3RVCA

Effector domain of ns1 from influenza a/pr/8/34 containing a w187a mutation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
118
structure length
118
Chain Sequence
ASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEANDNTVRVSETLQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Conservation of a crystallographic interface suggests a role for beta-sheet augmentation in influenza virus NS1 multifunctionality.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Protein binding
total genus 32
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3rvcA00
4OPAA 3O9SA 2RHKA 3O9TA 3P39A 3P31A 4OPHA 3EE9A 3KWIA 3OA9A 3EE8A 3L4QA 3O9QA 3P38A 3F5TA 3O9UA 3D6RA 2KKZA 3O9RA 3M5RA 3KWGA 3RVCA 2GX9A
chains in the Genus database with same CATH superfamily
2V51B 4BVOA 4DV2K 3K0SA 4O0JA 1N6QA 3ISNC 4H4OA 5AQLA 1XI1A 1YIJN 4FWQA 3QMLA 5JICA 1IG8A 3SQ0A 1XUPO 4ID5A 1YHQN 4RW8A 3C6HA 1RTHA 3TAEA 3VN5A 3D45A 2RE2A 4LF7K 1NK0A 5AZJA 3AO3A 4FJHA 3P5JA 4OVLA 4JHDA 2HBJA 2Q36A 2F4VK 4HWIA 4DV6K 5AFUH 4WFNL 4GY2B 3VQ7A 3C6UA 4FYDA 1C0TA 5CE3A 3LZIA 4LF5K 4BG8A 3M8RA 4B3OA 3D7EO 2UUBK 2W6KA 1D5AA 3PY8A 2UU9K 3MX2A 2A5XA 2FBTA 3ZSYA 3DOKA 1NJIO 1TK5A 5KPRA 3CERA 3MCPA 1VQ4N 3EYZA 4FK4A 2X74A 4OPJA 4FWRA 5AZIA 4CJPA 3IUCA 2D1KA 3EZWA 3R8EA 3OTOK 4JI5K 1YITN 3D2FB 3TU5A 1Q7YO 4HTUA 4CEFA 1HJOA 4HUGA 1SL1A 5BPNA 1MA9B 4FLWA 1XC3A 3VENA 1U48A 4OLBA 3KWGA 1GLCG 2FF3B 1EP4A 2O8BB 3SMSA 4OGCA 3VF4A 4DB3A 5KRTA 3J7YP 3HO1A 2O8CA 1IKVA 1DGKN 2YHXA 4ILGB 3LANA 3SV3A 2F7TA 4PKIA 3VQ4A 4Z4HA 1NGGA 3NF6A 1NGAA 2B6AA 1GLBG 4YDUA 1P8ZA 2QW9A 3DLKA 1LAVA 5TKYA 1VQMN 4Z4CA 3VEOA 4B3MK 3C0BA 3M1FA 5BPLA 2P9NB 4BRMA 3HP9A 1HKBA 4FWNA 4N5SA 3IAYA 1KFDA 3ZSVA 4J2BA 3WNHA 4B1YB 4C1NI 3O3GA 1WB9A 1VRTA 3OJSA 4DR6K 3LDNA 3VQ9A 4ELUA 4DUZK 4FM0A 1D8YA 1OVQA 1RTIA 3K5OA 4DTSA 3IFRA 3NGZA 3HK2A 3PLAA 3DAWA 2HSTA 1HLUA 3B8AX 1FKPA 4MFBA 3AA5X 3NAEA 3NMUA 4I9QA 4DS4A 3ULEB 4B9LA 4K41A 5A2QO 4CCHA 1YUWA 4H5TA 5AQJA 1KLNA 4CEAA 1YAGA 2HHUA 3N4PA 3QLHA 3I8DA 4JI0K 2AJQA 3MXMA 4KTQA 4C8OA 2O8FA 4JKCA 4IDHA 4CJFA 4XH5A 3E01A 3O9SA 1TKXA 4JI2K 3V81A 4IG0A 4W5NA 2O8BA 4OPKA 4DMNA 1IKXA 5AQMA 4CEEA 3AVIA 1J5EK 4H0YB 4U67L 3NH0A 1LW0A 3SUNA 2NNWA 1NK9A 3KLFA 3DXMA 4GMJB 2PZSA 5J2NA 5KGWA 4OKJA 2HVIA 4I7FA 2OTJN 4WCEL 1K6YA 4M3XA 1TV6A 4O5BA 3OYKA 1JCGA 3T1HK 3QETA 1LWEA 1W9HA 3FZKA 3H1QA 4OX9K 4C1NK 2VYPA 3KK3A 2XY5A 1YF5L 5HBMA 4K25A 3CCSN 4BRHA 1WSIA 4DTMA 1KFSA 3C6AA 3OYJA 2E6LA 2VGMA 4ZHRA 1HX1A 3SQ1A 2YCHA 1NNEA 3AVCA 3KD5E 2PBDA 4FPAA 2NUBA 1W7AA 3MWTA 4HTLA 1BISA 2NRTA 3VQ5A 4Z4FA 2YHWA 1OKJA 3NE6A 5GAGP 4KH6A 2P9KB 1ZBLA 2JWKA 1VSKA 1NKEA 4NXNK 2VGNA 3L4QA 5HOOA 5F0XA 4J2AA 1EO1A 3CHWA 4IKFA 3AO4A 4ISGA 5E26A 3CM5A 3PX4A 3KK1A 3MXIA 2Z1JA 4ID1A 4BC2A 3RMDA 4LC9B 3ZSOA 3NCIA 2P5OA 3LDOA 4PUOA 3WXMB 3R1XA 4CD1A 2KFNA 1U6ZA 3CIPA 3K2PA 3QEWA 1FJGK 1EWQA 2FSJA 5JS1A 4UQGA 2D0AA 4O44A 1YVNA 1Q9YA 3WXJA 3NH2A 3H3OB 4H5NA 3KD1E 3UKUA 4CERA 4GVEA 2FXUA 4JKFA 2W41A 3RVCA 5AQVA 4FLZA 1Y97A 3VQCA 4WQ4C 3TANA 2VG7A 3OYGA 3BF1A 4FK0A 4GV3A 4AQYK 3LZJA 3AO1A 1RDCA 2FF6A 4PHTX 4FW2A 4AHVA 3EKUA 2YNGA 4IOXA 3Q7CA 2G8UA 1HMVA 5DM7L 4IJNA 5BPMA 4CJKA 1ILYA 4AHCA 1NK4A 3AVAA 1O1WA 4N56A 3KVGA 4WQ5C 1T03A 4CESA 3NVMA 3V9XA 2Q0RA 4M3RA 3V1QA 3SV4A 5E84A 3A5NC 5ADXA 1S72N 4F4KA 4KHPK 4DU1A 4AH9A 3QNOA 4CF1A 1RBTA 4JI3K 4CJRA 1NK7A 1NMDA 3HI0A 5M1FA 1VQKN 2G8VA 1GLAG 2IOCA 5GADP 2EX3A 3TPQA 2I7PA 4Z0UA 4DFPA 3P31A 1NOYA 4JD2A 4E7LA 4BACA 3O8MA 1VSLA 3TAMA 4V19S 3EO3A 2QK9A 2AP1A 3P38A 1LWFA 2IVNA 1V4TA 1WAJA 1ZYQA 5MLCQ 4MO4A 2HHHK 4LH4A 3PX0A 1DLOA 2VCPA 4QOZB 1WAFA 2IIRA 4CJTA 1GLDG 1NLVA 2WONA 1HKGA 5EVZA 4IOCL 4KHSA 1G99A 4DTOA 1RDUA 1VSJA 1HQUA 1BO5O 4A5BA 1REVA 4I2PA 3F5TA 3ID8A 2W42A 4LH5A 3HSCA 4IOAL 4BQLA 1TL1A 3CD6N 1HRHA 4KTZA 5DK5A 2Q1NA 2ZWHA 4Y1CA 1WSJA 3E1YA 1JLFA 1GLEG 3DLEA 3U9ZA 4B3TK 2G8WA 5CZ2A 4Z4EA 5EXWA 3WUHA 1VQ9N 2DFFA 5E41A 2RHKA 3L3UA 3CF5L 1KRPA 3O4WA 4PY5A 4YOTA 3MEEA 1GLLO 4QS8A 1X3NA 4CJ5A 3KKRA 1VSHA 5BRHA 3LP0A 1CZBA 3VMFB 4ISFA 3DXKA 1T6CA 4K42A 3I55N 1XHXA 1ZXOA 4NCGA 3SAGA 4JRPA 4B1ZA 1QSLA 1N34K 4JKEA 1GOAA 2ZF5O 1H1VA 4BR5A 3OA9A 3ZT1A 2KHOA 3DI6A 3WNEA 1NBWA 1T6DA 1WN7A 1EXQA 4FOIA 4CJ4A 1ATSA 4H4MA 1GLJO 3MWPA 2G8FA 4HCBA 1M90O 2IC3A 4G9ZA 4CEQA 1TUYA 3RMCA 2KQ2A 3V9UA 4GV9A 4JS5A 4CJEA 1NKCA 4BC5A 1BWFO 2HHSA 3KWIA 5AQOA 1DEJA 4E89A 3JAMO 4H0VB 5HRPA 4DV5K 2QWPA 4FO0A 3WNGA 2BE2A 2YKMA 3W3DA 4IJAA 3CCUN 1E4FT 3AVBA 1N8RO 1LAWA 4J2DA 2P1JA 1RGIA 5LJWA 1KLMA 3CC7N 3H1VX 4AHRA 5AQYA 3OJUA 3O3HA 4OKKA 3O5BA 4LSLA 3WEEA 3M3ZA 3SK3A 1CZ9A 3C65A 5CHIA 1A5VA 4F3TA 2IGIA 3PIPL 1U2VB 1BIUA 1ITGA 3T7ZA 1JCEA 2OPRA 4DCHA 4CJQA 5DM6L 3OVNA 5AQIA 3E9LA 4KO0A 2XHBA 3HOSA 4B1WB 3GG4A 3TTCA 4KKOA 2A6AA 4FWKA 3SPZA 1JLAA 4FJLA 3VQBA 4RG8A 4CJWA 4M3WA 1Z25A 3NF7A 4LY7A 3MK6A 4CIGA 3NGYA 2F9TA 4NLBA 1QTMA 4JI7K 4JHDB 3CPWM 4M3YA 4FW1A 3ZT0A 3G71N 2Z1GA 1D4XA 2UYTA 2YJEA 1WBDA 2A3ZA 3I0RA 2BGGA 3OBYA 2D0CA 4A61A 1NGDA 2OA8A 3CM6A 5HL7L 4JKHA 4BRLA 4OKEA 3L2WA 2FBYA 4PQUA 1KD1O 1RT3A 1SKWA 4H0XB 3N4QA 4JN4A 1Z6RA 1GLFO 1L5UA 3T1YK 1CZAN 4DQIA 3QBXA 1I94K 4YOVA 3VQEA 3O3FA 5HROA 2HNDA 2HHXA 3V1OA 1RBUA 1W2BM 3O1WA 5SWMA 1RFQA 3UIQA 1XC9A 2BH1A 1HUXA 1J54A 3NDKA 2GWJA 3OHRA 2KZMA 4NB4A 2O8CB 1Q81O 3HBTA 3O9RA 3J8AA 4KRFA 3VA0A 1EX4A 1R59O 5TKWA 4B1XB 3MN9A 4FJJA 3D2EA 1TVRA 3OYCA 2CGKA 1BGXT 3QDKA 4E7IA 2UXBK 2VQEK 1F21A 2HF3A 4W5OA 3JXUA 3O9TA 4IDKA 5CYQA 3H45C 4CFCA 4DQQA 5B8HA 5C42A 3ENHA 3HPOA 1M1KO 2BDPA 2YHBA 4O5FA 3DMJA 4C8LA 4DTJA 4BREA 1RTDA 5AQTA 4JI8K 1MWKA 2WTUA 2ZQBA 4JKGA 4ZTFA 1YVUA 3P39A 3WNFA 4YFUA 2JWLA 4DQPA 4IFYA 5KRSA 2KW4A 2YNIA 1B9FA 1JXEA 5BN8A 3LPUA 4G1QA 3NH1A 5LMUK 3A2FA 4E7JA 1K9MO 1W97L 4WQ4A 4LFCK 4N76A 4I2QA 3LM9A 1RCHA 4OPAA 3AAPA 3P4IA 3H08A 2E2OA 3FGUA 4W5QA 4CBXA 5H1SQ 4BR7A 4BRDA 1JLQA 2O8DA 4E7KA 3KJVA 4XH4A 1VK0A 3NFAA 3BF3A 3LPTA 4FWLA 3THWA 2HNYA 2O8FB 1ATNA 4JKBA 5IWAK 1SL0A 4IG3A 3K59A 4AM7A 3NGIA 1S5JA 4FVMA 3K5LA 4WQ5A 4DTNA 4FZXC 2UUCK 4FJGA 5M1PA 3CJ7A 4YORA 3DXMB 1VSDA 4CJVA 1OH6A 1KAXA 4CECA 3JS6A 3DLLL 1E4GT 5AQSA 4CZLA 1TYQA 2E6MA 2NRHA 5AJ3K 1RDDA 1BCOA 4DQRA 3AVJA 1TKDA 4CF9A 1VRUA 5F1XA 1K8AO 4PKGA 4CHOA 2E2NA 4FJNA 3P1GA 2V52B 3GL1A 1YTUA 3MN5A 4B9SA 3AVHA 3L4IA 3ENOA 5AFUA 4A57A 4JS4A 4ELTA 1BA0A 1ZC6A 3CCJN 4O0IA 1RDAA 4BG9A 4I6MA 2WUSA 3UE5A 2DFEA 3MXJA 3RWUA 3HL8A 3S3NA 2CH6A 3A5MC 3ZETA 1BI4A 5HRSA 4IO8A 1VQ8N 4DSIA 1BA1A 1MU2A 4DLGA 4X64K 2NRRA 3LWLA 1L3SA 3DLRA 3CCEN 2P51A 3RMBA 3TI0A 3C94A 3LDPA 4JYAK 1JCFA 1Q9XA 1X9WA 3RR8A 2WC9A 3CCVN 5EU7A 1KAYA 4PL7A 1OH5A 4B3SK 1GOCA 4KV8A 1VSMA 3THYB 4MLHA 3IKMA 1BL3A 1HNVA 4CHPA 4DTPA 3UKUB 4A59A 4HUEA 4Z4IA 1RT6A 4N41A 3THXA 1NJXA 4M45A 4Z4GA 5F2RA 3IDHA 1JLCA 1VQ6N 5BR9A 5GINA 4BRAA 1KC8O 2Q3SA 3CMEN 4FWMA 1QQNA 3HTVA 2IDOA 1RT2A 3KLGA 5AQPA 4ICLA 2G8KA 3HPHA 3OYAA 4FM2A 4B9NA 3DRSA 4JK8A 4KAZA 4E7HA 4UY8O 4DR3K 3RSEA 3TAGA 2Q2RA 2CGJA 3KIOA 3TSUA 1X1PA 3AVGA 2GEMA 4X65K 3WXIA 4FWPA 4O8KA 3QESA 2GTDA 1XMOK 3AVFA 3SYZA 4BY9C 3K9KA 1TUUA 4TSXA 1YJNN 3A8YA 3TAFA 2HBLA 5JLHA 3K58A 1IBLK 1HPZA 4O55A 3KLEA 3VEYA 1CXUA 1X3MA 1QVFM 3DYAA 1ZBFA 2KLAA 5FRNA 3CI5A 2FSKA 1CXQA 4CJ3A 1NGHA 3TSPA 3QICA 1O13A 3CJ1A 1QQCA 1KVBA 1LV5A 4JD2B 2E2QA 2HHQA 2Q97A 4FLTA 3AARA 2ATQA 1RT1A 4KBOA 2Q31A 4CF0A 3THYA 5I42A 2IAJA 3VETA 4IEEA 4KTWA 3QO9A 2V7ZA 4JK9A 4EHTA 4C23A 1FXXA 1WOQA 2CH5A 2X6SA 4BROA 3L2RA 1NK8A 2UXDK 5HP1A 4IZ9A 3FZHA 4FJKA 4M63C 5AQWA 4CBWA 2GX9A 4DR5K 2OZMA 4DKWA 4GVMA 1S1WA 4EFHA 2F8SA 5EX5A 3S3MA 4FLYA 1T05A 4LF4K 4DF8A 3G4SN 4NCBA 4B8CA 3M8SA 4E1JA 3WXLA 1HNIA 1XNQK 1QZ5A 3OYFA 4DV7K 3LL3A 1BUPA 3ASMA 4DSFA 3VGMA 1ASUA 3ZX0A 3FE1A 3VEWA 1SS6A 5DMRA 3UB5A 4NYNA 2KZZA 1LW2A 3CPEA 3VTIA 3CFOA 1Q8IA 1BQMA 3OYMA 3HSTB 2YNFA 4BDZA 3BGRA 4FOEA 5JVGL 1J6ZA 3WT0A 3O4NA 3DLGA 2RF2A 2W40A 3DXKB 2A1RA 2JGUA 3GOIA 3HOTA 1YXQA 2QKBA 3M5RA 4DQSA 4CGGA 1RT5A 2LSNA 4JI1K 1RNHA 5J1EA 3ITHA 4BDPA 2YV0X 3IRXA 2F9WA 1Y64A 4Y1DA 1T3VA 2ZE2A 3BEXA 3QEVA 3MAQA 1HYZA 3ZX3A 3TR8A 3L0QA 4YOWA 3DWLA 4DQ8A 4CJ7A 1JL2A 2VQFK 1U04A 3TTDA 3HM9A 1TKTA 4FVUA 3VPZA 1JJ2M 4OJRA 1VHXA 4B8AB 4BRCA 5BR8K 4HCCA 3CYMA 4DR1K 3F2KA 3VQAA 3VF2A 4E3SA 4CEBA 1HYVA 3I33A 4EP5A 4AILC 4MDAA 3GBTA 1NMNA 5JLFA 1U45A 4FJIA 4CHQA 3SQ4A 3AY9A 3MN6A 4DFKA 3P83D 5AQFA 3WEEB 5GIOA 3ID6A 3AO5A 4DU4A 4K8XA 3BZKA 2F8TA 2OCEA 5K14A 1JXBA 3PO4A 4BRPA 4JKAA 1KCFA 4I9LA 3T69A 1IJJA 3AA3A 1D9FA 2XO7A 1ASVA 1NOZA 1WSGA 2GELA 2YI1A 5AQGA 3AVNA 3PV8A 1DT9A 2Q0UA 2A42A 4CJUA 3AA4A 3LAKA 5KGXA 4KH4A 3PIOL 4B3RK 3DRRA 3OYBA 4ELVA 1VSEA 3LDSA 3QEXA 1C1CA 4IBNA 5AQRA 4KHUA 1WLJA 2OPPA 2FBXA 2E20A 4DTXA 1HNZK 5HLFA 3O08A 3A0IX 4CE9A 5AQHA 4LFAK 2PAVA 3EZ5A 3G6EN 4H5WA 3QEPA 1KSPA 4F2SA 2OANA 3CJ9A 2Z1HA 4JRQA 2HBMA 1HR0K 4B9MA 2P9UA 3NVKA 3HPGA 4H0TB 1NKBA 4DG1A 2YX6A 4OGEA 2HBKA 4OPHA 4CD3A 1J53A 3AVLA 3IMXA 1D9DA 1K8KA 2H3GX 3EE8A 4FL9A 2IVOA 3V1RA 1DTTA 3TABA 1X9JA 3LP2A 4M3UA 4X66K 4KHQA 1KQSM 1NG9A 2QM1A 5FRMA 4JAXA 3OYNA 3FFIA 3VA3A 2ASOA 3VEVA 3UKRA 1JLBA 1VSFA 3MN7A 3HYFA 5HRNA 4N47A 1JLEA 4Q5VA 3J7ZO 4OLAA 1HNWK 4FJMA 3DJCA 1RDWX 1QSSA 4A2AA 4B1VA 3O1BA 5C10A 3KLIA 3ZLJA 4BE1A 5CYMA 3D2EB 4M7XA 4QCLA 4XEIA 2DPNA 4CGIA 1JL1A 5D3GA 5C24A 5FPDA 4KHNA 1CLQA 3ZEUA 4NO7A 3E9PA 3VQDA 1BOTO 1IKWA 1N32K 3KZBA 2DFHA 4MO5A 4F3OA 3BP8A 4K0KK 2FSNA 3O80A 4RW7A 1YJ9N 3BUZB 1UAXA 4WF9L 3B6PA 4AHSA 3AA2A 4BRNA 4B08A 3SUQA 1SKSA 4F9OA 4ZTJA 1HNXK 1ZBHA 2P9LA 3O6WA 4LSNA 4CGJA 1VQPN 2QWOA 3OS2A 3PX6A 3V6DA 3DOLA 4JKGB 5C0YA 4K43A 3H6EA 1X9MA 4DFJA 1XNRK 1YTAA 2V7YA 3ZSWA 3VQ8A 4DWIA 1ASWA 4EIAA 2VWKA 3G25A 3TWHA 2G8IA 5C2DA 5AQZA 2OTLN 2HOEA 3IS9A 3FR0A 1A5WA 4FJ8A 2BTFA 3JYTA 1V4SA 2G8HA 2HHVA 5CZ1A 3VESA 5M1NA 2P9SA 4X62K 3EEQA 3GE1A 3QIOA 2BANA 1IO2A 2O8DB 2X6NA 5AQQA 3SUPA 4CGFA 3WQTA 4OO1J 5KQ8A 1MDUB 5SZTA 2IVPA 3THWB 3R6MA 1OH8A 3U4LA 3OW2M 2VG5A 1NGJA 4O8UA 1S9GA 3OBWA 5FDLA 1LCUA 3L8BA 2RPIA 3VTHA 1S3XA 1WSEA 5AR0A 4BR9A 2XY8A 1ZBIA 2W6LA 3SJJA 4CJSA 4FJXA 5JS2A 5KQDA 3AGRA 2O4IA 2D0OA 2PYLA 4JNEA 3T3FA 5FLXO 4JV5K 2Y1IA 3I56N 3CCMN 3SPYA 2HMIA 1VAZA 1TYQB 2YJFA 2D0BA 2KFZA 4BC4A 1N5YA 2HHWA 4QAGA 1SAZA 1NGCA 4CEDA 1TK0A 1TKZA 1C1BA 4BR0A 2EWSA 3MEDA 4AHUA 2E88A 1QSYA 3EE9A 3RRHA 1N33K 4BRIA 4CZIA 3C6TA 2GBZA 3CXCM 1NGFA 4I6MB 1SL2A 2GV9A 4FLUA 1Z05A 3M8PA 1VQ7N 5KPTA 4CJLA 3S9HA 2KKZA 3ZETB 4CFAA 1BI4B 1BCMA 2ASPA 1TAUA 3IG1A 4NLCA 3G10A 1DTQA 3BDPA 3ZSXA 3SJHA 2ZGZA 1BQNA 2WBNA 3KLHA 3I8BA 3OYHA 1SQKA 4DV0K 3SBTA 5J2PA 3ZSQA 4FM1A 1TGOA 1QHAA 2NZTA 3V4IA 4U7BA 3MECA 4M3ZA 3D6RA 5AQKA 2E8AA 2JLEA 1RBVA 2BUPA 4CF8A 3OS1A 3H3NO 5GAHP 4CFDA 3ZYYX 5BRDA 4WYBA 3THXB 4IO9L 2UXCK 3E9OA 4RW4A 5M1OA 3T19A 3VGLA 3CC4N 2E1ZA 4J2EA 5AQNA 4EAHD 4BE0A 1UA0A 4F8RA 3CQXA 1B92A 2PY5A 4BGAA 2P9PA 1WUAA 5FPMA 2YNHA 2X78A 2P9IB 4FWOA 5ELZA 2DY4A 3ZX2A 3R9PA 3C95A 3RSEB 1RILA 4M7YA 4JK7A 4CZHA 4E19A 1C0FA 2P5GA 2OPQA 3FFKB 1S1UA 3NF8A 4BRGA 4B9UA 5FPNA 3OYEA 2EHGA 3EN9A 3LDLA 3ZCMA 1QS4A 4FZYA 2YKNA 3EY1A 1HJRA 1U4BA 4BDYA 1Q86O 4KI6A 4CW7B 3A5LC 5M1QA 4R79A 4BWJA 4KHYA 2D5RA 3CQYA 1QE1A 4C8NA 2QXFA 3HRGA 3TAPA 2IS3A 4DV4K 5FPEA 3DRPA 3JSMA 4ILHA 4JEPA 1S1TA 4DR4K 2ZM6K 4DSLA 3C7NB 4KB0A 3QINA 3D0PA 3CETA 1XMQK 2VWBA 1HYSA 1NK6A 3L3VA 5KI6A 4CZKA 2B4JA 4FK2A 5HRRA 2NRWA 4RW9A 4DHYA 4KB1A 1IV0A 5BN9A 1BU6O 4NYFA 4R5PA 1BDGA 3VGKA 3H46O 2GUIA 4QS9A 2YHAA 3CMAN 1KVCA 2UUAK 2ASMA 3VEZA 1C6VA 3Q7BA 3D2FA 4RWTA 3ZSRA 2ZD1A 1X9SA 1L3UA 2HNZA 2VWJA 4C8KA 1IKYA 2PFUA 5IT9O 2FLOA 1VQ5N 2QWRA 4KH5A 4EHUA 3SI6A 2HF4A 3CFRA 1WBBA 4CHYA 2HB5A 2P9IA 2ZGYA 2E1YA 1L3VA 4Q0BA 1LWCA 4PL8A 2A40A 3L2VA 2ITGA 2AA4A 1QVGM 4DSKA 4FLVA 4GNIA 1TK8A 1HPMA 1BG3A 4LF8K 1SV5A 2D0PA 4CGHA 3DM2A 3SAFA 1VQON 5M1KA 4DSJA 5LJVA 3RTVA 2P9NA 3U3GA 4KREA 4E0DA 5FROA 2ZJRL 4EP4A 3FZMA 3PSIA 1C0MA 1S6QA 1NGIA 3OYIA 4DUYK 4FJ5A 4CK3A 2DTUA 3VQ6A 1UA1A 5ADXH 2Y1JA 5LY3A 3G0ZA 3SZ2A 1QZ6A 1T8EA 2E4LA 3LP1A 1KVAA 2FBVA 3AVKA 4ISEA 4F2RA 4FZZA 1S1XA 2XRIA 3ZT2A 1NK5A 3C7NA 1RT4A 2XY7A 3SUOA 3AV9A 4K8ZA 4DFMA 4XIUA 4DTUA 4FJ7A 5GAEP 3ULEA 4E1MA 2GUPA 3LP3A 4CZJA 4W5RA 4ILJA 1G15A 3PUFA 1I39A 1QQMA 1Q18A 4H8KA 3OYLA 3EKSA 1HKCA 5CR4A 3F9KA 3AGKA 3AO2A 4KFBA 3KHYA 3B6OA 5J2QA 5I3UA 4A5AA 2YHYA 3CFPA 3ALYA 1T44A 2NRVA 4KI4A 4PWDA 3QB0A 2I7NA 2QA4N 2A1SA 1KTQA 3M8QA 3OYDA 4CBUA 4RCHA 4RTFD 1WSFA 1Z26A 3EL2A 3ULDA 4DTRA 4CHNA 3CCLN 1NM1A 1RTJA 4FLXA 1TAQA 1IBKK 3QEIA 1BHLA 1JLGA 4DV3K 4DV1K 1VSIA 5GIPA 1S6PA 3M6GA 1T7PA 5BREA 2O4GA 1EWRA 3E66A 1BIZA 2XY6A 3VQQA 2RKIA 4JLHA 1NJYA 4BGBA 3ENBA 1ATRA 2OYQA 4PA1A 3CQ8A 4YOYA 3VERA 5J2MA 2OPSA 3S3OA 3CJAA 3PO5A 3KTQA 1HQEA 4YOUA 3CC2N 4CFBA 1QQOA 4CK2A 4IFEA 3RRGA 1NGBA 3L2QA 4QS7A 2P9KA 1S22A 3AVMA 3QFUA 3WQUA 4FCYA 1KXPA 1UOCA 2A41A 4BRFA 4YDUC 4JI6K 2P9UB 1UWBA 4C8MA 1C0GA 5LMNK 4M42A 5JVHL 3T1AA 2F96A 4BR2A 4YHHK 3J80O 4CZGA 4BE2A 4RW6A 3LALA 5LL6Z 3S41A 3L2UA 1K8KB 2QWNA 4MLEA 1WSHA 3RMAA 5C2FA 2RN2A 4AM6A 3W0LA 1J9AA 4H5RA 2WFBA 2ITMA 2E5LK 4IFVA 3L6QA 4CIEA 3SAHA 4FXDA 1C0UA 1OH7A 1S1VA 5EOYA 3UKRB 1E3MA 2QEXN 3U6FA 2FC0A 3R3LA 4CF2A 3TTFA 4A62A 3NF9A 3CCRN 3KK7A 4WFBL 3MDQA 4AF1A 1SZ2A 5CY4A 4CVNE 1SKRA 4GV6A 4CEZA 3ATVA 3ZT3A 2KTQA 1R0AA 4YNQA 3MEGA 1LOTB 4Z94A 2ETJA 4H5VA 4CK1A 4M3TA 1EETA 3RR7A 3O9UA 4KPYA 4YY3K 2B5JA 3ZEUB 1NU0A 1FKOA 5I9EB 3HVRA 4MQ3A 3TSQA 1I3AA 4CZEA 3V9SA 4BC3A 3I0SA 3CJCA 4B9TA 3NHGA 2NRZA 1NJZA 4PKHA 2HHTA 5AQUA 3ZSZA 3SQ2A 3A5OC 3LDQA 2P9LB 1TL3A 3TAQA 4XH1A 3ZT4A 2QTDA 3CG7A 2I5JA 4BR4A 1RBRA 1XWLA 5BRFA 3THVA 3K57A 3AAQA 4FJ9A 4L3QA 1Q82O 2Z1IA 3PSFA 4YOXA 4DR2K 3GDQA 4BRQA 4BVPA 2GWKA 4DR7K 1ESVA 1GOBA 3DLHA 3VOVA 1K73O 2QWLA 4B9QA 2ZJPL 3HT3A 5C25A 2D4WA 3HM8A 1FW6A 5C15A 3VQPA 3MCAB 3BZCA 4EZ9A 3O9QA 3KKSA 3O4QA 1W0HA 2P9SB 3V9ZA 4LF9K 3HVTA 1DKGD 4CHZA 2HW3A 2QWQA 3J81O 2NRXA 3FZLA 2ZJQL 4A2BA 4Y0WA 4J8FA 1YJWN 3LAMA 3SMPA 1U47A 5AQXA 1YI2N 2E2PA 3CJBA 4HUFA 4DF4A 4LD0A 2CGLA 1U49A 4JI4K 2R7YA 4HHTA 3F73A 4DSEA 4WFAL 2QWMA 4FSVA 1IH7A 4DS5A 4GKJK 3OY9A 3BY5A 3SNNA 3SLCA 3V9WA 4JKDA 1KAZA 3U9DA 3ATUA 4CIFA 1IG9A 2HVHA 1P90A 1RT7A 2WOMA 4CEOA 1RDBA 4HVJA 3TARA 3CCQN 4FPBA 2O8EB 1XQSC 2QKKA 2QI2A 3KK2A 3QERA 3MX5A 1OVYA 3WXKA 5KTQA 5KPZA 4O4GA 1QHTA 4GKKK 4FWSA 3VF6A 5C12A 4L8RB 4IWVA 1WNSA 1EQYA 1IBMK 4CZFA 4DU3A 2PYJA 4B9VA 3FZFA 4DLEA 4H0PA 1YT3A 5AZJB 3QBWA 3HXMA 5JMVA 1J5OA 2J4RA 2VG6A 3U3YA 5T7BA 3MMVA 4BRKA 4GW6A 3K9JA 4W5TA 1C1AA 2HMPA 3QFPA 4LFBK 4BWMA 1NJWA 1EKEA 1ZBSA 3HJFA 3OS0A 4H0OA 3HP6A 4BQZA 3J7AP 1FK9A 1RBSA 1S9EA 4H03B 4KHWA 1A5XA 1MWMA 3SBGA 1NGEA 5AZIB 1B9DA 3QIPA 1XHZA 1SUQA 3U8XA 3VEXA 2OZSA 2QXLA 4IXCA 3K5MA 3DLBA 4AHTA 3LWMA 3FLCO 4LF6K 1VQLN 3SCXA 4CZMA 1NWKA 1JKHA 4CGDA 4NCAA 1ZBUA 4M41A 2P9PB 1VQNN 3K5NA 3HZ6A 4NXMK 4IEIA 4E1NA 2NLXA 4EZ6A 4B1UB 3QNNA 4CI6A 5EY4A 3NBPA 1N36K 3LM2A 1U2VA 2O8EA 1L3TA 4MDBA 4WE1A 3F9MA
chains in the Genus database with same CATH topology
4CZKA 2V51B 4BVOA 4GV9A 2NRWA 4DHYA 4FOEA 5AQLA 5BN9A 5JVGL 1YIJN 1BU6O 4FWQA 1J6ZA 3WT0A 3QMLA 5JICA 4BC5A 1BWFO 1BDGA 3KWIA 3VGKA 3H46O 1IG8A 2W40A 1DEJA 5AQOA 4QS9A 3CMAN 3DXKB 1XUPO 4H0VB 1YHQN 2ASMA 2QWPA 3GOIA 3VEZA 3Q7BA 3HOTA 3D2FA 4FO0A 4RWTA 3W3DA 3C6HA 4IJAA 1YXQA 1E4FT 3CCUN 2PFUA 2RE2A 2FLOA 3M5RA 1VQ5N 2QWRA 5AZJA 1N8RO 4KH5A 1RGIA 5LJWA 4EHUA 2HF4A 4JHDA 3CC7N 2HBJA 2Q36A 3H1VX 5AQYA 2F9WA 1Y64A 4HWIA 1T3VA 3BEXA 5AFUH 3O5BA 4WFNL 3WEEA 2P9IA 3M3ZA 4GY2B 3SK3A 3C65A 5CHIA 3ZX3A 5CE3A 2ZGYA 3L0QA 4YOWA 2E1YA 3DWLA 3PIPL 4DQ8A 4BG8A 4PL8A 2A40A 1U2VB 4CJ7A 3D7EO 3T7ZA 1JCEA 2AA4A 4DCHA 1QVGM 3MX2A 3TTDA 2A5XA 1NJIO 5DM6L 4GNIA 4FVUA 5AQIA 1HPMA 3E9LA 1BG3A 5KPRA 3CERA 3VPZA 3MCPA 2D0PA 1VQ4N 1JJ2M 4FWRA 5AZIA 4B1WB 3GG4A 3TTCA 3SAFA 3HOSA 1VQON 5M1KA 2A6AA 4FWKA 3IUCA 5LJVA 2D1KA 3EZWA 3R8EA 4BRCA 2P9NA 1YITN 3D2FB 3F2KA 3VF2A 3TU5A 1Q7YO 2ZJRL 3I33A 4MDAA 3FZMA 3GBTA 3MK6A 1HJOA 2F9TA 4NLBA 5JLFA 1NGIA 5BPNA 1MA9B 4JHDB 1XC3A 3VENA 3AY9A 3CPWM 3MN6A 3KWGA 1GLCG 3G71N 5AQFA 1D4XA 2FF3B 5ADXH 3WEEB 5LY3A 5GIOA 2UYTA 3ID6A 1QZ6A 3SMSA 3VF4A 4DB3A 2YJEA 1DGKN 2YHXA 2A3ZA 4ISEA 4ILGB 3C7NA 3OBYA 2F7TA 4PKIA 4A61A 1NGDA 5HL7L 1NGGA 4JKHA 4BRLA 5GAEP 3ULEA 1NGAA 2GUPA 4CZJA 4BRPA 4JKAA 1GLBG 1KD1O 3T69A 1IJJA 4ILJA 4YDUA 1P8ZA 2QW9A 4H0XB 3N4QA 2GELA 4JN4A 2YI1A 1QQMA 1Q18A 1GLFO 1Z6RA 5AQGA 1DT9A 1CZAN 2A42A 2Q0UA 3EKSA 1HKCA 3QBXA 5TKYA 1VQMN 5CR4A 4YOVA 3AGKA 3KHYA 3VEOA 4KH4A 3C0BA 3M1FA 5BPLA 3PIOL 2P9NB 4BRMA 1HKBA 4FWNA 5AQRA 1W2BM 3O1WA 1RFQA 4A5AA 2YHYA 1T44A 2NRVA 4B1YB 4C1NI 3QB0A 2E20A 2I7NA 2QA4N 3LDNA 4CBUA 4RCHA 4RTFD 3O08A 3EL2A 2BH1A 3A0IX 1HUXA 2GWJA 3OHRA 3IFRA 4NB4A 5AQHA 3CCLN 3PLAA 1NM1A 1Q81O 3HBTA 3DAWA 2HSTA 3O9RA 3J8AA 2PAVA 1HLUA 3B8AX 1R59O 3G6EN 5TKWA 4B1XB 3MN9A 3NMUA 4H5WA 2OANA 3D2EA 3CJ9A 2CGKA 2HBMA 3ULEB 2P9UA 3QDKA 3NVKA 4K41A 4H0TB 2YX6A 2HF3A 3JXUA 2HBKA 3O9TA 4OPHA 4CD3A 1YUWA 3IMXA 1K8KA 4H5TA 5AQJA 2H3GX 3EE8A 3H45C 4FL9A 5B8HA 2IVOA 1YAGA 5GIPA 3M6GA 3ENHA 5BREA 3N4PA 1M1KO 3E66A 1X9JA 4O5FA 1KQSM 2QM1A 4JAXA 4BREA 4JKCA 4BGBA 4IDHA 3ENBA 1ATRA 2ASOA 4XH5A 5AQTA 3VEVA 3UKRA 4YOYA 3O9SA 1MWKA 3MN7A 3VERA 3CJAA 4JKGA 5AQMA 3J7ZO 3P39A 4YOUA 3CC2N 3DJCA 4H0YB 4U67L 1RDWX 1QQOA 4IFEA 4A2AA 2NNWA 2JWLA 4B1VA 3O1BA 5C10A 1NGBA 4QS7A 2P9KA 1S22A 3DXMA 3QFUA 3WQUA 1KXPA 5BN8A 2A41A 3D2EB 4BRFA 4YDUC 4M7XA 1K9MO 4XEIA 2DPNA 2P9UB 2OTJN 1C0GA 1W97L 4WQ4A 5JVHL 4WCEL 3I55N 4BR2A 4CZGA 5FPDA 1JCGA 3ZEUA 3LM9A 3S41A 4NO7A 1K8KB 2QWNA 3E9PA 1BOTO 3AAPA 3FZKA 3H1QA 3P4IA 4OPAA 2E2OA 3FGUA 2VYPA 3KZBA 4MLEA 4MO5A 3BP8A 4C1NK 4CBXA 2FSNA 5H1SQ 5C2FA 4AM6A 4BR7A 4BRDA 1YF5L 3O80A 3W0LA 4H5RA 4K25A 1YJ9N 3BUZB 3CCSN 4BRHA 2WFBA 4WF9L 4XH4A 2ITMA 4BRNA 3BF3A 4FWLA 4F9OA 3C6AA 2P9LA 3L6QA 3SAHA 1ATNA 3O6WA 4JKBA 5EOYA 2VGMA 4MDBA 1VQPN 3UKRB 2QWOA 1HX1A 2QEXN 2YCHA 4AM7A 4WQ5A 3R3LA 2PBDA 4FPAA 3MWTA 4JKGB 5C0YA 4K43A 3TTFA 3H6EA 4A62A 4HTLA 2NRTA 2YHWA 2V7YA 3KK7A 3MDQA 1OKJA 4AF1A 4WFBL 3CCRN 1SZ2A 4GV6A 5M1PA 3CJ7A 4YORA 5GAGP 4EIAA 3ATVA 2P9KB 3DXMB 2JWKA 3G25A 4KH6A 5C2DA 5AQZA 2OTLN 2HOEA 2VGNA 3L4QA 5HOOA 1KAXA 1LOTB 4Z94A 5F0XA 3CHWA 3FR0A 4H5VA 1EO1A 2BTFA 3O9UA 3JS6A 3DLLL 1E4GT 4ISGA 5E26A 5AQSA 1V4SA 4CZLA 3ZEUB 1TYQA 3VESA 5M1NA 2NRHA 2P9SA 5I9EB 3GE1A 3TSQA 4CZEA 4BC3A 3CJCA 4BC2A 4LC9B 5AQQA 2NRZA 4PKHA 4OO1J 3WQTA 5KQ8A 5AQUA 1MDUB 5F1XA 3LDOA 3A5OC 1K8AO 2IVPA 3LDQA 3R6MA 2P9LB 3R1XA 3WXMB 4CD1A 1U6ZA 3CIPA 4PKGA 4XH1A 2E2NA 3U4LA 3OW2M 2QTDA 2V52B 2FSJA 3GL1A 4BR4A 1NGJA 1YVNA 4O8UA 3WXJA 3MN5A 3OBWA 3H3OB 4H5NA 5BRFA 3UKUA 3L4IA 1LCUA 3ENOA 5AFUA 4A57A 3VTHA 1BA0A 1S3XA 1ZC6A 5AR0A 3AAQA 4BR9A 3CCJN 4L3QA 1Q82O 4YOXA 4GVEA 3GDQA 2FXUA 4BRQA 4BG9A 4I6MA 2W41A 4JKFA 4BVPA 2GWKA 2WUSA 3UE5A 3RVCA 1ESVA 5AQVA 5KQDA 4WQ4C 3VOVA 2CH6A 3A5MC 3ZETA 1K73O 3AGRA 4IO8A 1VQ8N 2D0OA 2QWLA 3BF1A 1BA1A 4JNEA 4B9QA 2ZJPL 4GV3A 3I56N 2NRRA 2D4WA 3CCEN 2FF6A 3HM8A 4PHTX 5C15A 3MCAB 3CCMN 3LDPA 3EKUA 1VAZA 1JCFA 1TYQB 3O9QA 2WC9A 2YJFA 2P9SB 3CCVN 4IOXA 3Q7CA 1DKGD 5DM7L 1KAYA 2QWQA 4IJNA 4PL7A 4BC4A 5BPMA 1SAZA 2NRXA 3FZLA 2ZJQL 1NGCA 4A2BA 4Y0WA 1ILYA 4J8FA 1YJWN 3KVGA 3SMPA 4MLHA 3IKMA 4WQ5C 5AQXA 2E2PA 3CJBA 3NVMA 2EWSA 4BR0A 1YI2N 2Q0RA 2E88A 5E84A 3UKUB 2CGLA 3A5NC 5ADXA 4A59A 3EE9A 1S72N 4WFAL 2QWMA 4FSVA 4BRIA 4CZIA 3CXCM 5F2RA 1NGFA 3IDHA 4I6MB 1VQ6N 1Z05A 5BR9A 5GINA 4BRAA 1VQ7N 5KPTA 1KC8O 3SLCA 3CMEN 2KKZA 4FWMA 3ZETB 4JKDA 1NMDA 1KAZA 3HI0A 1QQNA 3HTVA 3U9DA 5M1FA 2ASPA 1VQKN 3ATUA 5AQPA 4NLCA 3SJHA 2ZGZA 4R79A 1GLAG 1P90A 2WBNA 5GADP 3I8BA 3TPQA 2I7PA 1SQKA 4JK8A 3SBTA 3P31A 4JD2A 4UY8O 3O8MA 1QHAA 2NZTA 3RSEA 3CCQN 2Q2RA 2CGJA 4FPBA 1XQSC 3TSUA 3EO3A 2QI2A 2GEMA 2AP1A 3P38A 4U7BA 3MX5A 3D6RA 1OVYA 3WXIA 5AQKA 2IVNA 4FWPA 3WXKA 2E8AA 4O8KA 2GTDA 5KPZA 1V4TA 2BUPA 4BY9C 3K9KA 5MLCQ 1TUUA 1YJNN 3H3NO 4MO4A 3A8YA 5GAHP 4FWSA 3VF6A 2HBLA 2VCPA 5C12A 3ZYYX 5JLHA 4IWVA 5BRDA 4WYBA 1EQYA 4CZFA 2IIRA 3FZFA 1GLDG 1NLVA 4IO9L 4H0PA 3E9OA 3VEYA 1HKGA 5EVZA 5M1OA 1X3MA 3VGLA 4IOCL 1G99A 3CC4N 2E1ZA 1QVFM 1RDUA 5AQNA 5AZJB 3QBWA 4EAHD 2KLAA 1BO5O 3CQXA 4A5BA 5JMVA 2J4RA 3F5TA 3ID8A 3CI5A 4BGAA 2FSKA 2P9PA 3HSCA 1WUAA 3MMVA 1NGHA 5FPMA 4BQLA 3TSPA 4IOAL 3CD6N 2Q1NA 2ZWHA 3QICA 4BRKA 1O13A 2P9IB 3CJ1A 3E1YA 1GLEG 3U9ZA 3K9JA 4FWOA 5ELZA 4JD2B 3QFPA 2HMPA 3ZX2A 5EXWA 3R9PA 3WUHA 1VQ9N 2E2QA 4M7YA 2Q97A 4JK7A 2RHKA 3RSEB 1ZBSA 3AARA 4CZHA 4H0OA 4KBOA 3CF5L 1C0FA 2Q31A 3O4WA 4BQZA 3FFKB 4BRGA 4YOTA 5FPNA 4H03B 3VETA 3EN9A 4IEEA 1GLLO 4QS8A 2V7ZA 1X3NA 3LDLA 4JK9A 4EHTA 4C23A 1MWMA 3SBGA 1NGEA 5AZIB 5BRHA 2CH5A 1WOQA 4BROA 3VMFB 4ISFA 3DXKA 4IZ9A 1Q86O 1T6CA 4K42A 3FZHA 3U8XA 3A5LC 5M1QA 3VEXA 4M63C 5AQWA 1ZXOA 2GX9A 2QXLA 4IXCA 4CBWA 4DKWA 3CQYA 3SAGA 3HRGA 3FLCO 4EFHA 1VQLN 4B1ZA 5EX5A 4CZMA 1NWKA 4JKEA 2ZF5O 5FPEA 1H1VA 3G4SN 4BR5A 3OA9A 2KHOA 2P9PB 4E1JA 1NBWA 4ILHA 1VQNN 3HZ6A 4IEIA 3WXLA 1T6DA 4JEPA 2NLXA 1QZ5A 4FOIA 1ATSA 1GLJO 3MWPA 4B1UB 3LL3A 1BUPA 4CI6A 5EY4A 1M90O 3VGMA 3C7NB 3LM2A 4G9ZA 3ZX0A 1U2VA 3FE1A 1SS6A 3CETA 3UB5A 2VWBA 1TUYA 3VEWA 3CPEA 3VTIA 3F9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPA A;  3O9S A;  2RHK A;  3O9T A;  3P39 A;  3P31 A;  4OPH A;  3EE9 A;  3KWI A;  3OA9 A;  3EE8 A;  3L4Q A;  3O9Q A;  3P38 A;  3F5T A;  3O9U A;  3D6R A;  2KKZ A;  3O9R A;  3M5R A;  3KWG A;  3RVC A;  2GX9 A; 
#chains in the Genus database with same CATH topology
 2V51 B;  4BVO A;  4DV2 K;  3K0S A;  4O0J A;  1N6Q A;  3ISN C;  4H4O A;  5AQL A;  1XI1 A;  1YIJ N;  4FWQ A;  3QML A;  5JIC A;  1IG8 A;  3SQ0 A;  1XUP O;  4ID5 A;  1YHQ N;  4RW8 A;  3C6H A;  1RTH A;  3TAE A;  3VN5 A;  3D45 A;  2RE2 A;  4LF7 K;  1NK0 A;  5AZJ A;  3AO3 A;  4FJH A;  3P5J A;  4OVL A;  4JHD A;  2HBJ A;  2Q36 A;  2F4V K;  4HWI A;  4DV6 K;  5AFU H;  4WFN L;  4GY2 B;  3VQ7 A;  3C6U A;  4FYD A;  1C0T A;  5CE3 A;  3LZI A;  4LF5 K;  4BG8 A;  3M8R A;  4B3O A;  3D7E O;  2UUB K;  2W6K A;  1D5A A;  3PY8 A;  2UU9 K;  3MX2 A;  2A5X A;  2FBT A;  3ZSY A;  3DOK A;  1NJI O;  1TK5 A;  5KPR A;  3CER A;  3MCP A;  1VQ4 N;  3EYZ A;  4FK4 A;  2X74 A;  4OPJ A;  4FWR A;  5AZI A;  4CJP A;  3IUC A;  2D1K A;  3EZW A;  3R8E A;  3OTO K;  4JI5 K;  1YIT N;  3D2F B;  3TU5 A;  1Q7Y O;  4HTU A;  4CEF A;  1HJO A;  4HUG A;  1SL1 A;  5BPN A;  1MA9 B;  4FLW A;  1XC3 A;  3VEN A;  1U48 A;  4OLB A;  3KWG A;  1GLC G;  2FF3 B;  1EP4 A;  2O8B B;  3SMS A;  4OGC A;  3VF4 A;  4DB3 A;  5KRT A;  3J7Y P;  3HO1 A;  2O8C A;  1IKV A;  1DGK N;  2YHX A;  4ILG B;  3LAN A;  3SV3 A;  2F7T A;  4PKI A;  3VQ4 A;  4Z4H A;  1NGG A;  3NF6 A;  1NGA A;  2B6A A;  1GLB G;  4YDU A;  1P8Z A;  2QW9 A;  3DLK A;  1LAV A;  5TKY A;  1VQM N;  4Z4C A;  3VEO A;  4B3M K;  3C0B A;  3M1F A;  5BPL A;  2P9N B;  4BRM A;  3HP9 A;  1HKB A;  4FWN A;  4N5S A;  3IAY A;  1KFD A;  3ZSV A;  4J2B A;  3WNH A;  4B1Y B;  4C1N I;  3O3G A;  1WB9 A;  1VRT A;  3OJS A;  4DR6 K;  3LDN A;  3VQ9 A;  4ELU A;  4DUZ K;  4FM0 A;  1D8Y A;  1OVQ A;  1RTI A;  3K5O A;  4DTS A;  3IFR A;  3NGZ A;  3HK2 A;  3PLA A;  3DAW A;  2HST A;  1HLU A;  3B8A X;  1FKP A;  4MFB A;  3AA5 X;  3NAE A;  3NMU A;  4I9Q A;  4DS4 A;  3ULE B;  4B9L A;  4K41 A;  5A2Q O;  4CCH A;  1YUW A;  4H5T A;  5AQJ A;  1KLN A;  4CEA A;  1YAG A;  2HHU A;  3N4P A;  3QLH A;  3I8D A;  4JI0 K;  2AJQ A;  3MXM A;  4KTQ A;  4C8O A;  2O8F A;  4JKC A;  4IDH A;  4CJF A;  4XH5 A;  3E01 A;  3O9S A;  1TKX A;  4JI2 K;  3V81 A;  4IG0 A;  4W5N A;  2O8B A;  4OPK A;  4DMN A;  1IKX A;  5AQM A;  4CEE A;  3AVI A;  1J5E K;  4H0Y B;  4U67 L;  3NH0 A;  1LW0 A;  3SUN A;  2NNW A;  1NK9 A;  3KLF A;  3DXM A;  4GMJ B;  2PZS A;  5J2N A;  5KGW A;  4OKJ A;  2HVI A;  4I7F A;  2OTJ N;  4WCE L;  1K6Y A;  4M3X A;  1TV6 A;  4O5B A;  3OYK A;  1JCG A;  3T1H K;  3QET A;  1LWE A;  1W9H A;  3FZK A;  3H1Q A;  4OX9 K;  4C1N K;  2VYP A;  3KK3 A;  2XY5 A;  1YF5 L;  5HBM A;  4K25 A;  3CCS N;  4BRH A;  1WSI A;  4DTM A;  1KFS A;  3C6A A;  3OYJ A;  2E6L A;  2VGM A;  4ZHR A;  1HX1 A;  3SQ1 A;  2YCH A;  1NNE A;  3AVC A;  3KD5 E;  2PBD A;  4FPA A;  2NUB A;  1W7A A;  3MWT A;  4HTL A;  1BIS A;  2NRT A;  3VQ5 A;  4Z4F A;  2YHW A;  1OKJ A;  3NE6 A;  5GAG P;  4KH6 A;  2P9K B;  1ZBL A;  2JWK A;  1VSK A;  1NKE A;  4NXN K;  2VGN A;  3L4Q A;  5HOO A;  5F0X A;  4J2A A;  1EO1 A;  3CHW A;  4IKF A;  3AO4 A;  4ISG A;  5E26 A;  3CM5 A;  3PX4 A;  3KK1 A;  3MXI A;  2Z1J A;  4ID1 A;  4BC2 A;  3RMD A;  4LC9 B;  3ZSO A;  3NCI A;  2P5O A;  3LDO A;  4PUO A;  3WXM B;  3R1X A;  4CD1 A;  2KFN A;  1U6Z A;  3CIP A;  3K2P A;  3QEW A;  1FJG K;  1EWQ A;  2FSJ A;  5JS1 A;  4UQG A;  2D0A A;  4O44 A;  1YVN A;  1Q9Y A;  3WXJ A;  3NH2 A;  3H3O B;  4H5N A;  3KD1 E;  3UKU A;  4CER A;  4GVE A;  2FXU A;  4JKF A;  2W41 A;  3RVC A;  5AQV A;  4FLZ A;  1Y97 A;  3VQC A;  4WQ4 C;  3TAN A;  2VG7 A;  3OYG A;  3BF1 A;  4FK0 A;  4GV3 A;  4AQY K;  3LZJ A;  3AO1 A;  1RDC A;  2FF6 A;  4PHT X;  4FW2 A;  4AHV A;  3EKU A;  2YNG A;  4IOX A;  3Q7C A;  2G8U A;  1HMV A;  5DM7 L;  4IJN A;  5BPM A;  4CJK A;  1ILY A;  4AHC A;  1NK4 A;  3AVA A;  1O1W A;  4N56 A;  3KVG A;  4WQ5 C;  1T03 A;  4CES A;  3NVM A;  3V9X A;  2Q0R A;  4M3R A;  3V1Q A;  3SV4 A;  5E84 A;  3A5N C;  5ADX A;  1S72 N;  4F4K A;  4KHP K;  4DU1 A;  4AH9 A;  3QNO A;  4CF1 A;  1RBT A;  4JI3 K;  4CJR A;  1NK7 A;  1NMD A;  3HI0 A;  5M1F A;  1VQK N;  2G8V A;  1GLA G;  2IOC A;  5GAD P;  2EX3 A;  3TPQ A;  2I7P A;  4Z0U A;  4DFP A;  3P31 A;  1NOY A;  4JD2 A;  4E7L A;  4BAC A;  3O8M A;  1VSL A;  3TAM A;  4V19 S;  3EO3 A;  2QK9 A;  2AP1 A;  3P38 A;  1LWF A;  2IVN A;  1V4T A;  1WAJ A;  1ZYQ A;  5MLC Q;  4MO4 A;  2HHH K;  4LH4 A;  3PX0 A;  1DLO A;  2VCP A;  4QOZ B;  1WAF A;  2IIR A;  4CJT A;  1GLD G;  1NLV A;  2WON A;  1HKG A;  5EVZ A;  4IOC L;  4KHS A;  1G99 A;  4DTO A;  1RDU A;  1VSJ A;  1HQU A;  1BO5 O;  4A5B A;  1REV A;  4I2P A;  3F5T A;  3ID8 A;  2W42 A;  4LH5 A;  3HSC A;  4IOA L;  4BQL A;  1TL1 A;  3CD6 N;  1HRH A;  4KTZ A;  5DK5 A;  2Q1N A;  2ZWH A;  4Y1C A;  1WSJ A;  3E1Y A;  1JLF A;  1GLE G;  3DLE A;  3U9Z A;  4B3T K;  2G8W A;  5CZ2 A;  4Z4E A;  5EXW A;  3WUH A;  1VQ9 N;  2DFF A;  5E41 A;  2RHK A;  3L3U A;  3CF5 L;  1KRP A;  3O4W A;  4PY5 A;  4YOT A;  3MEE A;  1GLL O;  4QS8 A;  1X3N A;  4CJ5 A;  3KKR A;  1VSH A;  5BRH A;  3LP0 A;  1CZB A;  3VMF B;  4ISF A;  3DXK A;  1T6C A;  4K42 A;  3I55 N;  1XHX A;  1ZXO A;  4NCG A;  3SAG A;  4JRP A;  4B1Z A;  1QSL A;  1N34 K;  4JKE A;  1GOA A;  2ZF5 O;  1H1V A;  4BR5 A;  3OA9 A;  3ZT1 A;  2KHO A;  3DI6 A;  3WNE A;  1NBW A;  1T6D A;  1WN7 A;  1EXQ A;  4FOI A;  4CJ4 A;  1ATS A;  4H4M A;  1GLJ O;  3MWP A;  2G8F A;  4HCB A;  1M90 O;  2IC3 A;  4G9Z A;  4CEQ A;  1TUY A;  3RMC A;  2KQ2 A;  3V9U A;  4GV9 A;  4JS5 A;  4CJE A;  1NKC A;  4BC5 A;  1BWF O;  2HHS A;  3KWI A;  5AQO A;  1DEJ A;  4E89 A;  3JAM O;  4H0V B;  5HRP A;  4DV5 K;  2QWP A;  4FO0 A;  3WNG A;  2BE2 A;  2YKM A;  3W3D A;  4IJA A;  3CCU N;  1E4F T;  3AVB A;  1N8R O;  1LAW A;  4J2D A;  2P1J A;  1RGI A;  5LJW A;  1KLM A;  3CC7 N;  3H1V X;  4AHR A;  5AQY A;  3OJU A;  3O3H A;  4OKK A;  3O5B A;  4LSL A;  3WEE A;  3M3Z A;  3SK3 A;  1CZ9 A;  3C65 A;  5CHI A;  1A5V A;  4F3T A;  2IGI A;  3PIP L;  1U2V B;  1BIU A;  1ITG A;  3T7Z A;  1JCE A;  2OPR A;  4DCH A;  4CJQ A;  5DM6 L;  3OVN A;  5AQI A;  3E9L A;  4KO0 A;  2XHB A;  3HOS A;  4B1W B;  3GG4 A;  3TTC A;  4KKO A;  2A6A A;  4FWK A;  3SPZ A;  1JLA A;  4FJL A;  3VQB A;  4RG8 A;  4CJW A;  4M3W A;  1Z25 A;  3NF7 A;  4LY7 A;  3MK6 A;  4CIG A;  3NGY A;  2F9T A;  4NLB A;  1QTM A;  4JI7 K;  4JHD B;  3CPW M;  4M3Y A;  4FW1 A;  3ZT0 A;  3G71 N;  2Z1G A;  1D4X A;  2UYT A;  2YJE A;  1WBD A;  2A3Z A;  3I0R A;  2BGG A;  3OBY A;  2D0C A;  4A61 A;  1NGD A;  2OA8 A;  3CM6 A;  5HL7 L;  4JKH A;  4BRL A;  4OKE A;  3L2W A;  2FBY A;  4PQU A;  1KD1 O;  1RT3 A;  1SKW A;  4H0X B;  3N4Q A;  4JN4 A;  1Z6R A;  1GLF O;  1L5U A;  3T1Y K;  1CZA N;  4DQI A;  3QBX A;  1I94 K;  4YOV A;  3VQE A;  3O3F A;  5HRO A;  2HND A;  2HHX A;  3V1O A;  1RBU A;  1W2B M;  3O1W A;  5SWM A;  1RFQ A;  3UIQ A;  1XC9 A;  2BH1 A;  1HUX A;  1J54 A;  3NDK A;  2GWJ A;  3OHR A;  2KZM A;  4NB4 A;  2O8C B;  1Q81 O;  3HBT A;  3O9R A;  3J8A A;  4KRF A;  3VA0 A;  1EX4 A;  1R59 O;  5TKW A;  4B1X B;  3MN9 A;  4FJJ A;  3D2E A;  1TVR A;  3OYC A;  2CGK A;  1BGX T;  3QDK A;  4E7I A;  2UXB K;  2VQE K;  1F21 A;  2HF3 A;  4W5O A;  3JXU A;  3O9T A;  4IDK A;  5CYQ A;  3H45 C;  4CFC A;  4DQQ A;  5B8H A;  5C42 A;  3ENH A;  3HPO A;  1M1K O;  2BDP A;  2YHB A;  4O5F A;  3DMJ A;  4C8L A;  4DTJ A;  4BRE A;  1RTD A;  5AQT A;  4JI8 K;  1MWK A;  2WTU A;  2ZQB A;  4JKG A;  4ZTF A;  1YVU A;  3P39 A;  3WNF A;  4YFU A;  2JWL A;  4DQP A;  4IFY A;  5KRS A;  2KW4 A;  2YNI A;  1B9F A;  1JXE A;  5BN8 A;  3LPU A;  4G1Q A;  3NH1 A;  5LMU K;  3A2F A;  4E7J A;  1K9M O;  1W97 L;  4WQ4 A;  4LFC K;  4N76 A;  4I2Q A;  3LM9 A;  1RCH A;  4OPA A;  3AAP A;  3P4I A;  3H08 A;  2E2O A;  3FGU A;  4W5Q A;  4CBX A;  5H1S Q;  4BR7 A;  4BRD A;  1JLQ A;  2O8D A;  4E7K A;  3KJV A;  4XH4 A;  1VK0 A;  3NFA A;  3BF3 A;  3LPT A;  4FWL A;  3THW A;  2HNY A;  2O8F B;  1ATN A;  4JKB A;  5IWA K;  1SL0 A;  4IG3 A;  3K59 A;  4AM7 A;  3NGI A;  1S5J A;  4FVM A;  3K5L A;  4WQ5 A;  4DTN A;  4FZX C;  2UUC K;  4FJG A;  5M1P A;  3CJ7 A;  4YOR A;  3DXM B;  1VSD A;  4CJV A;  1OH6 A;  1KAX A;  4CEC A;  3JS6 A;  3DLL L;  1E4G T;  5AQS A;  4CZL A;  1TYQ A;  2E6M A;  2NRH A;  5AJ3 K;  1RDD A;  1BCO A;  4DQR A;  3AVJ A;  1TKD A;  4CF9 A;  1VRU A;  5F1X A;  1K8A O;  4PKG A;  4CHO A;  2E2N A;  4FJN A;  3P1G A;  2V52 B;  3GL1 A;  1YTU A;  3MN5 A;  4B9S A;  3AVH A;  3L4I A;  3ENO A;  5AFU A;  4A57 A;  4JS4 A;  4ELT A;  1BA0 A;  1ZC6 A;  3CCJ N;  4O0I A;  1RDA A;  4BG9 A;  4I6M A;  2WUS A;  3UE5 A;  2DFE A;  3MXJ A;  3RWU A;  3HL8 A;  3S3N A;  2CH6 A;  3A5M C;  3ZET A;  1BI4 A;  5HRS A;  4IO8 A;  1VQ8 N;  4DSI A;  1BA1 A;  1MU2 A;  4DLG A;  4X64 K;  2NRR A;  3LWL A;  1L3S A;  3DLR A;  3CCE N;  2P51 A;  3RMB A;  3TI0 A;  3C94 A;  3LDP A;  4JYA K;  1JCF A;  1Q9X A;  1X9W A;  3RR8 A;  2WC9 A;  3CCV N;  5EU7 A;  1KAY A;  4PL7 A;  1OH5 A;  4B3S K;  1GOC A;  4KV8 A;  1VSM A;  3THY B;  4MLH A;  3IKM A;  1BL3 A;  1HNV A;  4CHP A;  4DTP A;  3UKU B;  4A59 A;  4HUE A;  4Z4I A;  1RT6 A;  4N41 A;  3THX A;  1NJX A;  4M45 A;  4Z4G A;  5F2R A;  3IDH A;  1JLC A;  1VQ6 N;  5BR9 A;  5GIN A;  4BRA A;  1KC8 O;  2Q3S A;  3CME N;  4FWM A;  1QQN A;  3HTV A;  2IDO A;  1RT2 A;  3KLG A;  5AQP A;  4ICL A;  2G8K A;  3HPH A;  3OYA A;  4FM2 A;  4B9N A;  3DRS A;  4JK8 A;  4KAZ A;  4E7H A;  4UY8 O;  4DR3 K;  3RSE A;  3TAG A;  2Q2R A;  2CGJ A;  3KIO A;  3TSU A;  1X1P A;  3AVG A;  2GEM A;  4X65 K;  3WXI A;  4FWP A;  4O8K A;  3QES A;  2GTD A;  1XMO K;  3AVF A;  3SYZ A;  4BY9 C;  3K9K A;  1TUU A;  4TSX A;  1YJN N;  3A8Y A;  3TAF A;  2HBL A;  5JLH A;  3K58 A;  1IBL K;  1HPZ A;  4O55 A;  3KLE A;  3VEY A;  1CXU A;  1X3M A;  1QVF M;  3DYA A;  1ZBF A;  2KLA A;  5FRN A;  3CI5 A;  2FSK A;  1CXQ A;  4CJ3 A;  1NGH A;  3TSP A;  3QIC A;  1O13 A;  3CJ1 A;  1QQC A;  1KVB A;  1LV5 A;  4JD2 B;  2E2Q A;  2HHQ A;  2Q97 A;  4FLT A;  3AAR A;  2ATQ A;  1RT1 A;  4KBO A;  2Q31 A;  4CF0 A;  3THY A;  5I42 A;  2IAJ A;  3VET A;  4IEE A;  4KTW A;  3QO9 A;  2V7Z A;  4JK9 A;  4EHT A;  4C23 A;  1FXX A;  1WOQ A;  2CH5 A;  2X6S A;  4BRO A;  3L2R A;  1NK8 A;  2UXD K;  5HP1 A;  4IZ9 A;  3FZH A;  4FJK A;  4M63 C;  5AQW A;  4CBW A;  2GX9 A;  4DR5 K;  2OZM A;  4DKW A;  4GVM A;  1S1W A;  4EFH A;  2F8S A;  5EX5 A;  3S3M A;  4FLY A;  1T05 A;  4LF4 K;  4DF8 A;  3G4S N;  4NCB A;  4B8C A;  3M8S A;  4E1J A;  3WXL A;  1HNI A;  1XNQ K;  1QZ5 A;  3OYF A;  4DV7 K;  3LL3 A;  1BUP A;  3ASM A;  4DSF A;  3VGM A;  1ASU A;  3ZX0 A;  3FE1 A;  3VEW A;  1SS6 A;  5DMR A;  3UB5 A;  4NYN A;  2KZZ A;  1LW2 A;  3CPE A;  3VTI A;  3CFO A;  1Q8I A;  1BQM A;  3OYM A;  3HST B;  2YNF A;  4BDZ A;  3BGR A;  4FOE A;  5JVG L;  1J6Z A;  3WT0 A;  3O4N A;  3DLG A;  2RF2 A;  2W40 A;  3DXK B;  2A1R A;  2JGU A;  3GOI A;  3HOT A;  1YXQ A;  2QKB A;  3M5R A;  4DQS A;  4CGG A;  1RT5 A;  2LSN A;  4JI1 K;  1RNH A;  5J1E A;  3ITH A;  4BDP A;  2YV0 X;  3IRX A;  2F9W A;  1Y64 A;  4Y1D A;  1T3V A;  2ZE2 A;  3BEX A;  3QEV A;  3MAQ A;  1HYZ A;  3ZX3 A;  3TR8 A;  3L0Q A;  4YOW A;  3DWL A;  4DQ8 A;  4CJ7 A;  1JL2 A;  2VQF K;  1U04 A;  3TTD A;  3HM9 A;  1TKT A;  4FVU A;  3VPZ A;  1JJ2 M;  4OJR A;  1VHX A;  4B8A B;  4BRC A;  5BR8 K;  4HCC A;  3CYM A;  4DR1 K;  3F2K A;  3VQA A;  3VF2 A;  4E3S A;  4CEB A;  1HYV A;  3I33 A;  4EP5 A;  4AIL C;  4MDA A;  3GBT A;  1NMN A;  5JLF A;  1U45 A;  4FJI A;  4CHQ A;  3SQ4 A;  3AY9 A;  3MN6 A;  4DFK A;  3P83 D;  5AQF A;  3WEE B;  5GIO A;  3ID6 A;  3AO5 A;  4DU4 A;  4K8X A;  3BZK A;  2F8T A;  2OCE A;  5K14 A;  1JXB A;  3PO4 A;  4BRP A;  4JKA A;  1KCF A;  4I9L A;  3T69 A;  1IJJ A;  3AA3 A;  1D9F A;  2XO7 A;  1ASV A;  1NOZ A;  1WSG A;  2GEL A;  2YI1 A;  5AQG A;  3AVN A;  3PV8 A;  1DT9 A;  2Q0U A;  2A42 A;  4CJU A;  3AA4 A;  3LAK A;  5KGX A;  4KH4 A;  3PIO L;  4B3R K;  3DRR A;  3OYB A;  4ELV A;  1VSE A;  3LDS A;  3QEX A;  1C1C A;  4IBN A;  5AQR A;  4KHU A;  1WLJ A;  2OPP A;  2FBX A;  2E20 A;  4DTX A;  1HNZ K;  5HLF A;  3O08 A;  3A0I X;  4CE9 A;  5AQH A;  4LFA K;  2PAV A;  3EZ5 A;  3G6E N;  4H5W A;  3QEP A;  1KSP A;  4F2S A;  2OAN A;  3CJ9 A;  2Z1H A;  4JRQ A;  2HBM A;  1HR0 K;  4B9M A;  2P9U A;  3NVK A;  3HPG A;  4H0T B;  1NKB A;  4DG1 A;  2YX6 A;  4OGE A;  2HBK A;  4OPH A;  4CD3 A;  1J53 A;  3AVL A;  3IMX A;  1D9D A;  1K8K A;  2H3G X;  3EE8 A;  4FL9 A;  2IVO A;  3V1R A;  1DTT A;  3TAB A;  1X9J A;  3LP2 A;  4M3U A;  4X66 K;  4KHQ A;  1KQS M;  1NG9 A;  2QM1 A;  5FRM A;  4JAX A;  3OYN A;  3FFI A;  3VA3 A;  2ASO A;  3VEV A;  3UKR A;  1JLB A;  1VSF A;  3MN7 A;  3HYF A;  5HRN A;  4N47 A;  1JLE A;  4Q5V A;  3J7Z O;  4OLA A;  1HNW K;  4FJM A;  3DJC A;  1RDW X;  1QSS A;  4A2A A;  4B1V A;  3O1B A;  5C10 A;  3KLI A;  3ZLJ A;  4BE1 A;  5CYM A;  3D2E B;  4M7X A;  4QCL A;  4XEI A;  2DPN A;  4CGI A;  1JL1 A;  5D3G A;  5C24 A;  5FPD A;  4KHN A;  1CLQ A;  3ZEU A;  4NO7 A;  3E9P A;  3VQD A;  1BOT O;  1IKW A;  1N32 K;  3KZB A;  2DFH A;  4MO5 A;  4F3O A;  3BP8 A;  4K0K K;  2FSN A;  3O80 A;  4RW7 A;  1YJ9 N;  3BUZ B;  1UAX A;  4WF9 L;  3B6P A;  4AHS A;  3AA2 A;  4BRN A;  4B08 A;  3SUQ A;  1SKS A;  4F9O A;  4ZTJ A;  1HNX K;  1ZBH A;  2P9L A;  3O6W A;  4LSN A;  4CGJ A;  1VQP N;  2QWO A;  3OS2 A;  3PX6 A;  3V6D A;  3DOL A;  4JKG B;  5C0Y A;  4K43 A;  3H6E A;  1X9M A;  4DFJ A;  1XNR K;  1YTA A;  2V7Y A;  3ZSW A;  3VQ8 A;  4DWI A;  1ASW A;  4EIA A;  2VWK A;  3G25 A;  3TWH A;  2G8I A;  5C2D A;  5AQZ A;  2OTL N;  2HOE A;  3IS9 A;  3FR0 A;  1A5W A;  4FJ8 A;  2BTF A;  3JYT A;  1V4S A;  2G8H A;  2HHV A;  5CZ1 A;  3VES A;  5M1N A;  2P9S A;  4X62 K;  3EEQ A;  3GE1 A;  3QIO A;  2BAN A;  1IO2 A;  2O8D B;  2X6N A;  5AQQ A;  3SUP A;  4CGF A;  3WQT A;  4OO1 J;  5KQ8 A;  1MDU B;  5SZT A;  2IVP A;  3THW B;  3R6M A;  1OH8 A;  3U4L A;  3OW2 M;  2VG5 A;  1NGJ A;  4O8U A;  1S9G A;  3OBW A;  5FDL A;  1LCU A;  3L8B A;  2RPI A;  3VTH A;  1S3X A;  1WSE A;  5AR0 A;  4BR9 A;  2XY8 A;  1ZBI A;  2W6L A;  3SJJ A;  4CJS A;  4FJX A;  5JS2 A;  5KQD A;  3AGR A;  2O4I A;  2D0O A;  2PYL A;  4JNE A;  3T3F A;  5FLX O;  4JV5 K;  2Y1I A;  3I56 N;  3CCM N;  3SPY A;  2HMI A;  1VAZ A;  1TYQ B;  2YJF A;  2D0B A;  2KFZ A;  4BC4 A;  1N5Y A;  2HHW A;  4QAG A;  1SAZ A;  1NGC A;  4CED A;  1TK0 A;  1TKZ A;  1C1B A;  4BR0 A;  2EWS A;  3MED A;  4AHU A;  2E88 A;  1QSY A;  3EE9 A;  3RRH A;  1N33 K;  4BRI A;  4CZI A;  3C6T A;  2GBZ A;  3CXC M;  1NGF A;  4I6M B;  1SL2 A;  2GV9 A;  4FLU A;  1Z05 A;  3M8P A;  1VQ7 N;  5KPT A;  4CJL A;  3S9H A;  2KKZ A;  3ZET B;  4CFA A;  1BI4 B;  1BCM A;  2ASP A;  1TAU A;  3IG1 A;  4NLC A;  3G10 A;  1DTQ A;  3BDP A;  3ZSX A;  3SJH A;  2ZGZ A;  1BQN A;  2WBN A;  3KLH A;  3I8B A;  3OYH A;  1SQK A;  4DV0 K;  3SBT A;  5J2P A;  3ZSQ A;  4FM1 A;  1TGO A;  1QHA A;  2NZT A;  3V4I A;  4U7B A;  3MEC A;  4M3Z A;  3D6R A;  5AQK A;  2E8A A;  2JLE A;  1RBV A;  2BUP A;  4CF8 A;  3OS1 A;  3H3N O;  5GAH P;  4CFD A;  3ZYY X;  5BRD A;  4WYB A;  3THX B;  4IO9 L;  2UXC K;  3E9O A;  4RW4 A;  5M1O A;  3T19 A;  3VGL A;  3CC4 N;  2E1Z A;  4J2E A;  5AQN A;  4EAH D;  4BE0 A;  1UA0 A;  4F8R A;  3CQX A;  1B92 A;  2PY5 A;  4BGA A;  2P9P A;  1WUA A;  5FPM A;  2YNH A;  2X78 A;  2P9I B;  4FWO A;  5ELZ A;  2DY4 A;  3ZX2 A;  3R9P A;  3C95 A;  3RSE B;  1RIL A;  4M7Y A;  4JK7 A;  4CZH A;  4E19 A;  1C0F A;  2P5G A;  2OPQ A;  3FFK B;  1S1U A;  3NF8 A;  4BRG A;  4B9U A;  5FPN A;  3OYE A;  2EHG A;  3EN9 A;  3LDL A;  3ZCM A;  1QS4 A;  4FZY A;  2YKN A;  3EY1 A;  1HJR A;  1U4B A;  4BDY A;  1Q86 O;  4KI6 A;  4CW7 B;  3A5L C;  5M1Q A;  4R79 A;  4BWJ A;  4KHY A;  2D5R A;  3CQY A;  1QE1 A;  4C8N A;  2QXF A;  3HRG A;  3TAP A;  2IS3 A;  4DV4 K;  5FPE A;  3DRP A;  3JSM A;  4ILH A;  4JEP A;  1S1T A;  4DR4 K;  2ZM6 K;  4DSL A;  3C7N B;  4KB0 A;  3QIN A;  3D0P A;  3CET A;  1XMQ K;  2VWB A;  1HYS A;  1NK6 A;  3L3V A;  5KI6 A;  4CZK A;  2B4J A;  4FK2 A;  5HRR A;  2NRW A;  4RW9 A;  4DHY A;  4KB1 A;  1IV0 A;  5BN9 A;  1BU6 O;  4NYF A;  4R5P A;  1BDG A;  3VGK A;  3H46 O;  2GUI A;  4QS9 A;  2YHA A;  3CMA N;  1KVC A;  2UUA K;  2ASM A;  3VEZ A;  1C6V A;  3Q7B A;  3D2F A;  4RWT A;  3ZSR A;  2ZD1 A;  1X9S A;  1L3U A;  2HNZ A;  2VWJ A;  4C8K A;  1IKY A;  2PFU A;  5IT9 O;  2FLO A;  1VQ5 N;  2QWR A;  4KH5 A;  4EHU A;  3SI6 A;  2HF4 A;  3CFR A;  1WBB A;  4CHY A;  2HB5 A;  2P9I A;  2ZGY A;  2E1Y A;  1L3V A;  4Q0B A;  1LWC A;  4PL8 A;  2A40 A;  3L2V A;  2ITG A;  2AA4 A;  1QVG M;  4DSK A;  4FLV A;  4GNI A;  1TK8 A;  1HPM A;  1BG3 A;  4LF8 K;  1SV5 A;  2D0P A;  4CGH A;  3DM2 A;  3SAF A;  1VQO N;  5M1K A;  4DSJ A;  5LJV A;  3RTV A;  2P9N A;  3U3G A;  4KRE A;  4E0D A;  5FRO A;  2ZJR L;  4EP4 A;  3FZM A;  3PSI A;  1C0M A;  1S6Q A;  1NGI A;  3OYI A;  4DUY K;  4FJ5 A;  4CK3 A;  2DTU A;  3VQ6 A;  1UA1 A;  5ADX H;  2Y1J A;  5LY3 A;  3G0Z A;  3SZ2 A;  1QZ6 A;  1T8E A;  2E4L A;  3LP1 A;  1KVA A;  2FBV A;  3AVK A;  4ISE A;  4F2R A;  4FZZ A;  1S1X A;  2XRI A;  3ZT2 A;  1NK5 A;  3C7N A;  1RT4 A;  2XY7 A;  3SUO A;  3AV9 A;  4K8Z A;  4DFM A;  4XIU A;  4DTU A;  4FJ7 A;  5GAE P;  3ULE A;  4E1M A;  2GUP A;  3LP3 A;  4CZJ A;  4W5R A;  4ILJ A;  1G15 A;  3PUF A;  1I39 A;  1QQM A;  1Q18 A;  4H8K A;  3OYL A;  3EKS A;  1HKC A;  5CR4 A;  3F9K A;  3AGK A;  3AO2 A;  4KFB A;  3KHY A;  3B6O A;  5J2Q A;  5I3U A;  4A5A A;  2YHY A;  3CFP A;  3ALY A;  1T44 A;  2NRV A;  4KI4 A;  4PWD A;  3QB0 A;  2I7N A;  2QA4 N;  2A1S A;  1KTQ A;  3M8Q A;  3OYD A;  4CBU A;  4RCH A;  4RTF D;  1WSF A;  1Z26 A;  3EL2 A;  3ULD A;  4DTR A;  4CHN A;  3CCL N;  1NM1 A;  1RTJ A;  4FLX A;  1TAQ A;  1IBK K;  3QEI A;  1BHL A;  1JLG A;  4DV3 K;  4DV1 K;  1VSI A;  5GIP A;  1S6P A;  3M6G A;  1T7P A;  5BRE A;  2O4G A;  1EWR A;  3E66 A;  1BIZ A;  2XY6 A;  3VQQ A;  2RKI A;  4JLH A;  1NJY A;  4BGB A;  3ENB A;  1ATR A;  2OYQ A;  4PA1 A;  3CQ8 A;  4YOY A;  3VER A;  5J2M A;  2OPS A;  3S3O A;  3CJA A;  3PO5 A;  3KTQ A;  1HQE A;  4YOU A;  3CC2 N;  4CFB A;  1QQO A;  4CK2 A;  4IFE A;  3RRG A;  1NGB A;  3L2Q A;  4QS7 A;  2P9K A;  1S22 A;  3AVM A;  3QFU A;  3WQU A;  4FCY A;  1KXP A;  1UOC A;  2A41 A;  4BRF A;  4YDU C;  4JI6 K;  2P9U B;  1UWB A;  4C8M A;  1C0G A;  5LMN K;  4M42 A;  5JVH L;  3T1A A;  2F96 A;  4BR2 A;  4YHH K;  3J80 O;  4CZG A;  4BE2 A;  4RW6 A;  3LAL A;  5LL6 Z;  3S41 A;  3L2U A;  1K8K B;  2QWN A;  4MLE A;  1WSH A;  3RMA A;  5C2F A;  2RN2 A;  4AM6 A;  3W0L A;  1J9A A;  4H5R A;  2WFB A;  2ITM A;  2E5L K;  4IFV A;  3L6Q A;  4CIE A;  3SAH A;  4FXD A;  1C0U A;  1OH7 A;  1S1V A;  5EOY A;  3UKR B;  1E3M A;  2QEX N;  3U6F A;  2FC0 A;  3R3L A;  4CF2 A;  3TTF A;  4A62 A;  3NF9 A;  3CCR N;  3KK7 A;  4WFB L;  3MDQ A;  4AF1 A;  1SZ2 A;  5CY4 A;  4CVN E;  1SKR A;  4GV6 A;  4CEZ A;  3ATV A;  3ZT3 A;  2KTQ A;  1R0A A;  4YNQ A;  3MEG A;  1LOT B;  4Z94 A;  2ETJ A;  4H5V A;  4CK1 A;  4M3T A;  1EET A;  3RR7 A;  3O9U A;  4KPY A;  4YY3 K;  2B5J A;  3ZEU B;  1NU0 A;  1FKO A;  5I9E B;  3HVR A;  4MQ3 A;  3TSQ A;  1I3A A;  4CZE A;  3V9S A;  4BC3 A;  3I0S A;  3CJC A;  4B9T A;  3NHG A;  2NRZ A;  1NJZ A;  4PKH A;  2HHT A;  5AQU A;  3ZSZ A;  3SQ2 A;  3A5O C;  3LDQ A;  2P9L B;  1TL3 A;  3TAQ A;  4XH1 A;  3ZT4 A;  2QTD A;  3CG7 A;  2I5J A;  4BR4 A;  1RBR A;  1XWL A;  5BRF A;  3THV A;  3K57 A;  3AAQ A;  4FJ9 A;  4L3Q A;  1Q82 O;  2Z1I A;  3PSF A;  4YOX A;  4DR2 K;  3GDQ A;  4BRQ A;  4BVP A;  2GWK A;  4DR7 K;  1ESV A;  1GOB A;  3DLH A;  3VOV A;  1K73 O;  2QWL A;  4B9Q A;  2ZJP L;  3HT3 A;  5C25 A;  2D4W A;  3HM8 A;  1FW6 A;  5C15 A;  3VQP A;  3MCA B;  3BZC A;  4EZ9 A;  3O9Q A;  3KKS A;  3O4Q A;  1W0H A;  2P9S B;  3V9Z A;  4LF9 K;  3HVT A;  1DKG D;  4CHZ A;  2HW3 A;  2QWQ A;  3J81 O;  2NRX A;  3FZL A;  2ZJQ L;  4A2B A;  4Y0W A;  4J8F A;  1YJW N;  3LAM A;  3SMP A;  1U47 A;  5AQX A;  1YI2 N;  2E2P A;  3CJB A;  4HUF A;  4DF4 A;  4LD0 A;  2CGL A;  1U49 A;  4JI4 K;  2R7Y A;  4HHT A;  3F73 A;  4DSE A;  4WFA L;  2QWM A;  4FSV A;  1IH7 A;  4DS5 A;  4GKJ K;  3OY9 A;  3BY5 A;  3SNN A;  3SLC A;  3V9W A;  4JKD A;  1KAZ A;  3U9D A;  3ATU A;  4CIF A;  1IG9 A;  2HVH A;  1P90 A;  1RT7 A;  2WOM A;  4CEO A;  1RDB A;  4HVJ A;  3TAR A;  3CCQ N;  4FPB A;  2O8E B;  1XQS C;  2QKK A;  2QI2 A;  3KK2 A;  3QER A;  3MX5 A;  1OVY A;  3WXK A;  5KTQ A;  5KPZ A;  4O4G A;  1QHT A;  4GKK K;  4FWS A;  3VF6 A;  5C12 A;  4L8R B;  4IWV A;  1WNS A;  1EQY A;  1IBM K;  4CZF A;  4DU3 A;  2PYJ A;  4B9V A;  3FZF A;  4DLE A;  4H0P A;  1YT3 A;  5AZJ B;  3QBW A;  3HXM A;  5JMV A;  1J5O A;  2J4R A;  2VG6 A;  3U3Y A;  5T7B A;  3MMV A;  4BRK A;  4GW6 A;  3K9J A;  4W5T A;  1C1A A;  2HMP A;  3QFP A;  4LFB K;  4BWM A;  1NJW A;  1EKE A;  1ZBS A;  3HJF A;  3OS0 A;  4H0O A;  3HP6 A;  4BQZ A;  3J7A P;  1FK9 A;  1RBS A;  1S9E A;  4H03 B;  4KHW A;  1A5X A;  1MWM A;  3SBG A;  1NGE A;  5AZI B;  1B9D A;  3QIP A;  1XHZ A;  1SUQ A;  3U8X A;  3VEX A;  2OZS A;  2QXL A;  4IXC A;  3K5M A;  3DLB A;  4AHT A;  3LWM A;  3FLC O;  4LF6 K;  1VQL N;  3SCX A;  4CZM A;  1NWK A;  1JKH A;  4CGD A;  4NCA A;  1ZBU A;  4M41 A;  2P9P B;  1VQN N;  3K5N A;  3HZ6 A;  4NXM K;  4IEI A;  4E1N A;  2NLX A;  4EZ6 A;  4B1U B;  3QNN A;  4CI6 A;  5EY4 A;  3NBP A;  1N36 K;  3LM2 A;  1U2V A;  2O8E A;  1L3T A;  4MDB A;  4WE1 A;  3F9M A; 
#chains in the Genus database with same CATH homology
 4CZK A;  2V51 B;  4BVO A;  4GV9 A;  2NRW A;  4DHY A;  4FOE A;  5AQL A;  5BN9 A;  5JVG L;  1YIJ N;  1BU6 O;  4FWQ A;  1J6Z A;  3WT0 A;  3QML A;  5JIC A;  4BC5 A;  1BWF O;  1BDG A;  3KWI A;  3VGK A;  3H46 O;  1IG8 A;  2W40 A;  1DEJ A;  5AQO A;  4QS9 A;  3CMA N;  3DXK B;  1XUP O;  4H0V B;  1YHQ N;  2ASM A;  2QWP A;  3GOI A;  3VEZ A;  3Q7B A;  3HOT A;  3D2F A;  4FO0 A;  4RWT A;  3W3D A;  3C6H A;  4IJA A;  1YXQ A;  1E4F T;  3CCU N;  2PFU A;  2RE2 A;  2FLO A;  3M5R A;  1VQ5 N;  2QWR A;  5AZJ A;  1N8R O;  4KH5 A;  1RGI A;  5LJW A;  4EHU A;  2HF4 A;  4JHD A;  3CC7 N;  2HBJ A;  2Q36 A;  3H1V X;  5AQY A;  2F9W A;  1Y64 A;  4HWI A;  1T3V A;  3BEX A;  5AFU H;  3O5B A;  4WFN L;  3WEE A;  2P9I A;  3M3Z A;  4GY2 B;  3SK3 A;  3C65 A;  5CHI A;  3ZX3 A;  5CE3 A;  2ZGY A;  3L0Q A;  4YOW A;  2E1Y A;  3DWL A;  3PIP L;  4DQ8 A;  4BG8 A;  4PL8 A;  2A40 A;  1U2V B;  4CJ7 A;  3D7E O;  3T7Z A;  1JCE A;  2AA4 A;  4DCH A;  1QVG M;  3MX2 A;  3TTD A;  2A5X A;  1NJI O;  5DM6 L;  4GNI A;  4FVU A;  5AQI A;  1HPM A;  3E9L A;  1BG3 A;  5KPR A;  3CER A;  3VPZ A;  3MCP A;  2D0P A;  1VQ4 N;  1JJ2 M;  4FWR A;  5AZI A;  4B1W B;  3GG4 A;  3TTC A;  3SAF A;  3HOS A;  1VQO N;  5M1K A;  2A6A A;  4FWK A;  3IUC A;  5LJV A;  2D1K A;  3EZW A;  3R8E A;  4BRC A;  2P9N A;  1YIT N;  3D2F B;  3F2K A;  3VF2 A;  3TU5 A;  1Q7Y O;  2ZJR L;  3I33 A;  4MDA A;  3FZM A;  3GBT A;  3MK6 A;  1HJO A;  2F9T A;  4NLB A;  5JLF A;  1NGI A;  5BPN A;  1MA9 B;  4JHD B;  1XC3 A;  3VEN A;  3AY9 A;  3CPW M;  3MN6 A;  3KWG A;  1GLC G;  3G71 N;  5AQF A;  1D4X A;  2FF3 B;  5ADX H;  3WEE B;  5LY3 A;  5GIO A;  2UYT A;  3ID6 A;  1QZ6 A;  3SMS A;  3VF4 A;  4DB3 A;  2YJE A;  1DGK N;  2YHX A;  2A3Z A;  4ISE A;  4ILG B;  3C7N A;  3OBY A;  2F7T A;  4PKI A;  4A61 A;  1NGD A;  5HL7 L;  1NGG A;  4JKH A;  4BRL A;  5GAE P;  3ULE A;  1NGA A;  2GUP A;  4CZJ A;  4BRP A;  4JKA A;  1GLB G;  1KD1 O;  3T69 A;  1IJJ A;  4ILJ A;  4YDU A;  1P8Z A;  2QW9 A;  4H0X B;  3N4Q A;  2GEL A;  4JN4 A;  2YI1 A;  1QQM A;  1Q18 A;  1GLF O;  1Z6R A;  5AQG A;  1DT9 A;  1CZA N;  2A42 A;  2Q0U A;  3EKS A;  1HKC A;  3QBX A;  5TKY A;  1VQM N;  5CR4 A;  4YOV A;  3AGK A;  3KHY A;  3VEO A;  4KH4 A;  3C0B A;  3M1F A;  5BPL A;  3PIO L;  2P9N B;  4BRM A;  1HKB A;  4FWN A;  5AQR A;  1W2B M;  3O1W A;  1RFQ A;  4A5A A;  2YHY A;  1T44 A;  2NRV A;  4B1Y B;  4C1N I;  3QB0 A;  2E20 A;  2I7N A;  2QA4 N;  3LDN A;  4CBU A;  4RCH A;  4RTF D;  3O08 A;  3EL2 A;  2BH1 A;  3A0I X;  1HUX A;  2GWJ A;  3OHR A;  3IFR A;  4NB4 A;  5AQH A;  3CCL N;  3PLA A;  1NM1 A;  1Q81 O;  3HBT A;  3DAW A;  2HST A;  3O9R A;  3J8A A;  2PAV A;  1HLU A;  3B8A X;  1R59 O;  3G6E N;  5TKW A;  4B1X B;  3MN9 A;  3NMU A;  4H5W A;  2OAN A;  3D2E A;  3CJ9 A;  2CGK A;  2HBM A;  3ULE B;  2P9U A;  3QDK A;  3NVK A;  4K41 A;  4H0T B;  2YX6 A;  2HF3 A;  3JXU A;  2HBK A;  3O9T A;  4OPH A;  4CD3 A;  1YUW A;  3IMX A;  1K8K A;  4H5T A;  5AQJ A;  2H3G X;  3EE8 A;  3H45 C;  4FL9 A;  5B8H A;  2IVO A;  1YAG A;  5GIP A;  3M6G A;  3ENH A;  5BRE A;  3N4P A;  1M1K O;  3E66 A;  1X9J A;  4O5F A;  1KQS M;  2QM1 A;  4JAX A;  4BRE A;  4JKC A;  4BGB A;  4IDH A;  3ENB A;  1ATR A;  2ASO A;  4XH5 A;  5AQT A;  3VEV A;  3UKR A;  4YOY A;  3O9S A;  1MWK A;  3MN7 A;  3VER A;  3CJA A;  4JKG A;  5AQM A;  3J7Z O;  3P39 A;  4YOU A;  3CC2 N;  3DJC A;  4H0Y B;  4U67 L;  1RDW X;  1QQO A;  4IFE A;  4A2A A;  2NNW A;  2JWL A;  4B1V A;  3O1B A;  5C10 A;  1NGB A;  4QS7 A;  2P9K A;  1S22 A;  3DXM A;  3QFU A;  3WQU A;  1KXP A;  5BN8 A;  2A41 A;  3D2E B;  4BRF A;  4YDU C;  4M7X A;  1K9M O;  4XEI A;  2DPN A;  2P9U B;  2OTJ N;  1C0G A;  1W97 L;  4WQ4 A;  5JVH L;  4WCE L;  3I55 N;  4BR2 A;  4CZG A;  5FPD A;  1JCG A;  3ZEU A;  3LM9 A;  3S41 A;  4NO7 A;  1K8K B;  2QWN A;  3E9P A;  1BOT O;  3AAP A;  3FZK A;  3H1Q A;  3P4I A;  4OPA A;  2E2O A;  3FGU A;  2VYP A;  3KZB A;  4MLE A;  4MO5 A;  3BP8 A;  4C1N K;  4CBX A;  2FSN A;  5H1S Q;  5C2F A;  4AM6 A;  4BR7 A;  4BRD A;  1YF5 L;  3O80 A;  3W0L A;  4H5R A;  4K25 A;  1YJ9 N;  3BUZ B;  3CCS N;  4BRH A;  2WFB A;  4WF9 L;  4XH4 A;  2ITM A;  4BRN A;  3BF3 A;  4FWL A;  4F9O A;  3C6A A;  2P9L A;  3L6Q A;  3SAH A;  1ATN A;  3O6W A;  4JKB A;  5EOY A;  2VGM A;  4MDB A;  1VQP N;  3UKR B;  2QWO A;  1HX1 A;  2QEX N;  2YCH A;  4AM7 A;  4WQ5 A;  3R3L A;  2PBD A;  4FPA A;  3MWT A;  4JKG B;  5C0Y A;  4K43 A;  3TTF A;  3H6E A;  4A62 A;  4HTL A;  2NRT A;  2YHW A;  2V7Y A;  3KK7 A;  3MDQ A;  1OKJ A;  4AF1 A;  4WFB L;  3CCR N;  1SZ2 A;  4GV6 A;  5M1P A;  3CJ7 A;  4YOR A;  5GAG P;  4EIA A;  3ATV A;  2P9K B;  3DXM B;  2JWK A;  3G25 A;  4KH6 A;  5C2D A;  5AQZ A;  2OTL N;  2HOE A;  2VGN A;  3L4Q A;  5HOO A;  1KAX A;  1LOT B;  4Z94 A;  5F0X A;  3CHW A;  3FR0 A;  4H5V A;  1EO1 A;  2BTF A;  3O9U A;  3JS6 A;  3DLL L;  1E4G T;  4ISG A;  5E26 A;  5AQS A;  1V4S A;  4CZL A;  3ZEU B;  1TYQ A;  3VES A;  5M1N A;  2NRH A;  2P9S A;  5I9E B;  3GE1 A;  3TSQ A;  4CZE A;  4BC3 A;  3CJC A;  4BC2 A;  4LC9 B;  5AQQ A;  2NRZ A;  4PKH A;  4OO1 J;  3WQT A;  5KQ8 A;  5AQU A;  1MDU B;  5F1X A;  3LDO A;  3A5O C;  1K8A O;  2IVP A;  3LDQ A;  3R6M A;  2P9L B;  3R1X A;  3WXM B;  4CD1 A;  1U6Z A;  3CIP A;  4PKG A;  4XH1 A;  2E2N A;  3U4L A;  3OW2 M;  2QTD A;  2V52 B;  2FSJ A;  3GL1 A;  4BR4 A;  1NGJ A;  1YVN A;  4O8U A;  3WXJ A;  3MN5 A;  3OBW A;  3H3O B;  4H5N A;  5BRF A;  3UKU A;  3L4I A;  1LCU A;  3ENO A;  5AFU A;  4A57 A;  3VTH A;  1BA0 A;  1S3X A;  1ZC6 A;  5AR0 A;  3AAQ A;  4BR9 A;  3CCJ N;  4L3Q A;  1Q82 O;  4YOX A;  4GVE A;  3GDQ A;  2FXU A;  4BRQ A;  4BG9 A;  4I6M A;  2W41 A;  4JKF A;  4BVP A;  2GWK A;  2WUS A;  3UE5 A;  3RVC A;  1ESV A;  5AQV A;  5KQD A;  4WQ4 C;  3VOV A;  2CH6 A;  3A5M C;  3ZET A;  1K73 O;  3AGR A;  4IO8 A;  1VQ8 N;  2D0O A;  2QWL A;  3BF1 A;  1BA1 A;  4JNE A;  4B9Q A;  2ZJP L;  4GV3 A;  3I56 N;  2NRR A;  2D4W A;  3CCE N;  2FF6 A;  3HM8 A;  4PHT X;  5C15 A;  3MCA B;  3CCM N;  3LDP A;  3EKU A;  1VAZ A;  1JCF A;  1TYQ B;  3O9Q A;  2WC9 A;  2YJF A;  2P9S B;  3CCV N;  4IOX A;  3Q7C A;  1DKG D;  5DM7 L;  1KAY A;  2QWQ A;  4IJN A;  4PL7 A;  4BC4 A;  5BPM A;  1SAZ A;  2NRX A;  3FZL A;  2ZJQ L;  1NGC A;  4A2B A;  4Y0W A;  1ILY A;  4J8F A;  1YJW N;  3KVG A;  3SMP A;  4MLH A;  3IKM A;  4WQ5 C;  5AQX A;  2E2P A;  3CJB A;  3NVM A;  2EWS A;  4BR0 A;  1YI2 N;  2Q0R A;  2E88 A;  5E84 A;  3UKU B;  2CGL A;  3A5N C;  5ADX A;  4A59 A;  3EE9 A;  1S72 N;  4WFA L;  2QWM A;  4FSV A;  4BRI A;  4CZI A;  3CXC M;  5F2R A;  1NGF A;  3IDH A;  4I6M B;  1VQ6 N;  1Z05 A;  5BR9 A;  5GIN A;  4BRA A;  1VQ7 N;  5KPT A;  1KC8 O;  3SLC A;  3CME N;  2KKZ A;  4FWM A;  3ZET B;  4JKD A;  1NMD A;  1KAZ A;  3HI0 A;  1QQN A;  3HTV A;  3U9D A;  5M1F A;  2ASP A;  1VQK N;  3ATU A;  5AQP A;  4NLC A;  3SJH A;  2ZGZ A;  4R79 A;  1GLA G;  1P90 A;  2WBN A;  5GAD P;  3I8B A;  3TPQ A;  2I7P A;  1SQK A;  4JK8 A;  3SBT A;  3P31 A;  4JD2 A;  4UY8 O;  3O8M A;  1QHA A;  2NZT A;  3RSE A;  3CCQ N;  2Q2R A;  2CGJ A;  4FPB A;  1XQS C;  3TSU A;  3EO3 A;  2QI2 A;  2GEM A;  2AP1 A;  3P38 A;  4U7B A;  3MX5 A;  3D6R A;  1OVY A;  3WXI A;  5AQK A;  2IVN A;  4FWP A;  3WXK A;  2E8A A;  4O8K A;  2GTD A;  5KPZ A;  1V4T A;  2BUP A;  4BY9 C;  3K9K A;  5MLC Q;  1TUU A;  1YJN N;  3H3N O;  4MO4 A;  3A8Y A;  5GAH P;  4FWS A;  3VF6 A;  2HBL A;  2VCP A;  5C12 A;  3ZYY X;  5JLH A;  4IWV A;  5BRD A;  4WYB A;  1EQY A;  4CZF A;  2IIR A;  3FZF A;  1GLD G;  1NLV A;  4IO9 L;  4H0P A;  3E9O A;  3VEY A;  1HKG A;  5EVZ A;  5M1O A;  1X3M A;  3VGL A;  4IOC L;  1G99 A;  3CC4 N;  2E1Z A;  1QVF M;  1RDU A;  5AQN A;  5AZJ B;  3QBW A;  4EAH D;  2KLA A;  1BO5 O;  3CQX A;  4A5B A;  5JMV A;  2J4R A;  3F5T A;  3ID8 A;  3CI5 A;  4BGA A;  2FSK A;  2P9P A;  3HSC A;  1WUA A;  3MMV A;  1NGH A;  5FPM A;  4BQL A;  3TSP A;  4IOA L;  3CD6 N;  2Q1N A;  2ZWH A;  3QIC A;  4BRK A;  1O13 A;  2P9I B;  3CJ1 A;  3E1Y A;  1GLE G;  3U9Z A;  3K9J A;  4FWO A;  5ELZ A;  4JD2 B;  3QFP A;  2HMP A;  3ZX2 A;  5EXW A;  3R9P A;  3WUH A;  1VQ9 N;  2E2Q A;  4M7Y A;  2Q97 A;  4JK7 A;  2RHK A;  3RSE B;  1ZBS A;  3AAR A;  4CZH A;  4H0O A;  4KBO A;  3CF5 L;  1C0F A;  2Q31 A;  3O4W A;  4BQZ A;  3FFK B;  4BRG A;  4YOT A;  5FPN A;  4H03 B;  3VET A;  3EN9 A;  4IEE A;  1GLL O;  4QS8 A;  2V7Z A;  1X3N A;  3LDL A;  4JK9 A;  4EHT A;  4C23 A;  1MWM A;  3SBG A;  1NGE A;  5AZI B;  5BRH A;  2CH5 A;  1WOQ A;  4BRO A;  3VMF B;  4ISF A;  3DXK A;  4IZ9 A;  1Q86 O;  1T6C A;  4K42 A;  3FZH A;  3U8X A;  3A5L C;  5M1Q A;  3VEX A;  4M63 C;  5AQW A;  1ZXO A;  2GX9 A;  2QXL A;  4IXC A;  4CBW A;  4DKW A;  3CQY A;  3SAG A;  3HRG A;  3FLC O;  4EFH A;  1VQL N;  4B1Z A;  5EX5 A;  4CZM A;  1NWK A;  4JKE A;  2ZF5 O;  5FPE A;  1H1V A;  3G4S N;  4BR5 A;  3OA9 A;  2KHO A;  2P9P B;  4E1J A;  1NBW A;  4ILH A;  1VQN N;  3HZ6 A;  4IEI A;  3WXL A;  1T6D A;  4JEP A;  2NLX A;  1QZ5 A;  4FOI A;  1ATS A;  1GLJ O;  3MWP A;  4B1U B;  3LL3 A;  1BUP A;  4CI6 A;  5EY4 A;  1M90 O;  3VGM A;  3C7N B;  3LM2 A;  4G9Z A;  3ZX0 A;  1U2V A;  3FE1 A;  1SS6 A;  3CET A;  3UB5 A;  2VWB A;  1TUY A;  3VEW A;  3CPE A;  3VTI A;  3F9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...