 B;  5AQV A;  3CCR N;  3MCP A;  2E2P A;  4IOX A;  3PIP L;  3Q7B A;  1QQM A;  2RE2 A;  1GLC G;  2E2N A;  4C23 A;  3EE8 A;  4DHY A;  4WQ5 C;  1K9M O;  2A42 A;  5CE3 A;  2WC9 A;  2ZJR L;  4U7B A;  4JKD A;  4QS8 A;  3S41 A;  2F7T A;  2NLX A;  5E26 A;  1GLJ O;  5AQS A;  3SLC A;  3F2K A;  4WFA L;  3RSE A;  3WXM B;  3PIO L;  1Z05 A;  1VQ9 N;  2NRX A;  3CJB A;  2NRV A;  3SAH A;  4B1X B;  3UB5 A;  2ASM A;  1R59 O;  3TSQ A;  2NRZ A;  3D2E A;  3KWG A;  3O9Q A;  3QFU A;  4EAH D;  5C2D A;  5AQW A;  3SBG A;  2P9K A;  4B1W B;  2NRW A;  4DKW A;  3N4Q A;  5GAH P;  3VER A;  3CJA A;  3O9S A;  4JEP A;  4CZF A;  5AQR A;  1YIT N;  4WYB A;  3O80 A;  3O6W A;  2A6A A;  5CR4 A;  3GOI A;  4JKA A;  4G9Z A;  3FGU A;  4BVO A;  2EWS A;  5TKY A;  3KZB A;  5AQZ A;  4CD3 A;  3DAW A;  3VES A;  1W2B M;  3AAR A;  4AM6 A;  3HOT A;  5F1X A;  5JIC A;  1XUP O;  3IFR A;  3D2E B;  3O1W A;  4FWP A;  1YUW A;  5DM7 L;  2F9W A;  2P9K B;  4JHD A;  1KAY A;  1C0G A;  1VAZ A;  1S72 N;  3C0B A;  2Q1N A;  5FPM A;  1P90 A;  5HL7 L;  1YF5 L;  1QQN A;  1MWK A;  4MO4 A;  1Q81 O;  1HKB A;  1J6Z A;  3EL2 A;  3HM8 A;  3LM9 A;  1JJ2 M;  4PKH A;  4YOY A;  1XQS C;  2E8A A;  3CJ9 A;  4IJA A;  3MX2 A;  4AM7 A;  1E4F T;  3TTD A;  3E66 A;  4NB4 A;  1VQO N;  1YJ9 N;  2QEX N;  2QWO A;  3DLL L;  1BDG A;  4JK9 A;  1GLA G;  3DJC A;  5AQO A;  2V52 B;  1XC3 A;  1YXQ A;  4I6M A;  4BQL A;  4BC4 A;  5C15 A;  3IUC A;  4FWQ A;  2BH1 A;  2GTD A;  3SMS A;  3BP8 A;  4H5R A;  2PBD A;  4PHT X;  2VGN A;  2BUP A;  1NGF A;  4MDA A;  4HWI A;  3CIP A;  1QQO A;  2NNW A;  3CI5 A;  2JWK A;  3MDQ A;  5AQU A;  3I55 N;  1GLE G;  5AQK A;  1ATR A;  1KAZ A;  1OKJ A;  3H1Q A;  3K9K A;  5ELZ A;  1HLU A;  3K9J A;  4WFB L;  3U9Z A;  3CER A;  1V4S A;  4CBX A;  2OTJ N;  4BG9 A;  4I6M B;  4BRA A;  2OTL N;  2Q0R A;  3EN9 A;  1VQ8 N;  3P39 A;  1Z6R A;  3OHR A;  2QTD A;  4ISE A;  5EY4 A;  2NZT A;  2Q97 A;  3CPW M;  4YDU A;  5AQH A;  4CJ7 A;  2YJF A;  3OA9 A;  4A62 A;  4DCH A;  4BRM A;  4A2B A;  1NLV A;  4IDH A;  1QVF M;  3SAF A;  1QZ6 A;  2A3Z A;  1V4T A;  4YOW A;  3WXI A;  2QW9 A;  3G4S N;  1U2V A;  5B8H A;  1RGI A;  1Q7Y O;  4IEI A;  1M90 O;  4PKG A;  4FOI A;  3RVC A;  3VEV A;  5GIN A;  3OW2 M;  2FSN A;  1NWK A;  2I7P A;  3SJH A;  5BR9 A;  5HOO A;  4GV6 A;  2GWJ A;  1ZXO A;  4WCE L;  1HKC A;  1YI2 N;  1NBW A;  4MLE A;  3G71 N;  3HI0 A;  1VQM N;  4B1Z A;  1LOT B;  1GLD G;  2JWL A;  2KHO A;  3E9L A;  3OBY A;  3FZH A;  1T6C A;  2E88 A;  2IVN A;  4KH5 A;  2E2O A;  2GEL A;  3VTI A;  4BR4 A;  3J8A A;  4CZI A;  2DPN A;  4WFN L;  1VQ6 N;  1TYQ A;  3ID8 A;  1NGB A;  3BF1 A;  4BC2 A;  4MO5 A;  2P9I B;  5AR0 A;  5JVG L;  4H0P A;  2NRT A;  4PL8 A;  2QA4 N;  2P9U A;  4NLC A;  3WXK A;  4BVP A;  4IO8 A;  5C2F A;  3R6M A;  5GAD P;  3NMU A;  2QWL A;  3W0L A;  4AF1 A;  3U8X A;  3LDP A;  3SMP A;  4FSV A;  5AQL A;  4A57 A;  4YOU A;  1VQK N;  3R3L A;  5ADX H;  4H5W A;  1VQN N;  4ILJ A;  4FPB A;  3ZET B;  3E9P A;  2YHW A;  4J8F A;  3VEY A;  3KHY A;  5LJV A;  3CCE N;  5AQM A;  4BC5 A;  3Q7C A;  3EO3 A;  2ASP A;  1GLF O;  4NLB A;  3ATV A;  4BGA A;  4BR5 A;  1QVG M;  3CC7 N;  3L4Q A;  1DGK N;  2P9U B;  3R8E A;  5MLC Q;  2VGM A;  2PAV A;  5M1Q A;  3CQX A;  3CPE A;  3SAG A;  3P4I A;  2ASO A;  2W41 A;  3IMX A;  3O8M A;  2E1Z A;  2P9N B;  3AGR A;  1GLL O;  4OPH A;  3O4W A;  2Q36 A;  3TSP A;  3FZK A;  2GUP A;  2HBL A;  4WF9 L;  3QIC A;  2YJE A;  1Q86 O;  1M1K O;  1NGH A;  2ZWH A;  4IOA L;  2ZF5 O;  3CD6 N;  2J4R A;  1SAZ A;  1JCF A;  4BC3 A;  4ILH A;  3ENO A;  2FSK A;  5E84 A;  4KBO A;  3R9P A;  4U67 L;  4JK7 A;  3N4P A;  3CCU N;  3ID6 A;  3HOS A;  3FLC O;  3KVG A;  4JKB A;  4JKG A;  3RSE B;  4L3Q A;  5F2R A;  3WT0 A;  3MN6 A;  1KC8 O;  3ULE A;  4IXC A;  2ZGY A;  5JLH A;  2CGL A;  4OPA A;  1ATS A;  5BPL A;  1BOT O;  2HST A;  1C0F A;  3C6A A;  3FR0 A;  3IDH A;  3H45 C;  5KQ8 A;  1YHQ N;  4PKI A;  3MWT A;  4RTF D;  3ZYY X;  3UKU A;  1KAX A;  1CZA N;  3L0Q A;  3L4I A;  3O9U A;  4WQ4 C;  4BRK A;  2BTF A;  3W3D A;  3EZW A;  4H5T A;  5TKW A;  3I33 A;  3E9O A;  5AZJ A;  5GIO A;  1VQL N;  3EKU A;  4EIA A;  5JVH L;  2AP1 A;  4JKG B;  5AQF A;  4M7Y A;  3M5R A;  3FZF A;  3H3O B;  5KQD A;  5M1F A;  3QBX A;  3P38 A;  3ULE B;  4PL7 A;  1NGI A;  4IO9 L;  2NRH A;  4IWV A;  4UY8 O;  3AAQ A;  4BRQ A;  4H5N A;  2KLA A;  4CBU A;  2GEM A;  2D4W A;  4JHD B;  4FWK A;  3MK6 A;  3QB0 A;  4XEI A;  2VWB A;  4CZJ A;  5AQQ A;  5EVZ A;  1HJO A;  2HF3 A;  2QWP A;  3A5O C;  3UKU B;  4BR2 A;  3CMA N;  4WQ5 A;  3DWL A;  2A5X A;  4JD2 A;  5AQP A;  4RCH A;  5BN9 A;  5AZJ B;  1YVN A;  1RDW X;  3VEO A;  3VMF B;  3CHW A;  2ITM A;  1YAG A;  1SS6 A;  1ZC6 A;  1NGD A;  3ENH A;  5AQT A;  2Q2R A;  4JNE A;  5AFU H;  5BRD A;  2A41 A;  1KXP A;  2QWQ A;  5KPZ A;  4RWT A;  4KH6 A;  4M7X A;  3ENB A;  4MDB A;  3VEZ A;  3VEX A;  3A5N C;  5H1S Q;  3H46 O;  3B8A X;  2VCP A;  3CQY A;  1RDU A;  5AQI A;  2YI1 A;  1VQP N;  2D0O A;  3H6E A;  4BY9 C;  4FWO A;  2WBN A;  2E1Y A;  2QM1 A;  5C10 A;  3CF5 L;  4CZM A;  4ISG A;  3D2F A;  4H0T B;  2CH5 A;  4MLH A;  4CBW A;  3LDO A;  3LM2 A;  5C12 A;  3MN7 A;  1JCG A;  4FVU A;  1H1V A;  1P8Z A;  3KWI A;  3O08 A;  1G99 A;  4FO0 A;  1VQ4 N;  3UE5 A;  3SBT A;  4BRC A;  3MN5 A;  5AQG A;  3R1X A;  1LCU A;  4BR9 A;  1RFQ A;  3HBT A;  5AQJ A;  1BA1 A;  2HBK A;  3CME N;  2A40 A;  1HX1 A;  2WFB A;  3O9T A;  5KPT A;  4HTL A;  1WOQ A;  4CZG A;  1NGJ A;  3FZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...