3RVKA

Structure of the chey-mn2+ complex with substitutions at 59 and 89: n59d e89q
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
MADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTAQAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
total genus 45
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rvkA00
5KQGA 2OQRA 1UDRA 3FGZA 1A04A 1DBQA 1YMVA 3Q9SA 3H1EA 3LKVA 4YLEA 1ZDMA 1ZGZA 1CEYA 3IP6A 3OLVA 1XHFA 2CHEA 2VUIB 3H6HA 4KZKA 1QQBA 1Y1LA 2OENG 3HK2A 1A2OA 3BBLA 1Z2DA 3C97A 5TQ2B 2P4UA 2RJNA 1JWLA 2E4XA 1PNRA 5GQSA 4TMYA 4NCAA 4RXTA 4RY9A 1Z17A 1ZAYA 3BRQA 1YIOA 1NY5A 4MQEB 1FFGA 1SRRA 2LPMA 1MB3A 4LDZA 8ABPA 2FVYA 2JBAB 2R4QA 4P98A 1A0OA 3RVLA 1P6QA 4MS4A 4RKQA 3O2QB 4EYGA 3I5AA 4MR8B 3RVSA 2WMYA 2PE5A 3JPWA 4P1ZA 5FWXA 2IPMA 3QLVA 5EWJA 2WY2D 3OQMA 3LMKA 3R0JA 4MS1A 4ZPJA 3KG2A 2B1JA 1LJUA 2HQRA 1LK0A 2MYTA 3MMNA 3EQZA 4RXMA 4HYEA 4JASB 4YS6A 3D02A 4WXMA 1QMPA 1JDNA 5HKOA 4N41A 2MSKA 3EGCA 3T8YA 3N0RA 3IP7A 3Q7TA 1AB5A 1JF8A 3EODA 1M2EA 1ZGGA 4KVFA 4XLTA 4MLDA 2HPHA 4G0XA 3MIZA 1DBPA 1JDPA 2QW1A 2FLKA 2JCGA 3EAFA 2IOYA 2R25B 1C4WA 2A9PA 1NXTA 2YHAA 3CZCA 2QU7A 3MF4A 1F51E 4Z9AA 3LUGA 2IDMA 4LE0A 5TPWB 4G0YA 2L19A 1L5ZA 3JS5A 3I45A 1JL3A 3KYIB 1K68A 3O75A 4L85A 4RK5A 1H9CA 1KRXA 1USKA 2X7XA 3JVIA 3KKEA 2A9RA 1RPJA 3QEKA 4HNSA 4RK7A 5FWYB 2W42A 2VYCA 3LUKA 2I6FA 2M98A 1EFAA 3N8IA 3O1HB 5EWLA 3QELB 3P9YA 4EVRA 4LE2A 2AYXA 3H5OA 1KMIY 4GNRA 2LBPA 4UHKA 5HQJA 3M9XA 4CBVA 2JVKA 3O74A 3HSYA 6ABPA 3GA5A 2A9OA 1QO0D 3GL9A 4WZZA 4YGXB 1DBWA 3CLKA 3QLUA 4RDCA 2GKGA 1DCFA 3CRNA 2IYNA 3CTPA 3GV0A 3SAJA 5EWMA 4ETIA 1TLFA 1QNLA 1PHRA 4G86A 4NICA 2V0NA 1OXKB 4E7PA 3F6CA 2A9QA 3MQ4A 1U04A 3O2SB 1P2FA 3CS3A 3LUDA 3GRCA 1E6KA 2FLWA 4KK4A 5FWXB 5ED4A 2VK2A 5IX8A 2FQYA 4KFCA 3SY8A 5KWSA 1VLZA 4EUKA 4F11A 3H5WA 1DG9A 3MYYA 2HJ9A 3LUCA 1ZITA 4LX8A 5IEBA 2NT3A 4N03A 9ABPA 2GWRA 1Z2EA 4XASA 3C3MA 3FFXA 1DRKA 1NATA 3QEMA 4RU1A 5FWYA 1AB6A 3OLZA 5CNJA 3JPYA 4Z4EA 1DP4A 3HV2A 2FXIA 4D74A 1NXXA 4IRXA 4ETNA 3RQIA 2MSWA 3H5TA 5T3YA 3SQNA 1APBA 2QZJA 4IF4A 4JP1A 2E4VA 5FBKA 3DLBA 2RGYA 3TMYA 1M5UA 3FFTA 3IPAA 2E4ZA 3A3KA 4EY3A 3C3KA 4G0OA 2DRIA 3T38A 2FQXA 4N47A 4YRZA 2MYUA 3N6VA 2PJUA 3NHZA 4NCBA 5EWJB 3RVQA 1PEAA 1DJMA 2IPNA 1Z15A 5F64A 5C5EA 1YMUA 3N0WA 3K9CA 4ZYLA 4RY8A 2LP4Y 2FEPA 1VRVA 4YP9A 1GUDA 5IUKC 1NTRA 4NQRA 4KREA 3I09A 3SG0A 4KRFA 2JK1A 4MQEA 4G0MA 4N0QA 1GUBA 4FE4A 5ABPA 3MM4A 4UHJA 4XXHA 3N75A 2WWVD 5JNUA 6CHYA 2PAFA 1ZH2A 1NXVA 3LUJA 3CKMA 1USGA 4Q6WA 1YTUA 1JHZA 3KHTA 2XDYA 3LUAA 4ETMA 3RVOA 3FMVA 1Z13A 3JVDA 3OM0A 2QR3A 4PE5B 5DCLA 3HCWA 3KJXA 5JNRA 2JVIA 5HM6A 2FTKE 3W9SA 1CYEA 1QP7A 3B2NA 1RNLA 1EHCA 1K66A 1ABFA 4ZJPA 5IULC 3TO5A 1E6LA 2RDMA 1C0EA 3CG4A 4RK0A 1PEYA 3VNAA 3N0XA 3NHMA 4GPAA 5KI6A 1JFSA 1EAYA 2QVGA 4IMIB 4L4UA 2FMIA 1NXOA 1RXIA 3D8UA 4IGAA 5KQLA 2PUCA 4MR9A 2LIVA 5FBHA 3QEMB 2JRLA 2L17A 3A0UA 3CG0A 2RJOA 1ZH4A 3ROFA 5C5CA 3Q7SA 4KMRA 4YWHA 7ABPA 4KPYA 2R47A 1U2PA 3KS9A 5IC5A 4Z4HA 4JOQA 4PYRA 3HXMA 4Z99A 5KC8A 3LFTA 3I42A 4B09A 1YK0A 2HQBA 3A10A 1SXHA 2E4YA 5CNMA 2N9UA 2ZWMA 5CHYA 3C3WA 5TPZA 4MS1B 3EULA 1LJLA 2PKXA 3O1JC 1GCGA 3QLVC 4YCSA 3OMWA 1U0SY 4WUTA 2QVCA 1D2AA 4KV7A 1FFSA 3FDFA 5EWLB 2NZVG 4RKRA 1D1PA 3T6KA 5KC9A 1CHNA 2QSJA 3HUUA 3H6GA 4D6XA 3NNNA 4S04A 2FKAA 4RZSA 3LUFA 4MS4B 5JS2A 3O2JA 2ZAYA 2F8TA 4MQFB 3DGFC 4LE1A 4MYRA 4Y9TA 2PUEA 1QPZA 3HEBA 4RS3A 3NBMA 4RSMA 5IBQA 4W5RA 4G0PA 2BGGA 1FSPA 4Z9BA 2GI4A 4FB4A 1TVMA 3OLYA 1ZESA 3IDOA 4G0QA 2P9HA 1KRWA 3BRSA 5JNVA 1ISRA 2ID9A 2R48A 4WWHA 3KLOA 1VKRA 3BREA 1BAPA 4HNRA 4MRMA 3M9WA 2FEWB 5HSGA 1DZ3A 3TD9A 4F8JA 3CU5A 3DZDA 4M88A 1RXEA 2WJWA 3ILYA 3QX8A 4O5AA 5IUJC 2L18A 1P8AA 3EJWA 5IUNC 4MGEA 3E3MA 4KNYA 4O1IA 5JNSA 4F12A 4JB0A 4F3TA 3KLNA 3GT7A 1D1QA 4JAVC 3RVNA 3ROTA 4Q7EA 1J56A 2FQWA 4RY0A 5TQ0B 2FMKA 1NXSA 3GBVA 3O1IC 2FN8A 2PL9A 3LTEA 4HNQA 5JNWA 3ILHA 3EDCA 3HZHA 4RV5A 1T34A 4FE7A 4WXEA 3CNBA 4W5NA 1JBEA 1ABEA 4QYWA 3URMA 1YVUA 3F6PA 2JBAA 5BQ3A 2WRZA 1E6MA 1EWVA 4XAQA 4XFKA 1YK1A 3HDGA 1PNTA 4IILA 1DC8A 1NXPA 1GCAA 3F73A 4RWEA 3QLUC 1OXBB 1LBIA 2PUGA 5DKFA 1MIHA 3H5VA 4W5TA 4MR9B 1Z16A 4KQ9A 1IIBA 4NV3A 3A0RB 4H60A 4Z4IA 4ZMSA 4MR7A 3K4HA 2B4AA 4OTZA 5PNTA 1MAVA 2IKSA 3SNKA 4JA2A 4W5QA 3HVRA 1Z12A 4E7OA 4EYQA 3HDVA 3GYBA 1BDIA 1JYFA 2H0AA 1P6UA 4EVSA 4IMJB 3NNDA 2H3HA 2MSLA 1BDHA 1BDJA 3IP9A 1F4VA 2E4UA 3TB6A 1SXIA 4LZLA 4Q6BA 1I3CA 2LUOA 3QLTA 2L2QA 3Q15C 4H3HB 4MS3A 3VNBA 1MVOA 2FMFA 3H5IA 4QICA 4LDAA 1ZY2A 4Z4GA 5B3JA 3HS3A 2KYRA 1M5TA 5IEJA 2AYZA 1QQAA 1PUXA 1ISSA 1USIA 3Q7RA 2FSPA 2PUDA 1VPWA 1EWTA 3CFYA 1FQWA 1Z25A 3RVRA 1TM2A 2IPAB 4TN5A 1S8NA 1SD5A 3EQ2A 3OMXA 4W5OA 4RK6A 3JTEA 2F8SA 5EWMB 5KQMA 3UK0A 4ML3A 1JX6A 1RZRD 3QX9A 4Z4CA 2NUBA 5TPWA 2FEKA 3OLWA 4MAAA 5E3JA 1XHEA 1W25A 2E4WA 1M2FA 2WB4A 2GX6A 5I4CA 5DGCA 5TQ0A 3HO1A 4F06A 1TJYA 1GLGA 2ID7A 3IP5A 4PICA 3HJFA 3L6UA 3QELA 3OQNA 1QO0A 2PL1A 3L49A 5TPZD 1JLKA 5BRJA 3DGEC 4OBBA 1NXWA 3RH0A 2YHBA 3IPCA 5TE9A 1URPA 5TQ2A 4PZ0A 3RVMA 4RK4A 2QV0A 3C6QA 3OLXA 2NZUG 4RXUA 1LBHA 4MRMB 2PMCA 1DC7A 3E61A 1KGSA 2GBPA 1TMYA 3KSMA 3H1GA 5KQPA 2IPLA 1XWWA 2TMYA 1ZHHA 1L5YA 3OO0A 4N76A 1JH9A 4EGSA 1EWKA 2CD7A 4EYOA 3LKBA 1BVHA 4MLCA 2Q5CA 1E2BA 3Q41A 5TQJA 4DN6A 1W9HA 4YV7A 4MQFA 1YS6A 1WETA 1B00A 3KCNA 3OM1A 4PEVA 3OQOA 2FW0A 1JFTA 4S05A 4LRQA 5T7BA 5D2CA 4O1HA 1RZRA 3O21A 2JB9A 3RVKA 1ZVVA 4WT7A 4D6YA 1YS7A 4KQCA 4H3KB 1D5WA 1QP4A 1D4ZA 4MR8A 3HUTA 5B3JC 4OLAA 3UUGA 1JYEA 4KK3A 4DQDA 3H5LA 2MYNA 1SXGA 4G0ZA 4XARA 3SM9A 4MR7B 5DTEA 2PUFA 3GWGA 1DRJA 1FFWA 3DBIA 3JY6A 3H1FA 3RVJA 2QXYA 2CHFA 4Z0NA 1Z26A 3DLHA 3FFWA 2FMHA 4EYKA 3G1WA 3GBPA 2M1ZA 4YR7A 2CWDA 3MA0A 2WJAA 4QPJC 2MYPA 2PUBA 4MPTA 3KTOA 4N0PA 4RK1A 3RVPA 2FN9A 4OATA 5DLEA 4DADA 5BR1A 3CZ5A 2PLNA 2O20A 1QP0A 2HSGA 4MS3B 4OLBA 3G85A 5GOTA 4Z4FA 3TX6A 3M6MD 4YO7A 3LOPA 3HM9A 5JS1A 4TLMB 3CHYA 5CNKA 3F7NA 4G97A 1DCKA 3OO1A 4JB2A 1U8TA 2VUHB 3S99A 4OG2A 1MB0A 3T95A 1ZN2A 4QYMA 5BRAA 3BILA 1R8JA 3LUHA 1QKKA 3NNSA 1BA2A 2J48A 2NT4A 1JFVA 3N53A 3QK7A 4EVQA 2HQOA 1U2QA 1DCMA 4TLLB 1HEYA 5CNIA 3UKJA 4ZMRA 2JVJA 3KYJB 2PUAA 5JNTA 1Z18A 3H75A
chains in the Genus database with same CATH superfamily
3ESRA 1X7WA 2PRIA 1JNXX 3ENVA 2HWKA 2BTQA 4LF4B 3C0KA 1CSEE 5B1EA 3VR2A 3FYUB 4HRXA 5DCUA 5DO9A 5CYGA 4JI6B 3LO5A 1SZCA 3OF5A 4LPKA 3TSYA 1TYDE 4RJ2A 4YJ3A 1SURA 2Y9PB 1XRSB 2ZBQA 5DP1A 5AI4A 5LA6F 3R75A 1JR6A 2FQ1A 2C98A 1ITZA 1NA5A 2NO4A 4IO1A 5ESWA 1MG5A 2CLIB 2NSDA 3R7BA 3ORFA 3ONWA 3WL5A 1QC5B 2UZ1B 3ZHRA 1T5TA 1PNRA 4FPXA 4TMYA 1E5QA 1WHSA 2N0SA 3QPUA 3EISA 1BKYA 2BFMA 2A30A 1VE3A 5IYZF 3LGAA 1P5JA 1H2XA 1AH2A 4IJUA 2Y0BA 3UGKA 1YXMA 2XYRA 4XWOA 2ETXA 2R4QA 3EPRA 4RMJA 4DUZB 5CD1A 2HXSA 5JSHA 3VR4A 3WE7A 1RTTA 2BM0A 2XSZD 1QYIA 4ZVQA 2CWWA 3R5HA 1ZCAA 3RVSA 2IS2A 3T3NA 4P1ZA 2NOAA 2XUIA 3MS4A 2OTCA 2YVQA 4S1PA 1ONPA 2IEDA 2XODA 4IJVA 3U81A 3QE3A 1AA6A 3PRYA 4MS1A 5B2ZA 4BNYA 4F5EA 3F6RA 3MOGA 4MP8A 3SZ3A 4L9SA 3V7NA 4JBNA 1RJFA 2X5XA 5CCBA 1Z2PX 4MW0A 1QMPA 3ZDFA 1I7LA 2RGUA 4U6SA 3G68A 4IDAA 1A1SA 2BCEA 1DIRA 3PNBA 4PNZA 1S4QA 1T2NA 2FSIA 1EH5A 4D4HA 1M2EA 1EVKA 1BJTA 1J99A 1XAHA 1P4JA 4Q9DA 5KYKA 4UDXX 5U1PA 2VXCA 4W5HA 2N42A 1H0KA 2P2NA 2GQ0A 2JCGA 3QU9A 2ZW9A 3EAFA 5LB2A 5DTIA 1BX0A 2RAVA 4NBSA 3ZN2A 2QUKA 4KQ6A 3VU1A 3BXPA 3IBCA 4LRUA 4EO4A 4JJEA 4TLBA 4F3CA 1FDIA 3S5JA 2R7LA 4YFYA 4RQTA 1JHOA 1WJGA 3GK3A 1P4RA 4I7EA 3PTZA 3SBEA 4EG3A 2VKTA 4CKZA 1L5ZA 2VN8A 1WF6A 8OHMA 3GLIA 4DV1B 1B6GA 3BE4A 3IQGX 1UJ5A 2JIZD 2ZJ0A 3KTFA 3NWEA 4QXPA 1LI5A 1N2GA 3BIOA 3AZQA 3KKEA 3R0XA 5BNTA 1V5EA 1W0CA 4MVWA 4TX1A 2WW8A 3K0HA 3AUUA 4QYTA 4X54A 4DT1B 1WY5A 3QELB 1ZL2A 4UTNA 2I29A 4CDMA 1E3MA 1NX9A 3FCSB 1EJ0A 2V7UA 3FPHA 4M4SA 5T4BA 1TFRA 2E21A 2YIJA 3HU3A 3OPVA 4QEKA 1GZDA 1IHYA 3NASA 3PL5A 4BFUA 2C82A 1FRFS 4WGGA 2C7GA 3QXXA 2XH8A 2DAPA 3DB1A 5FYQA 2ZB7A 2D8AA 1NYQA 2J9RA 4G37A 3SKVA 1POWA 2X8WA 4BV2A 5IF9A 4RDCA 2VHCA 3AR6A 3P9CA 3DHYA 1VA5A 3PFKA 3HDTA 3QI7A 1N2HA 4TKZA 5HIAA 1K0UA 1GTL1 1Y5IA 2VZLA 3DT6A 3LOQA 3M3HA 3FGNA 1JXAA 4GMHA 4PZDA 2UU9B 3NEPX 4R1LA 3WGOA 1C7FA 1E6KA 1K8QA 4KIWA 1UBUS 2G83A 2A5GA 4E07A 4ENTA 2RGDA 1TVCA 2VK2A 3CLSD 3IBYA 1UADA 2XWSA 4CM4A 4JJIA 5CPBA 1B0PA 3EGDA 4AYXA 5D87A 1X7YA 2PX0A 1BE0A 3CH7A 4BO8A 4DKXA 1VLJA 1AXEA 5DN6D 4JT4A 1PHPA 3IUBA 3IXLA 2C1XA 1CNEA 2QTBA 5LSAA 3D0RA 3QEAZ 3MT9A 5IEBA 1QO7A 4N03A 2Q3MA 4N18A 2HU8A 1WPQA 4RQUA 3OJCA 4QREA 2JW5A 2FPKA 2UDPA 1KPIA 2ODPA 3R3YA 1JDVA 4MGKR 1FRQA 1KZ7B 2EARA 2BCJQ 1XPOA 1DKQA 1K5HA 4EG1A 3X1MA 3EGEA 1T43A 2C5FA 1QH0A 3PB3A 4MAMA 4Q19A 3ORYA 1FU8A 3F46A 3AI1A 1P1KA 1KP2A 1WMBA 2ZSKA 3BDAA 3U9TA 1T36B 3ZEAA 4H7JA 3UWMA 4FNGA 4EUHA 1NM5A 3IPAA 3L02A 3N8DA 4LF7B 1WZ2A 1LSOA 3R5TA 2ZTVA 2J5XA 5JADA 1B1AA 5H7XA 3V3TA 4B7XA 1XT6A 4NCBA 5T67A 2V96A 2HN9A 1XPUA 4XFDA 1FZTA 2PAAA 1DDGA 1NBME 3SLRA 4ZYLA 1NRJB 1MOZA 3QKRB 2IYEA 1ZC4A 3T7SA 4NQRA 3UMJA 3DS8A 3KC2A 4F6CA 3AWIA 4B4WA 1L2TA 3BVPA 1I32A 1WXGA 1TJ4A 4FR5A 2JFWA 3CVOA 3H2JA 2CY0A 3DXXA 4YP0A 3T5GA 3PZRA 5FFFA 1ZCJA 3K1TA 1R4MB 4P7GA 2J3QA 2GBIA 3LUJA 1P2SA 2H16A 4PAOA 2DTEA 3K70D 1C7RA 4GP6A 3VXKA 5MFZA 4GE0A 1HRKA 3W78A 3GNQA 4TMTA 1WW3A 4JVOA 4BECA 2CK3D 1LNZA 1NYLA 4X60A 2VHQA 3SIPA 3NX4A 1TUIA 4JJ8A 3EEIA 4JFAA 4NI5A 3UUEA 4YAIA 1LK5A 1E3IA 4OYRA 5JNRA 1LS6A 4ZT5A 2RKOA 1LQTA 1VHLA 1PYGA 2XHZA 4AX4A 1WEHA 1SPXA 2C31A 3KLPX 4Q4JB 5EHQA 4X45A 3DZJA 2Q2WA 4ZJPA 3UT5B 2H59A 1QYDA 4CYMA 4ZRDA 4AICA 4D81A 1PQPA 2ZSJA 3B85A 1GQ2A 2C2BA 5CA0B 3ON5A 2X4DA 1TYCA 1W34A 4F2DA 4MWEA 2I3GA 4CM5A 4M37A 5CA0A 1CS4C 3MCZA 4P7BA 1TUEA 2XMPA 1NXOA 2Q5JA 5JH7F 3CCCA 1Q44A 3V8BA 1KI9A 5GZ3A 1E2GA 1VG1A 2HSEA 2YZKA 3P2MA 2F3SA 5EQTA 2Z57A 3VTZA 3WS7A 4ZZIA 3HR8A 2HSJA 4DMRA 7ABPA 4YWHA 1Z07A 3PBKA 1DFGA 2WJVA 1T1RA 1ZC3A 4XVHA 5EP4A 3AFMA 3E2PA 3FJOA 3RRZA 4X94A 4J1TC 3I42A 3BHMA 2RB4A 3CNLA 2K7ZA 2QROA 2W6ID 4IVNA 4QDTA 5EGNA 1XZEA 1DKMA 4BVAA 1YZTA 2VJMA 1DIHA 2D0IA 4JEMA 2R65A 1LPBB 4PXYA 3VNVA 3CWCA 3STXA 3HKDA 3QKWA 1R50A 1TKAA 2IYUA 2QVCA 4XM0A 3T94A 3NVKI 3CV3A 4IUBS 3VPSA 4RTPA 4DEXA 2EX4A 1Z4QA 1FUUA 2A5FA 3HUUA 4DR7B 2AXNA 2BZSA 2X9LA 2IHZA 1OFTA 4DBLC 1J0DA 3AX6A 2RK4A 2GEFA 3HSSA 3O2JA 2IH2A 2WUGA 2GRUA 3IPRA 3ZD8A 1MJNA 4E1VA 4EW2A 1PJ4A 3FOZA 3ADDA 2HXYA 1DWPA 1MN6A 3EQ7A 3PLRA 1F8GA 2CLMB 2JARA 3OZIA 1OLSB 2BP7B 4JODA 3ZNOA 5CYOA 3KLBA 4D5GA 4MINA 1T2CA 2G6TA 4PSCA 5EKXA 1P4HA 3R76A 3PZBA 2R48A 4NKRA 5EQFA 3TH5A 4YRDA 5TY0A 2ZAOA 3AIKA 1XTTA 2XRYA 2MSNA 3ICVA 5BW8A 4LHXA 5HSGA 1T8WA 1YR8A 3CU5A 4BNFA 2AN1A 2DKOA 1TQ6A 4I4TA 1NQOA 1R3UA 3HP4A 1H23A 1P7PA 1F3LA 1VCIA 2C54A 1PFUA 2FP4B 4FDTA 4DE5A 2CHQA 5LVAA 4ZAYA 2PBLA 2DFDA 1SBQA 3HUFA 4IZHA 4Z86A 2G9NA 5L3SA 1DS6A 1FJHA 1R88A 2MMCA 4MVJE 2FMKA 4Q7JB 1PJSA 3QA3E 5HRAA 3OF2A 4QECA 1UBGA 4MUXA 2PS3A 3J7AC 3EDCA 3LQ4A 4E31A 3E5MA 4LJKA 3ZZNA 5LQMA 1JBEA 2PKCA 2ID8A 1GCIA 1CF4A 4OBEA 4MPRA 1HF3A 2REQA 3HZZA 1SGWA 3OOJA 2C4WA 4JEHA 1JTVA 1QUEA 2YMQA 4G2TA 3RUIA 1KYXA 4C14A 3IL2A 4I55A 4NR0A 5HS6A 1E9DA 4QEZA 2D4AA 3F73A 1Y8RA 4WZAA 4DNFA 4ZZ0A 2F3TA 3MCWA 4KDFA 2ZS7A 4I14A 3VJLA 4OM7A 2P1ZA 4DV0B 3K4HA 1COWD 4A8JC 3SNKA 2IKSA 1QE3A 3NWBA 4E7OA 1V5GA 1HLPA 3HM2A 4PWZA 4ED9A 5FUBA 1ISGA 2PLRA 3EIWA 3OHMA 3N05A 3W6UA 3SKXA 5DFAA 1VI5A 3ASUA 4A8JB 1E2FA 4KLRA 4HYQA 1S96A 4UBOA 5EYPA 5HK8A 1Q20A 1PEDA 4Q7MB 3SVZA 2ZREA 3IT1A 4H3HB 5CLLA 5FI1B 1ESDA 3I28A 1ZSVA 5C7YA 3EZFA 4B3BA 3H2IA 1IUKA 1ZY2A 1FY2A 1MABA 3K5HA 4XB2A 1V95A 3PI6A 5E4FA 1FTGA 2RK3A 2BMFA 4OUDA 2I0FA 5FTWA 5L3ZA 1D2NA 3AERB 1K4YA 4K6CA 4EYEA 3TGPA 4LKOA 1RLOA 1K06A 4PLWA 1JR4A 3PPVA 3PLNA 5CITA 5HKBA 3RAJA 2WB2A 5BSKA 1E2KA 1WU7A 4G5QA 1XO1A 2B34A 4O4JA 4ZPXA 1OQAA 3ASVA 1C29B 3T52A 4RVOA 4ZOQI 1Y3CE 1D2HA 1XVAA 1QZZA 2YV5A 2ZU0C 4TTJA 4I3HA 4OJMX 2EW2A 2YJGA 3IE2A 5C80A 2PX8A 5REQA 2B5WA 3P52A 1VJGA 4EARA 4K9RA 2OB2A 2EL7A 3ONVA 4Z4CA 2WUVA 4RDXA 4U6QA 1GRVA 1WTCA 1XHEA 2XX3A 2WOJA 4R3UC 4JLJA 4W8OA 1JE0A 4LW8A 2QMUA 3VYVA 3W04A 3U26A 2WB4A 5I4CA 2GHIA 3ZH2A 2FGKA 2B2NA 4Q7LA 3V97A 3C15C 4UM9B 3IP5A 4QPDA 4LSGA 1AQJA 5EIOA 4YJGB 1QO0A 1OYWA 2LZ0A 2IT1A 1AKMA 2C57A 1P2TA 4RD2A 2XEDA 1NXWA 2VT3A 2Q4EA 4OQ4A 4D82A 2X13A 5MN4A 2WQ6A 2C2OA 3TPCA 1JTEA 2OCDA 1FK8A 3S40A 1NVEA 4YMVA 3OCYA 1S0UA 4MIEA 4Y2UA 2OO5A 3C6QA 4BO7A 5C4MA 3G5TA 4TM7A 3MGGA 1P60A 1Q7TA 4HWRA 4EWLA 5BR7A 2E1RA 2F4NA 4RA9A 1M2NA 3DWIA 3ZX5A 2PKRA 4AQ7A 4L8LA 3T7EA 2IYFA 4M49A 5C7IO 3HN6A 1U9JA 1XZMA 3UT6A 2LCFA 2W8BA 2WTNA 1QFSA 2G9ZA 1NVWQ 3F3MA 4IR7A 4KIFA 4TV8B 1THZA 2J5RA 2IELA 3F97A 2ZWIA 5AQEA 1U2SA 2H29A 1D7AA 3OQNA 4P0PB 2AG0A 5HR5A 1ZRMA 2CXRA 1HTTA 4AP9A 4BNNA 4YV7A 1D8TA 4XIIA 1C3JA 1YS6A 3NHLA 2GTHA 2HD4A 1HK7A 2EFGA 1XCJA 1VE9A 5CYFA 3U4MA 3TOZA 2OPBA 4I9GA 4ROSA 3LOUA 2ZRCA 4B48A 1X80B 1OILA 4KIUA 3WGJA 2GK6A 2CNLA 1QMGA 3JR7A 1DPFA 1C9EA 3C6ZA 2W2PA 3LKDA 3BXHA 3BAZA 3NG1A 4OOEA 1KIAA 1L5KA 1ZO8A 2JI7A 3DV2A 3OG9A 3QPBA 4JB3A 1MX1A 3R7WA 4ANFA 4FUQA 1IDOA 2UAGA 2B3DA 1F0KA 1ZXBA 4QD3A 5FCDA 1F6WA 3RUFA 1M1NA 1Z75A 1HSZA 2DHRA 1UK8A 3D4LA 4MROA 5T64A 5C7LO 5CT9A 6AT1A 2CNDA 1Z6PA 4IVRA 1T4MA 3JYOA 2JGMA 4I50A 5EZQA 3HHEA 5DOZA 4PX5A 3GB9A 4RETA 3OD1A 1UJBA 1BOOA 2I7DA 3VAZA 5KNCD 3JX9A 1GITA 4X64B 4CIYA 5H8WA 4Q9NA 1TVKA 1VE5A 1Y7HA 2WD7B 1MD9A 4JOBA 4BFVA 2PT7A 3WGMA 1E8MA 5HW0A 1PJZA 1VGRA 2Y2UA 3G1WA 3P2EA 4XM2A 4YMHA 2VHVA 2WD7A 3EDMA 3GZ4A 5B58C 2O8FB 5LZ4A 4MPTA 1NRIA 1NRWA 3VDNB 4C4OA 2B1QA 4EABA 5JCOC 2MMGA 3PYLA 3VX3A 4LYEA 2H8GA 3ZTWA 1XMVA 3EVTA 3F9CA 4EH1A 1KZHA 1RKXA 2Y1XA 4DQUA 3D0OA 3LQKA 4PBRA 3LOPA 3CRVA 4S2UA 4F2WA 5K0BA 3EZ6A 2VNAA 2ZJAA 5K0EA 5CA0F 5EEHA 5SYNA 2XXAA 5KNCH 1MB0A 1OR8A 2O7NA 5F3RA 3WBJA 4C9BA 4JR2A 3VYUB 4JJZA 3LUHA 3ZLVA 3NP9A 1BA2A 1H1TA 4ZCPA 1M2HA 3QBDA 4YDSA 1XRMA 4UBIA 4ZDWA 1SVOA 4FGUA 1N8TA 4U8GA 5LXTF 1VFPA 4C08A 3KYJB 2HOQA 3O83A 1SC6A 4G1VA 5IU6A 2GJ4A 3RS4A 1G55A 1VM6A 2GN9A 1L5WA 3VJMA 2D74A 5HEKA 4I8DA 3BD9A 3QKSA 1ZUNB 2IEZA 2IKQA 4BLPA 3C7TA 2J9GA 2FMUA 1XHFA 3E03A 5DH9A 3ZQ4A 4YT8A 1TA4A 3BMNB 3Q5GA 3DQQA 2FSVA 1N3LA 2EZTA 1E9SA 2WYVA 4HEQA 3TLGA 3BBLA 5A06A 2EJCA 2JANA 2RJNA 3IURA 1U7WA 4ITUA 4MOWA 4RIFA 2QM0A 2BUCA 2PTHA 4TVKA 3WSVA 2XQFA 3GHHA 4V0OA 4ER7A 1K6JA 4GICA 3AEYA 4CL2A 1RXCA 1Y5LA 2HTFA 1SVSA 2FWPA 2EYQA 2QDXA 4QXAA 3F7MA 4BDTA 4J0KA 1E2QA 2VL7A 3D7RA 2GD0A 4JL6A 3PT9A 2D2XA 2V97A 3HVUA 3NC4A 5D3QA 4U00A 2Q5HA 3O2NA 5ES3A 4QBKA 4L95C 3AG5A 5TEVA 3R7FA 1FIUA 1EGMB 4Y6OA 1CHDA 3CF2A 4MR8B 4ECEA 4URVR 1XZGA 3B1XA 1E3TA 1FDOA 4IZIA 4B79A 5JYEA 2YKGA 3VO8A 9MHTA 3WDMA 2FLVA 2OECA 4AP5A 2WY2D 4F3YA 1KETA 1OKKA 5JMOA 4EW3A 4C30A 1B3RA 4LTMA 3THSA 4CGYA 3R5SA 2YH2A 4JASB 3OX3A 1XMIA 4YS6A 4CQLB 4DMGA 2QOEA 1FS4A 2VYFA 2CJWA 1ETUA 4YJKA 5GIOE 1LBQA 2I4RA 3OVMA 2W2KB 4O8CA 4U7HA 2YJ5A 3E81A 3IP7A 4I8XA 4L57A 3EOZA 1Y6GA 1YA4A 2XE7A 5DM1A 1AUOA 2ZAGA 3BJIC 3LCUA 3QVOA 2AT1A 1HNXB 3IUPA 1YFJA 3KEQA 3IE0A 1O96A 4EUSA 2ZOSA 3NWJA 4R1NA 5TGZA 3W6NA 2E37A 1XOIA 3JAMA 5JTUA 2JF0A 3DXZA 2ZTSA 3DTYA 3EGXB 4TKVB 1B8NA 5EJIA 3GJTA 4DZZA 2IX3A 2F3PA 4J3FA 3G9ZA 4PHCA 5T4EA 5AUOB 4OY3A 3VR0A 1VCHA 4Y67A 5UKDA 4G9EA 2AJ8A 4FMDF 4I2VA 5B4TA 1AV6A 4XDZA 4MP3A 2WU8A 3C41J 4H1VA 4YRPA 2QD4A 3OEHA 3EDYA 3DOCA 2JFXA 4GD3Q 3GVHA 3ACBA 1HQDA 5CM9C 4DR3B 3SX0A 3U44B 2WFLA 3X44A 3O1HB 1KS2A 1RKUA 2J8ZA 2HF7A 2QVBA 2YL2A 3MN1A 1PT7A 4UCFA 1A7KA 5F76A 4ZVOA 4E5UA 2RH9B 3H5OA 3HYCA 4L1KA 4U6NA 1IBMB 1CDEA 1AMNA 4YUYA 4ZT7A 3FSEA 4U0KA 1WDLA 2ON6A 2FP3A 2H2AA 3C3XA 5ERXA 1G4AE 3KSDO 4KMSA 1FBTA 3TQQA 1KO4A 4ZT4A 3TFQA 1G3QA 2D00A 5TEWA 3W1VA 3UMYA 1KO7A 3C5WP 1BIFA 3B5IA 3P9PA 4R1UA 2QUIA 4KO4S 4XUGB 2G5TA 1Y42X 2JD1A 4S1WA 4LA4A 3V32A 1BROA 2YY6A 3L0IB 3FB1A 4ONEA 2PMFA 4G86A 5LQCA 1T5LA 3GFSA 4QUBA 4RA9B 3QKUA 3WYCA 5G3ZA 4Y18A 3PLAE 1X1AA 4MXDA 3EW7A 5FWXB 3T99A 3L1JA 4BKRA 3GJ0A 2MSEB 5EIBD 3HCEA 2F59A 4TXNA 1EEXB 5AXAA 5AVQA 3TG2A 4EGQA 1NOJA 5IBRA 1KYYA 4TSFA 3RBAA 4AMYA 2O57A 3GA7A 2D2EA 1BKSB 2WE7A 3F1KA 1YB5A 4RE6A 2H4HA 2OHGA 4P3PA 2GWRA 3PJEA 3SCZA 1GR1A 3B2QA 1C3OA 1J21A 3TLGB 5HOQA 2N1BA 1YE3A 2IHNA 4O0MA 1OKKD 4HAVA 4FHFA 5J4VA 2QX9A 3UHFA 5BUQA 2V6MA 2G28A 5CDTA 4YT5A 5H70A 4IRXA 4YREA 3VX4A 3ASYA 2PQ6A 2QHXA 1IQUA 3PU6A 1KZ1A 2VT7A 1G5QA 3IHWA 3M0EA 3SYTA 3TBFA 4IIJF 1TJPB 1SVUA 3KVOA 1RP1A 1TQ8A 1YZKA 2EFJA 2P1DA 2QQEA 4PC3A 2RGYA 4Q1VA 3H5AA 3WZ2A 1C9YA 2ZYDA 3PDIA 4EP1A 3L4BA 4YTEA 4AZWA 1DC4A 4FEAA 3IEVA 2PJUA 1XRRA 3OJLA 4NYJR 4ARZB 4ZAZA 1E63A 2QPLA 4W6QA 4XSHA 4I5EA 3EYAA 2BLNA 1AHIA 3HB1A 2W0SA 2LP4Y 4TZ0A 1FDUA 4U9IS 2WJIA 4KE9A 3WIDA 4NWIA 1IXSB 5EI5A 3BSSA 2MR6A 4CDNA 2JKVA 3GFGA 5LKAA 3LT0A 1IB0A 4MQEA 4B7ZA 4N0QA 3D6AA 3U4IA 3UMCA 5P21A 2WWVD 1L7RA 4KMOA 4CXMA 1I3LA 4O63O 2X5OA 1O5OA 4YCDA 3OFJA 1M8JA 1NC3A 1ZINA 2IIQA 4WHMA 5KPJA 1JT9A 1FB5A 3I3OA 1D4FA 2V9PA 3I04A 3D59A 3JVDA 4ZA2A 3U4QA 1RLJA 1YQUA 1ELOA 1B2LA 5AM3A 1JHUA 4LVOA 2G0NA 1IHXA 1Z39A 4RVCA 4X8MA 4DLUA 4OQNA 4IEEA 4TRRA 2PPVA 1F2UA 4DR1B 5ESDA 2ZQ5A 3ETGA 1X7WB 5EMKA 4QULA 3ZWAA 1YD7A 3HKBA 4FP9A 2O14A 1NUQA 1UMBA 5IULC 1SQSA 4RK0A 1TCBA 2CL6X 4FU0A 3L46A 3W7BA 1TQ2A 5K3CA 2BKXA 4I1VA 1OAOA 4IZOA 1SUBA 1T91A 4KYUA 3T5CA 3UM9A 3N0XA 2ZU6A 4IDGA 2QVGA 3X2EA 1PS8A 1KYQA 4OO3A 3GVPA 3D8UA 3V1TC 1FBNA 3ODPA 3PITA 4GPIB 3NYWA 4YRFA 3WLFA 3C7CB 4AMZA 3E05A 1L5GB 1S3FA 1EGHA 3Q1KA 3K1JA 1PGOA 2A4KA 4P7KA 1J9EA 2EYUA 4ZU6X 2Q7DA 2R11A 2BBOA 2R86A 5F2EA 5BOSB 1I0LA 3E35A 5BUCA 3OPYI 4JLMA 4M0MA 4FIZA 5FPTA 3TMAA 3HXMA 1VZ3A 1E2HA 5KC8A 3IV9A 4TMWA 2OQIA 4GR9A 2ZYTX 1P7CA 2N46A 1MO6A 1I1NA 3RODA 3IAS1 4CMHA 2V4ZA 5KCMA 4EO7A 2QN3A 3EGIA 4LYFA 4AZTA 1P45A 521PA 1XEXB 5J2UA 4M1ZA 3QFTA 3S28A 1CR0A 4YP7A 3PQCA 2O1EA 3R3HA 1AKYA 3FDFA 3IKJA 4KIJA 5JCZA 4KX5A 1YBMA 1XTKA 3AJ8A 5D3MA 4F38A 4DCUA 4S04A 4G36A 4J0HA 2C8JA 3BH0A 3CJRA 3EGVA 2FKAA 3U7QA 5JSQA 3IBSA 2WYWA 3DE6X 2JHPA 3KYCA 3ZHQA 5JXHA 1N7JA 4YO8A 3OOWA 5KJCA 1L5NA 5BSWA 3TZBA 1A9PA 2CJXA 4GUAA 3GLGE 1E99A 4V2IA 1V8ZA 4G6ZA 4FBGA 4LOJA 4RSMA 1WMFA 3JASB 2HA4A 4PG4A 1U9YA 3RAEC 2CHUA 3B82A 4QDZA 1ZN9A 1JFFA 3VUEA 1MO5A 3K9LA 4FWBA 4M6WB 4NDAA 3L4KA 1Y6FA 4XGNA 2OZLA 4C7XA 2P5SA 2GETA 1D03A 3DZDA 3A27A 3LBFA 4M88A 3ACDA 4DG9A 1EUZA 5LLTA 6ADHA 1JI0A 4RPJA 2I6UA 5IC6A 1H2EA 2IU4A 2DPGA 3AJDA 1SCNE 4M0LA 1FMJA 2P90A 4KNYA 3MELA 3T1HB 1WBDA 2PRKA 3E3NA 1CP2A 3IFSA 1RJGA 4OMCA 4OXQA 4JLSA 4TXLA 2XI4A 2ZIEA 1TJNA 5JO9A 2B92A 2CXPA 4PVDA 4ER3A 4RV5A 3AFIA 1C9JA 1KYTA 4KXUA 3RBZA 4D0SA 5JYDA 1ABEA 3H05A 1CR1A 2WU0A 5CGZA 3RWOA 2QVLA 4M1OA 5JS6A 2B5OA 4A6DA 3AXSA 2Q62A 1VG8A 2EV9A 3F4BA 3HDGA 4BX9A 4E33A 1CUXA 5JAOA 3A3NA 4L8GA 2ZWPA 2ZEJA 1IK6A 2VJNA 3SSOA 3ZHVA 4CRWB 5CCEA 3FLEA 3TM4A 1SCAA 3L0ZA 1N5RA 2OC9A 4Z4IA 3BGVA 5C1PA 4H60A 2ASEA 5DRYA 2R6CA 2PMKA 3SP1A 2AVDA 2YYZA 2I34A 1KQOA 2QTNA 3I23A 4BFYA 2HO5A 2DWQA 4L6IA 2WQZA 3DP9A 3HCDA 1D2CA 1KKLA 1SIBE 2IIVA 4PN3A 3IP9A 4DB4A 3Q7QA 1SXIA 3SDBA 3ENKA 4C6TB 3HLYA 4ROTA 1CERA 1UPCA 5AVKA 1KYVA 1Y1PA 2WG2A 4V0RA 4HR7A 1FUEA 1E1LA 3DHEA 3FH0A 4BIIA 3AEKB 1V3UA 3NTXA 1GARA 4OJTA 3B1KA 2ESRA 3IDAA 1V25A 3MINB 2GN2A 3I62A 2FV8A 3MTQA 4EJSC 2CJPA 1BA3A 3CFYA 2NZ8A 4RNCA 1G3RA 2LCIA 1W93A 4HMPA 3WKCA 2QL6A 5CVUA 3P9ZA 3EQ9A 5E4JA 3KETA 2VSNA 3BA6A 1AF4A 2DTDA 3T1QA 4NE2A 2AFHA 4X95A 4EZBA 2GESA 3H9CA 3LGSA 2F8SA 3UAYA 4QBGB 1UM9B 2AQHA 1EJ2A 2QGZA 3K0AB 3DE4X 2Y0EA 1U5AA 5HTOA 4LOLA 4YJDA 4PYQA 2OBBA 1Z06A 1GQOA 3ZU3A 5MF6A 4KVAA 1ISJA 4E30A 5BT8A 4MI3A 4CEJB 4OSEA 4BVFA 4B75A 3E7DA 4F06A 3E9NA 3SN6A 4AJNA 2XYHA 4CQJA 5AKIA 4PHHA 1KE2A 4J0JA 3LFUA 4NV0A 2CFCA 4CKEA 3PHIA 4MPPA 2W7TA 1A9XB 1T8TA 2A58A 2R66A 3VKWA 4DDKA 3WAKA 2K5UA 2YWCA 1OWMA 2A6PA 2QV0A 2YR0A 2XTAA 2XUPA 1TK3A 1I6KA 2UXDB 1P9RA 2OXCA 3VR4H 4KU4A 2F43B 1BHO1 1AM4D 1L4MA 1ZCZA 1GFWA 3UV6A 3MMXA 3UFBA 1WSDA 5A5GA 1XWWA 3EUWA 1SXJA 5KSZA 2LGJA 4I1PA 2AG1A 1PWYE 3KZOA 1L7DA 2QXUA 4EPXA 1IXYA 1KIFA 3LKBA 4CN8A 3MRVA 1NW8A 2DH5A 2VC2B 1KR2A 3DCNA 3HNOA 4LNAA 1KOLA 4EY4A 3V7FA 3Q8LA 4BC1A 2XNSA 4ER5A 4P7FA 2GYYA 4D4JA 2F6RA 1LLDA 3L82B 1WETA 2NO9A 4OI2A 1PK7A 2ODNA 1KI1A 4C0LA 2VYND 3G8YA 3DH0A 3MUFA 4FYHA 3UOWA 1RZRA 1CUCA 4H6VA 3COJA 1HDYA 2GZ1A 4RANA 4ZV4A 3KWMA 4MVCA 1N92A 4A8PA 2GPYA 1JQEA 2RIRA 1EUDA 1GO2A 4KQCA 4RLQA 5CVEA 5EHIA 4B1FA 2GXAA 2H06A 1RI4A 4D9BA 4NESA 1HRDA 2Q4RA 2IV3A 2XDAA 4JYPA 3OZ7A 1OBHA 2AK3A 4AECA 4XGIA 4MDFA 3MPUA 4KGDA 3W3AD 2AEMA 3L2OB 2GWHA 4L9AA 5BNFA 1IQRA 3JQQA 1SG9A 1EKXA 5JRJA 1TQHA 3K6KA 2CKMA 4GX2A 1PLJA 4HK4A 2NU8A 1EUCA 4P6VF 5DGIA 1T8SA 3U62A 1PU2A 3B8EA 4G09A 4IFEA 1WDKA 5U9CA 3GBPA 3PQ5A 1RHKA 2OMEA 4QQNA 2ECFA 2EQ5A 2ZI6A 4RH1A 5C81A 1CZUA 3PNVA 1N6RA 4RGYA 2ODEA 1RYBA 3KBOA 5GINE 4DJAA 3AY6A 4R6WA 4OATA 4LZNA 3PG5A 3GT0A 3K0SA 2CDBA 4GOMD 2ZANA 3SE7A 4NDZA 4RFLA 3K4PA 2NU6B 1KJNA 1NHWA 1YCFA 2OHJA 4RBNA 5GONB 1U2TA 4EEXA 5IFLA 3BB3A 1SVMA 4XVRA 3DMFA 4PONA 4P4SA 5CAEA 1R0YA 1E5LA 3NPMA 1P18A 1M34A 7MDHA 1QRSA 1H0HA 2PD3A 3SLGA 3BH7A 3F7NA 1GL7A 3AM4A 1HYEA 5KYYA 2XNKA 4ZCTA 2VOEA 3CSSA 2FRXA 1D5CA 4DQLA 1RM0A 1TYAE 3GRZA 4A82A 1BCRB 4P58A 3T4XA 3C3PA 4JUIA 5AJUA 4YASA 3CKLA 1E3SA 3VC2A 4EO9A 2VJPA 1ZD5A 5CNIA 2WWRA 2EP5A 1XTPA 1JJBA 1SKQA 1I0IA 2JVJA 1VQ1A 3H4VA 5A6SA 1JDUA 1ZXXA 2QQGA 3DL2A 1Y1SA 4G63A 5EIWA 1DKNA 3AZPA 3H75A 4NATA 1Z5UA 2C96A 4DCTA 5JQGA 1XZJA 1Z6GA 4EOGA 3JYNA 1G8FA 1DBQA 5IK2A 1KJYA 3Q9SA 4EQZA 4COOA 3OUTA 1JBQA 4NOMA 1U7PA 1ETHA 4Q48A 2W22A 4YXWA 4KZKA 4QZVA 3HN7A 3OKPA 2GZ3A 2WKWA 5KB3A 1Q16A 1Y9AA 5EE9A 5TF4A 1OJ7A 4HLCA 3VISA 1FP6A 3FCEA 2IXFA 4YRZA 1MO4A 4GL4A 1MQ9A 2HH9A 3LF1A 2DERA 3AVYA 1JWLA 2IBSA 3FI0A 2QMOA 1G60A 3JQ9C 3HU5A 5EE1A 5FO1A 4AFNA 1M0EA 2ZXEA 3WYEA 1SHUX 1LNQA 2ZVDA 4KO2S 4KQJA 3LUPA 4D45A 4M0DA 1R16A 3H3XA 4MV0A 4WESB 1L5FA 4EY8A 1K89A 2ZQZA 1R1DA 1WY7A 3H97A 4W5JA 1L7AA 4QYSA 3M6UA 2VSQA 2WZQA 3DV0A 1YHZA 2DCUA 5L4SA 1N36B 1JU9A 2X1LA 1XKTA 2RGBA 2ZYRA 3G5AA 1T4DA 3I5MA 4J0IA 1L4BA 3RRXA 3W9UA 2PE5A 4N5NA 1MC5A 1C4KA 4RFVA 3TQTA 3N2EA 1B41A 2GSWA 3HVKA 2CSUA 4ZXFA 1IZ7A 4MV1A 1TW3A 4BAUA 1MCZA 2W58A 5AK5A 3LMKA 1FYVA 3M3DA 3VTAA 5K8UA 1YE5A 2FZCA 4FZVA 3WNBA 4HYEA 2X1VA 3PNSA 1XKQA 5JMPA 5LQUA 2G08A 1W0JA 1JMKC 1CETA 1U8XX 1G7RA 4DCJA 1UJMA 3IUQA 2VZ9A 1U1IA 2HRRA 4H59A 4LC1A 4R6XA 2D5CA 3B3JA 3N0RA 3IGFA 4K9MA 3NW9A 3QVUA 3QXSA 5JCOA 3N2ZB 3CZRA 3K32A 2R00A 1L4EA 1KSFX 3PUHA 4IV5A 3SOPA 3TQRA 5M29A 1VL8A 4JJAA 4QUKA 4BO1A 1GCUA 3KDPA 3NHPA 4WNAB 3G0GA 1OH8A 4XX1A 2ZUFA 2CUNA 3VVMA 2JGKA 2IUEA 1DLJA 1C4WA 3PWSA 4G01B 2P7IA 3ZD6A 2P2CA 3JCZA 2Z6AA 2QU7A 1ESEA 4KUEA 3RC2A 1QHEA 2HU5A 2PR2A 3KU4A 5AOCA 4R54A 2GPBA 3KQYA 4Z6KA 1TPYA 5ICMA 5TPWB 3FD8A 2P0AA 4K6GA 4KACA 2H1RA 4CHGA 3GEHA 4ER0A 4YCBA 5HUQA 4Q4AA 3EXEA 3A1NA 1GGFA 3C3DA 1CUAA 5SZHB 1NBOA 4L4XA 3G1UA 5EFZA 1FPQA 2YWJA 3LUKA 3CLUC 3BL5A 3FWYA 4INPA 2JIDA 2Q5OA 5CK4A 3WL6A 5LZ8A 2C7OA 1ZN7A 2YDXA 1TCCA 3RANA 4KDEA 4LQCA 4PZ9A 3ZY5A 2XUGA 1I14A 4DYDA 3FJ1A 3RYIB 1IXKA 1MB2A 1F60A 1RM4A 2O4CA 2R1TB 3VBEA 1DSSG 3FVVA 1V5IA 2HSZA 3MWEA 1P80A 2B4YA 4GIBA 3KZVA 4R2KA 4QOEA 2YMLA 3INYA 5EP1A 3X1YA 2Q3EA 4FFSA 3ZDRA 2I6GA 4FHDA 2Z09A 3AGPA 3CTPA 3SAJA 3IEIA 1QOZA 3WJAA 4F86A 4X8LA 1EWQA 1PHRA 5IZ4A 5K7SA 3ED5A 3T06B 1TB4A 4KLNA 1UZLA 3S4YA 2V7BA 5KQMA 1JG4A 5SICE 3IBTA 5ELLA 3NI2A 4ZOLB 4XQGA 4DNPA 1PZGA 2VHXA 2JZNA 2QRKA 2PD4A 4XSGA 3C3EA 1CJCA 3SY8A 1U63A 2ZG6A 1MTOA 5M7EA 2J7PA 3PC2A 2ZDQA 4UEQA 3T9FA 2CUTA 2DPYA 4L28A 4HN9A 3N28A 5AJHA 3K0CA 3TM5A 3A6GA 4OK5A 3S81A 2UVPB 1GUYA 2WA2A 4JC4A 5DN9A 2JLUA 1Z2EA 4OBXA 1QWSA 4QRDA 5AT1A 4M8KA 2HGSA 4FZ5A 4XYGA 3MAJA 3IPLA 4KUHA 3NAGA 3KLMX 3KKZA 3NHFA 1C3LA 3P0FA 1O94A 3KL4A 1Y81A 5AHKA 4EG8A 2PZJA 4LISA 1UBSB 4J43A 3H2GA 221PA 5IF3A 4XDGA 1WCV1 2C94A 3TOCA 3OX1A 4RULA 4XTCS 2I2XB 5CFZA 3CR7A 1EIWA 5ISMA 1GNSA 3PNOA 5C0OE 5CXUA 4YCCA 1L8QA 4M1TA 3QX3A 3SQOA 1DC3A 4P08A 4LCJA 1Z9BA 2FDRA 4G4SP 1THMA 2C9CA 3K8QA 2VRCA 4MV8A 4Q39A 2C2MA 5CX1A 2CVZA 2GZHA 1L6RA 5C5EA 4FKBA 3UCEA 1KDTA 3FNFA 1JIQA 3BTSA 4IX1A 4RY8A 4KLCA 4R9SA 1L7NA 2QRUA 1WBJB 4KQKA 1QX4A 4M0PA 4LWQA 4XE5A 1FTWA 2DFPA 4ZU3A 3EG5A 3IIJA 4KRFA 2G67A 4UMVA 1F2TB 1E96A 2JK1A 1OBOA 4WOKA 4ERXA 3E1SA 4D8YA 2ZXUA 2XXAB 2C07A 3I6BA 4ZOAA 1GG9A 1WHSB 1PNOA 3X1KA 4DLYA 4OREX 3O4JA 5JFOA 3QQ5A 5A3SA 1TGVA 3Q7IA 4MJ7A 4D0LB 2GNOA 2WV7A 3V55A 3SVLA 1RBQA 4K81B 2OFOA 3VOTA 3AVPA 1A9RA 3I73A 3DKPA 5JSZA 3W5AA 5DCLA 2WJZB 4RAOA 2W4QA 1DX6A 1TCAA 3DTVA 3JARA 1I4LD 3QIAA 4FYJA 3UOGA 3OOSA 4LK2A 3PI7A 2YNMA 1AGPA 4WY2A 1Q77A 5HUJA 4MV6A 1L3CA 3WY9A 1J25A 4ZYUA 1KZGB 1DX4A 2OYSA 3JQAB 3PX7A 3EFHA 5TF0A 4JDPA 2J3HA 4MAFA 4NAUA 3Q0EA 4GI5A 4OGFA 5F77A 1PG2A 3QTLA 5IJ9B 5JAPA 2FR0A 2WF9A 5EP2A 4XUEA 1B76A 3G7UA 5GVRA 3SBDA 4BFSA 5BXYA 1TNDA 4ZOCA 3M6XA 3VKVA 1O6FA 1E2NA 1EDOA 2ENUA 3NJ4A 3S1SA 2FFAA 1J4AA 1E2UA 1SA0A 1E7QA 3THYA 2OK8A 1Q0PA 4GRDA 3WKBA 5BQXA 3QEMB 4D4IA 3S2EA 10MHA 3NKLA 1AGYA 1XBTA 1ENYA 2HA6A 2V3WA 4MWGA 3ROFA 1JSCA 3HNRA 3BWCA 1E1NA 4WBXC 2AZTA 2XBMA 2WP0A 1RPTA 3PX2A 1XCPA 4Q1CA 3RWBA 3CVWA 2GRAA 2WF6A 5DBGA 3LFTA 5I48A 4KPGA 2C4TA 4IKEA 4Y9SA 1UBHS 2XUOA 1SQ5A 2Z2KA 3C4JA 4KE8A 1UEIA 4ZQGA 3W3AH 3G2LA 3AF4A 4HQRA 16PKA 2D7CA 1M6VA 2ZATA 4WESA 5IMSA 3QJ5A 4YCSA 1UKEA 4R2XA 3TSAA 2G4CA 2ZCVA 3ZUGA 3RHFA 4F9FA 1XP8A 1QRAA 3I5UA 4V0SA 3ADKA 5I3ZA 5CBKA 3WP1B 4XQCA 2ZBUA 5HDQA 2EGHA 3ECSA 5E6RA 1PZMA 1YZHA 3MD9A 3H65A 3T9BA 2ETVA 2X5NA 4N0EA 1U3DA 2BR5A 2QAGA 1K6MA 1TDJA 6REQA 3V8RA 4ZI5A 4M38A 1V9SA 3FIJA 1N2CE 5KYNA 3C6YA 5J23A 3ZZMA 1ONSA 4EHLA 3N2GA 2VUUA 1XF1A 3PQ3A 2IW1A 4BS9A 3G2JA 2YXPX 3MVEA 4Y6GB 2PX2A 3QF7A 4FB4A 4NF2A 4JHLA 1PW7A 4G0QA 1XTSA 2GNAA 1PJ3A 3FMOB 3FHLA 3H42B 3HVHA 4HZUA 2C2KA 5E2AA 4LQLA 4HGNA 4MQ6A 2NN3C 4HFRA 1NNLA 3NVAA 4YNBA 4AG6A 5C1BA 3TAXA 2QUBA 3LC2O 4MW7A 4N5MA 2QSYA 4C3ZA 5A5FA 2C3OA 1LBSA 1NLZA 1VP9A 2YWHA 1L1FA 1MAUA 3UBMA 4GYJA 4EGAA 1EK6A 1T2FA 3EBPA 3ZGXA 2ZI7A 3SI7A 1A4XA 3C6XA 2E49A 4M2LA 5BSMA 3E3MA 3C1TA 4BFZA 1WX1A 1I7QB 1KXZA 3H13A 1JHPA 4TLAA 3WXMA 4ARCA 2JFGA 1R9NA 1NUSA 1CUFA 3IAM6 1NULA 5FOXA 2VAVA 2PQ2A 2FN8A 2PL9A 2RBEA 3HNPA 4JLOA 3RYCA 2J3DA 1FU4A 2LWIA 3HKCA 1WM1A 2IW3A 2FVXA 4FWIB 3CNBA 4HJRA 4AO7A 3E9RA 2MJLA 3WKDA 1KJJA 1N8SA 2A67A 1BXGA 1E79D 1QLHA 4FILA 1E6MA 4H16A 1EWVA 4NJOA 4XAQA 4BBZA 1H2BA 3F2VA 4DCVA 4O2RA 2ECQA 1JFLA 1MW9X 2VNKA 5ALNA 4B6JA 4IDQA 1K8RA 2PVSA 3F6EX 5E7QA 4DNXA 3ZJVA 4Q3AA 2PN1A 2FW9A 2WTXA 1KPHA 1KYZA 4PPYA 4XIYA 4CIXA 3I9FA 3JARB 2V5VA 4KQ9A 4N7MA 2IP4A 3A0RB 5EMHA 1CJMA 4YDRA 5ALPA 4R41A 3AJ9A 3AP2A 3WZMA 5LOVF 3WLSA 3CCBA 3GAZA 4DA0A 4MTCA 1N2CA 2PL3A 1GYQA 4F9TA 5IJ0B 2DPXA 2O2JA 2ZYAA 4K2HA 4R9RA 3I2KA 2FWIA 2XTZA 3DZHA 4Y6LA 1NAIA 3RJTA 1U7TA 1O95C 1ODIA 2FSFA 4BE7B 5BNWA 4RV4A 4WFJA 1WS6A 3RSOA 4LZLA 1C3OB 1DRUA 3JZDA 4UC0A 3CZ4A 1WXFA 4E13A 1MX5A 2VNJA 3VNBA 2O3UA 2V7TA 3L8CA 1RIFA 3R5JA 1QC5A 5BYKA 2FSVC 4K3VA 3HS3A 2Q45A 3W8FA 2R1VB 4CMIB 1X7XA 1ISSA 3GEMA 1G8YA 4LZJA 1SHLA 2VPYA 1NPYA 2L82A 4DLBA 3DDUA 4LXUA 1MGPA 4C78A 1L6IA 2XZPA 1ULUA 2IPAB 3CH4B 1RZVA 1CUYA 3H3JA 3AIOA 3A3YA 2X76A 1SD5A 4BX2A 2G9VA 3QH4A 4DR6B 2QN8A 2Y1WA 2AMLA 3AM5A 1A4UA 4EKYA 4ZHQA 4JELA 3R8FA 1HM5A 1KK3A 1TL7C 4LDJA 1OLOA 3D0KA 1YKFA 2HEIA 4GBED 4MA0A 4UE6A 5EWMB 3UAGA 4AROA 3OIFA 1D8AA 4M21A 4BKPA 2BGKA 4OHZA 3WYAA 2FETA 2I6TA 2MHCA 2W4IA 3H9QA 1SC3A 3A9UA 2DQSA 1UQTA 2ZRBA 1JWAB 3O03A 2EFYA 1MT3A 2CEAA 1Y1TA 2GDJA 5B3KA 1RJWA 1JEEA 3JRXA 4I6EA 1Y0BA 2DKNA 3FNBA 4Z2AA 1NVGA 4JBHA 2UUBB 2B30A 3S2FA 1C3XA 4CR8A 1HSOA 4CV3A 3GF4A 3KVNA 4BWFB 2GPJA 1BH2A 3UB4A 2YHBA 1ORRA 5J58A 1HFWA 2I1LA 2H1SA 1UJNA 2PZKA 3FWHA 1FLDA 3QMVA 4JKOA 3O26A 4QARA 2E5FA 2WYHA 4BGDA 1SIWA 2X9GA 5F73A 5C2JB 4B3XA 3RROA 3USCS 3OHSX 2J45A 3KIPA 5BPFA 1D6JA 2H5EA 3X43A 2J0UA 1R10A 3ENWA 3K53A 1EBBA 1NT4A 2QUJA 1VCMA 2OCXA 1S1MA 2ONYA 4F56A 4BFXA 5KYUB 2QIOA 4DUYB 1JH9A 4LSZA 1YUMA 4N39A 3TLBA 3VH1A 3ZR4B 3K70B 1QAOA 1UDCA 2C9BA 1KJQA 1QYVA 2JH8A 4O25A 5CFPA 4QX6A 3GFTA 4UUBA 2AFVA 3LC0A 3ND9A 4G8CA 3VVLA 3SC3A 4CEHA 5F4BA 5FP0A 3VM6A 5KBYA 1XZLA 4EECA 2ZUBA 3OQOA 3UHPA 1P2GA 4X6LA 4AJIA 1GG8A 4E21A 1CQJB 3GA0A 3STTA 1V8PA 1TYEB 721PA 4Q4DA 5IVPA 2B6NA 1QAMA 4WT7A 5C8YB 3MGAA 5HKKD 3AUFA 2SKCA 3FAZA 4RIGA 2EDAA 5DI3B 4BLRA 1ZD3A 4FR2A 2XB9A 4COKA 1O97C 3R8XA 3JAWB 1FDRA 2GZSA 4IZ6A 1JAXA 3RK0A 2RHMA 4GR5A 2CK3A 5K6RA 4IHJA 2YZ7A 3PE6A 2HIMA 1M54A 3D3NA 4G0ZA 1H4TA 4IEFB 4RD6A 4WGFA 4CLEA 3CBGA 4YGYA 2P6OA 2O9JA 2WVAA 5K0GA 2IE0A 4ALJA 4KO3S 1BU8A 4B3DA 3U80A 3GMIA 3QFFA 3O3MB 3R3ZA 4KHZA 1LPSA 1RDFA 1T4BA 1EHIA 1LC0A 4B0OA 3TQCA 1OU0A 4G26A 3DFFA 2CMHA 3F1LA 4AJEA 4E0BA 1T9ZA 3KZ1E 1XAIA 2QNBA 3FB4A 2PUBA 4QDOA 4M99A 4FCCA 4WFKA 2OBNA 4A15A 3W0LB 2FN9A 5TVGA 3HXQA 2OCGA 2GK7A 2A7XA 4B84A 4TKUA 2BEVB 5BR1A 1DBSA 2P9JA 3DAOA 4ID9A 3U49A 1MZPA 3CH5A 5E6RB 3NIFB 4YRRA 4Z4FA 5A5VA 4OHWA 3UWOA 1EP3B 5BP7A 5EJAA 5IKMA 1GZHB 5KJ1A 4S0ZA 4HS9A 5DV9A 2DHCA 1OVMA 2PS1A 5EIXA 1ZJ5A 2H0RA 1MVLA 4PFJA 4A8TA 3WHLA 2Q3FA 3KKMA 4OP1A 3Q6IA 3I34X 4G41A 4YAGA 5KTYA 5CG2A 5EEGA 1M9NA 1WULS 2HQOA 3AL2A 5K0TA 2REBA 1T26A 3DM9B 1LDBA 1I36A 1MIOA 3PD7A 2REXB 3UKJA 1JBKA 2GTPA 4TTAA 1BSVA 3AVQA 3VPXA 2J5BA 4X44A 5JNTA 1NLFA 1J0BA 2AOTB 1CLEA 2I7VA 3CUTA 1UPXA 3G9TA 4YRNA 3WVNA 3O8CA 4P31A 3IRUA 1R0BA 1XWFA 2DU8A 1YKGA 2E6UX 3BXOA 3V6MA 5AUNB 3AHHA 4A2PA 3WP0A 3ZW8A 1ZDMA 2JI8A 4R16A 3L06A 4ZODA 2BV3A 3ZKWB 4J8PA 4OH7A 3K9QO 4MDYA 2XPCA 3P5SA 3QVXA 4HB4A 1Q6YA 2ZPTX 1MXHA 1OREA 4HAXA 1ZM7A 4J7CA 5AVVA 1FMLA 3K71B 1A2OA 2WD9A 4HNGA 5CLGA 1EIZA 3OBBA 3EDOA 3HJCA 1OIWA 4Q4HA 3PFNA 1FXUA 2E4XA 3UJBA 4PIPA 5FQNA 1R0WA 2QMYA 1D3AA 4BUCA 4P4LA 1KFKB 1MRSA 3NDBB 1NVKA 3A6HA 1ZGJA 2HHCA 4HG2A 1WB4A 4I0WB 4XJSA 4ZI7B 8ATCA 4UOQA 1TTPB 1FUYB 1EUQA 4KWCA 2CV0A 1XDDA 1J0AA 4B74A 3P2YA 4MRNA 3WGUA 4O4IF 3Q1LA 1PVVA 3GRVA 2IZZA 4PLCA 1M76A 4ZC8A 1ZJYA 5DNDA 3VPFA 4GLOA 5EWJA 1JH8A 1NBIA 2VH2A 1GOTA 3U3RA 3EIFA 3UAXA 8AT1A 3R0JA 2OFPA 3UPUA 3HFSA 2HM7A 1T9GR 2DG2A 3LZCA 3MMNA 4DDHA 4ZN6A 4CFYA 5A4FS 1L5LA 4OXYA 4GKJB 3CVXA 3O0DA 4JJKA 1D2MA 3I92A 3FZQA 2AOVA 5CD9A 2QR2A 1QQAA 3R6TA 2D06A 1EVEA 1QYRA 3OPMA 4M55A 1B23P 4I4TB 2VXOA 4QBFA 2HL6A 4Q4CA 4MVJI 3I37X 1DUVG 2G4LA 4Z4EA 3WIOA 4ALKA 2O1WA 4CKXA 1R15A 4LKRA 3ZY3A 2RGRA 1N32B 3EQ6A 4KE6A 4F5DA 4L15A 1ZIDA 2JD2A 4WNIA 3VFDA 4BFWA 4X1KB 4FXPA 4BO5A 1TC1A 2R9VA 3GR6A 3W3AA 5F1KA 4DJDC 2F1HA 5DNVA 4F5WA 4D3YA 4W5NA 1YZNA 2ID4A 3FW1A 5KPDA 1UIRA 2PHZA 5JXJA 2IUFA 4RHYA 1UJ2A 3B36A 5BQOA 2XQVA 3FBWA 2DSNA 3JS5A 3KYIB 2EEPA 1VBKA 2DHDA 1USKA 5J59A 4EYSA 1X8JA 1FRZA 1A9SA 2P6MA 2CLOB 1JZQA 1YQQA 4HNSA 1MKYA 2ZIXA 4R1SA 4RVGA 3ZWBA 3ETNA 3WB2A 4HOYA 1OX4B 3MUEA 2HADA 3KJGA 3ZVMA 3UA3A 4X1YA 2M9MA 3P9YA 5IP5A 2OXRA 4WJLA 2OBMA 4NLLA 1O77A 2IUTA 3RFUA 1XZIA 2HCJB 2W2TA 3DKKA 2JA1A 3OFSA 1AXGA 3D8SA 3IOEA 3CX3A 2IYTA 3N2KB 1PFGA 3D6TB 5AI9A 1UZUA 5JZ9A 2Q6LA 2O8FA 3AFNA 3D5TA 3L1UA 5TDHA 1WDWB 1G5HA 5KREA 2CNWA 4P3YA 4A6XA 3S2UA 2Q3HA 4JUFA 4PXSA 2D62A 3MWDB 2P4SA 2X5KO 4RJKA 4XZ3A 4O29A 5LLSA 5KX5A 3TLKA 1XZFA 3DAPA 1GPH1 4TQUS 1NBMA 4LYAA 2PH7A 2PSJA 3IUYA 5H3LA 3WLLA 3GGOA 1YB7A 3O2SB 3SICE 4D02A 1KK0A 1LI7A 3DEAA 4XVQA 1XCOA 5IX8A 1IULA 4JFRA 2YN2A 3NT4A 2VP5A 3LQ2A 1ZVJA 4LNUA 2X2EA 1B8OA 3K9FC 1MORA 2NQTA 3MYYA 2QRMA 1UBKS 1ZITA 2GKSA 2JPDA 2B21A 2GCGA 1CIJA 1ZBQA 4LYDA 1E3WA 4RJLA 9ABPA 3P9XA 5DLPA 1RU3A 1W87A 5ICCA 4L7QA 5G1OA 1UEJA 4RH3A 1ADFA 1W4RA 1Y8RB 2EW1A 2C3YA 3KR1A 5FA8A 1HEUA 5J4YA 2F9MA 5H3CA 3TI7A 4J1TA 4ACAA 1U6IA 4XDYA 2LV8A 3D6MA 3ZCVA 2X0RA 4D74A 3TLXA 4YBRA 1SJ9A 3T0IA 1MOPA 3QXCA 2NZWA 1QOPB 5EJ5A 2PO7A 3V42A 2IXGA 4O5OA 3AWDA 2R00C 4B7AA 1JW9B 2FUKA 3GRRA 2EX0A 4G9BA 5FBKA 3VZBA 2JASA 2PA0A 1JV2B 3TMYA 3JVUA 1M5UA 2K2QB 1GRQA 1TU4A 5EG5A 3A3KA 4ND2A 1ZICA 3EXHC 3HKEB 3HXTA 4I46A 3B1WA 1QE5A 3IUJA 2HRBA 5EWJB 5DMHA 2ZJ7A 1J42A 1GN8A 1WSWA 4BJ1A 4YRKA 3SNHA 3CEAA 3LE8A 3PXDA 4NJMB 4F97A 1OPXA 2BTOA 4RPLA 4ZRMA 4NBNA 3GJXC 4KREA 3I09A 5IVIA 4E12A 3RNLA 2J41A 1VB5A 3Q7PA 3QWBA 5ABPA 2J3KA 1HOXA 4MUYA 5CFRA 1Y9ZA 1IWOA 2IZ0A 1GQRA 5JW6A 2HNBA 2W8BB 2ZCUA 1IG0A 3R3SA 4GR4A 4TV8A 4UBKA 1DFIA 1XV5A 3OSUA 3PFCA 1LTHR 3OUUA 4WEOA 3T3PB 3AV3A 2LIPA 4Q6WA 1L8XA 5K3SA 1Q0HA 2XDYA 4L76A 3LUAA 4ZI3A 4GI7A 2QT9A 2Z6VA 1AKRA 1FMCA 1LBEA 4LZOA 1TADA 3OM0A 4FUTA 4IUCS 5I9TA 4E5DA 3PX3A 4DQXA 3Q7EA 1CWUA 3WL3A 3NDIA 3PIIA 3RUAA 1KSJA 3DFZA 5L8VA 1U3UA 3Q3VA 5AW1A 1HKHA 5LYYA 2DQ4A 3CX7A 3OECA 4DPKA 5TMPA 1NMYA 4BNDB 1SRQA 1JPNA 1YI1A 4D9CA 1EHCA 2XOXA 3D6NB 4NY1A 2C5LA 1VPTA 3DOHA 3KE9A 4DQVA 4GKKB 4H1WA 4MUMA 5GPBA 4YMGA 2IUUA 3W77A 1U65A 3NGMA 4QQRA 2WTUA 4ODIA 1G8AA 1XNGA 2VK4A 4D8XA 1KI7A 1N5DA 1DV1A 4FINA 4N6GA 5D86A 2BF7A 4DMLA 4FSDA 2ODWA 4KWIA 5JEEA 4CFSA 4FW9A 4TLCA 3ZIAA 1V41E 4FMCB 1PTJA 3TIGA 1QORA 1JDTA 3FUWA 4EDHA 3GLHA 4MV9A 3O8OB 4KPYA 3RTEA 3I1YA 4QYXA 3DMPA 5HX7A 3EEQA 3PXCX 4QGFA 1XAGA 4JDUA 4WY5A 4Z4HA 2QX7A 2X77A 9LDBA 3M1AA 1KAHA 1N2EA 4I4NA 2AZ4A 1BCRA 2DJ5A 3QHAA 4B3JA 4J07A 3F2IA 1U3VA 3WBFA 1GYPA 2PWYA 3PXUA 4GZMA 1IOVA 4WLFA 3UQZA 4ZDIA 5BVGA 1GGVA 4BIMA 5IZCC 5I7RA 1SN7A 2PSDA 4NJEA 5JATA 3ETHA 1W88A 2W43A 1M6YA 3OWHA 3O1JC 4MVJH 2NU8B 2VQ6A 1XVVA 3CVVA 4HL6A 2SBTA 2X7HA 3OX4A 4XIJA 3WLHA 1KBOA 2G07A 5FNVA 3JD2A 1ZR2A 3T6KA 3QRWA 5ER6A 3T7KA 2EAUA 1V8OA 2IEYA 1QPGA 4EW6A 2EEZA 2WKPA 1XAJA 2BFCA 2BE7A 1THGA 2WZCA 2ZRJA 3DGFC 3DQZA 4NBTA 4E09A 3QG5A 4L3VA 4O02B 2SICE 2VRWA 2YV1A 1DTWA 1KMHB 1NMXA 1UCFA 1W36C 1I1HA 4B4KA 3SM3A 4KMMA 2HMYB 2GEVA 2PTGA 3QOYA 4G23A 4HGZA 3OLYA 1GTZA 4IDFA 4IQ0A 4UXHA 5EXEA 5B2EA 5JDCA 2WT9A 2P9HA 3LFHA 1CJKC 2K87A 3P97A 1BXKA 4FQ5A 4JJ7A 5I5EA 1BNCA 1W35A 5DASA 3AOEC 2QTCA 4B34A 3F7TA 3C8DA 5P8WA 1ZM4A 4MYDA 1LTQA 1Z7EA 3PJRA 1RXEA 3DONA 3RK4A 1T9GS 4MA4A 1EFLA 1BWQA 4QTXA 4JXKA 2WICA 3MLBA 5FQOA 3LDHA 3EJWA 3UWSA 3ZXYA 2XMCA 3TD2A 4LC9A 1NDQA 1CRLA 1TM7E 3PUVA 3QU7A 5LL6P 3GT7A 4EY5A 4F3TA 3L41A 2L0XA 3URKA 1SH7A 1I3OA 5KYWB 5I7OA 4FGWA 4RY0A 2VHTA 5TQ0B 1W4CA 4P92A 3ZK7A 4W5WA 2Q2QA 4PZAA 4DTIA 2XMQA 2E48A 2H2WA 4ZQFA 1OXXK 1VGVA 3VOAA 2VK8A 4MB6A 4DDUA 2OO5C 1FSSA 3W8EA 3THYB 3CTMA 4K88A 4C4PA 4O4IB 2JBAA 1G6KA 2RGCA 3DAYA 4EA6A 5BQ3A 2XLBA 8GPBA 2I2FA 4ENUA 1R7RA 2AIRA 2F00A 3DKIA 4U7TB 1GZ5A 1UZMA 2R8PA 4RLSA 4H6PA 1NXPA 5IM5A 3CF4A 4KXLA 4DA6A 2QT0A 2Q5EA 3QLUC 1N57A 4FFPA 4BBPA 3DEZA 4I1IA 1PR1A 4P36A 4MR9B 3HXPA 2AB0A 2DT8A 4I3GA 3PRKE 2COEA 4AM8A 1AO0A 5LMZA 2VP9A 1ULTA 1C30A 4DRZA 4B71A 3L7BA 1DU4A 1PK9A 3UY4A 2PMEA 1J97A 5IAJA 3BDIA 3CO0S 4DLVA 4TS9A 4ZI7F 3HDJA 1YNOA 2HDWA 2CDRA 1HL7A 3DT8A 2XD4A 1S2OA 1EWYA 5B3AA 3GU3A 4R3WA 4EAQA 3TBHA 3WG9A 2Q6TA 4BCCA 2VP2A 1XDZA 3AHEA 1J8DA 3GELA 4NPHA 4GOND 2AYZA 4Q01A 4W4TA 4JR1A 4PAWA 2UYCA 5K0CA 1RLMA 1YJBA 4M7RA 2J46A 1J20A 4OB8A 3LVBA 1HI9A 2H7VA 3INGA 1DBVO 3NHUA 1C9DB 1NY6A 2AFIE 2QJFA 3BQMB 4L75A 4L9RA 5DRTA 4QQFA 3OMXA 5SZIA 3MD0A 3H5NA 4TQAA 3U44A 1QCYA 2ZUWA 3SZRA 3PPWA 4C29A 3DO8A 3KTDA 3GH1A 4JGIA 3EXG1 3LQFA 3ZE6A 2G82A 1P7VA 3IMFA 2CV2A 4XCVA 1PG0A 2DUJA 3TL6A 4LK3A 2QN1A 4IX9A 2YY7A 1KK1A 5E3JA 1E6WA 5FUWA 3ORRA 2I1VB 4Q3KA 4RTNA 3K92A 3JQCA 5BMVF 1OAOC 4AZVA 1EM8B 1N6HA 1TJYA 3FIUA 1K7FB 3GMDA 5BSUA 2MINB 4YP5A 4CF5A 4R0MA 3HJFA 4NZ9A 3SYLA 2G80A 4C1BA 2MIIA 3ZDEA 3F5MA 5I7AA 4EY6A 4RPHA 1XZCA 4RZHA 2AHRA 3CNHA 3RUCA 3IPCA 3KWJA 1IATA 1EFUA 1JIXA 5I45A 3TG8A 2D6FA 3SHWA 2V6JA 1KRHA 2O6HA 3A2MA 4HUQA 3W8DA 1J9ZA 5IN5A 4C7BA 4JI8B 2QTLA 4LXGA 2EKLA 4MITA 4F6RA 4PO3X 1J7JA 1LSUA 3FUVA 3GC6A 1X39A 2UV8A 3KSMA 3TB4A 4PGMA 4PW0A 3CNNA 4FGKA 2WUDA 3E84A 1YBAA 2NQ2C 2P0EA 3P4YA 4Q18A 3D7LA 5E9JA 2JLZA 1P72A 5HILA 4XB1A 4OMDA 1E18A 1ECBA 5K99A 4B43A 2CNBA 4RKYA 1H0SA 3ZE0B 4S1NA 2XKKA 1E2BA 5CT6A 3B48A 1W9HA 3QZUA 1Z38A 3LVQE 1SZPA 1YIAA 4NL4H 3VBCA 5BN5A 4X7BA 7MHTA 3AB3A 4HWSA 4CTMA 1GKLA 3KCNA 4NABA 4OFXA 2WAOA 4OGKA 5DNWA 2V55B 3UYLA 1VYHA 2XY4A 5HBGA 5CB8A 2C2GA 1MRZA 1P5ZB 4UEKA 4EUEA 3GD5A 3LM8A 2H1LA 4OD0A 4MW2A 4GDMA 5H59A 4DQDA 3VI3B 1F4LA 1SC1A 3OKFA 2W2LD 3OZRA 4RTLA 5CB4A 5DNUA 3ZVNA 5CT4A 2OXFA 1L5SA 3FHTA 1IH8A 1WKVA 1WVGA 2EQAA 2VBIA 3EWNA 5DWQA 4CCYA 3AF2A 4RHTA 1EB9A 1JYEA 3BXEA 5LYJF 2IYWA 4RTKA 1GILA 1JQDA 2OFXA 3FSJX 3Q6MA 4XARA 1E5TA 5F35A 2O8BB 4XA8A 4Q3LA 3OQJA 4FJ2A 3T35A 4XDHA 1P3JA 3PFGA 3RVJA 4YPOA 1QHXA 4HWTA 4XKJA 1U31A 2O7QA 2QXYA 1M1XB 1ZOSA 4D3SA 4D8VA 3V1NA 3ESAA 4R51A 3EEYA 2BDUA 2XNJA 3EIHA 4L74A 5GAJA 3DZFA 5A05A 1V11B 3AHGA 3P9IA 1Q2UA 3HEMA 4S1VA 4ZDJA 5CR9A 1QVAA 1CQZA 2KS6A 3T4UA 1Z34A 2BD0A 2PZMA 3BXXA 4EF5A 4WLUA 4P33A 5JHHB 1EZ4A 4GE3A 5FJJA 2IXBA 2GEBA 4FWTA 4URYR 3Q2KA 1XMQB 2V7PA 2G09A 3MSXA 4TTIA 4TLMB 1QRRA 3CRRA 3NIWA 1U0NA 1U8TA 2GPAA 5DTRA 2AWOA 3WI7A 4LTNA 5KAMA 2X6TA 1YZVA 2A1UA 2GCOA 4KQIA 1JU4A 1RVV1 1UR5A 3ICEA 2CMFA 1NIPA 2ZJ2A 2PGOA 3CE9A 1YR2A 4OF4A 2A1UB 1VE7A 1OZAA 3O3CA 5B6IA 2Z6UA 1SKAA 5JECA 4KN9S 1TM4E 3GI1A 4IXWA 4C3UA 5FTLA 4HKTA 2NZ2A 2X23A 1DG3A 3F98A 4URXR 2W2LA 4LQDA 3R9IA 4LF6B 2VXBA 1JPUA 2YCLA 4OH1A 3PDCA 4WDRA 3TDKA 2DHQA 1ZH0A 1UDRA 4JXXA 4ZCQA 5IBCA 3LKVA 5FUMA 1JHDA 2ADMA 1ZGZA 3KO8A 3PNYA 3V6LA 5KOJB 3KKKA 4DDTA 1PT8A 2QVXX 3P0HA 4QFCA 4RZIA 5FUVA 2FRVA 1HZZA 2WWXA 1UFVA 3G8CA 1USWA 1OIVA 1OZGA 4R40A 1VL0A 3MXOA 1TK9A 1P0MA 5HYVA 3KZCA 4J1SA 4LQ4A 4DABA 3VKHA 2ROQA 5CLQA 3E48A 1ZIPA 5DX8A 1IXZA 2FZWA 2G1PA 2C9OA 1BRTA 1M1YA 4QE3A 1MB3A 3BWVA 5LDDC 4GQBA 2BGWA 5LXTB 5JFTA 1JZSA 2XT9A 1EFCA 2VDRB 4OXRA 2RMKA 3UGJA 1SQ6A 4N8SA 2P91A 4Z9XA 4ALNA 1S02A 2OCPA 2GDZA 2ERCA 1CFZA 3AT1A 4JEUA 2MOKA 3QLVA 6NULA 4PIMA 3Q12A 3T7RA 1N0VC 2OP1A 2WJ4A 3LHFA 3DOUA 3LHKA 1YOVB 5CXQA 2FX2A 3HU2A 2FJ0A 3NZEA 4QYIB 3S2ZA 2GAIA 3TXYA 3T4EA 1JJFA 1FS5A 1R6BX 1TZ2A 2Q07A 2BFEB 2FY8A 2R7NA 1VG0B 3GFVA 1RC1A 4NZYA 4O2BA 3DZKA 4OHKA 4WXMA 4B3GA 1B0ZA 4IRMA 6REQB 3QOWA 4N41A 3IOYA 3ZV4A 4BP1A 1EMDA 1XTUA 1LEHA 5BXQC 2OG1A 4MLDA 4G0XA 3IMEA 4NNJA 3U3XA 3COZA 3FFBA 4E22A 3KEOA 4A73A 1JDPA 2ZYVX 1GIAA 4HZUB 1M0WA 4NPCA 2ERXA 4RPCA 1UMDA 5JR3A 2DM6A 2W5UA 3WMGA 2FPIB 2YHAA 3ZBQA 2VPXA 1XLVA 4UTZA 3L6RA 1L5MA 2C1EA 1I1QB 1T0PA 1QRDA 3F7OA 4MYSA 1SFRA 4HDMB 5JC1A 2PO5A 2X1MA 5A4MS 2BFBA 4N6NA 3LUGA 2JIBA 5CH5A 2GM5A 4UDNA 3U7QB 4D9MA 1VRWA 4KN6A 3WSTA 5DISB 1N6IA 1THTA 4BZXA 1FTQA 1MV5A 5L3QB 4RPKA 3SX4A 3DC7A 4B8YA 1RPJA 1KHHA 3N3AC 5AVJA 1GKIA 3PFFA 4GXNA 4LRWA 2GN6A 2QTVB 2PVPA 4MUFA 2SHKA 2H65A 2J6IA 2YQ5A 3P8ZA 2IEGA 3RU7A 2P9BA 1NDHA 1M0TA 4MW5A 1SUAA 1H8ED 2LD4A 1BS9A 3X1ZA 1O95D 2IP2A 1EM8A 4GNRA 3WGHA 1N0UA 1XLWA 3OESA 3M9XA 4K9PA 5AJZA 1HOTA 1KI4A 3D31A 1SC9A 1MTZA 2X2OA 3QFRA 2VYVA 4IS3A 4N54A 1D4OA 4ZZ2A 4EVIA 4ENRA 4RH0A 3E5NA 4WADA 5CIQA 3UJ7A 2FUCA 4G4IA 3PGMA 1UL1X 2R87A 3N70A 2GKGA 3OJXA 1IHPA 1KHTA 3DMTC 1PL8A 5EWMA 4ZWNA 2C83A 2N1MA 3OOHA 4TMFA 5FORA 2J0QA 3HFJA 4FFNA 5HCIA 2V0NA 2ZE6A 3I9V6 2O52A 4NYIQ 2WWYA 4DDMA 1L4KA 3FY4A 3P2KA 1P2FA 1GSOA 2JFVA 2Q7XA 4YCJA 1OT3A 4I5IA 1WMEA 4QQ8A 3D8BA 3BCUA 2VDVE 3RJMA 3LHSA 3LX8A 2PUVA 4G1BA 1BX1A 4JT8A 2OQVA 1XA3A 4N0DA 4UZSA 5TMEA 4M98A 3TCNA 3TLAA 4J4BA 1UK9A 4NHOA 5BSEA 1CUBA 4U7WA 3RK1A 4X1IB 3ANNA 4QKQA 5DBIA 4BN0A 2I8LA 2CXQA 4J91A 2O1SA 4Y2SA 4LDRA 1IRXA 4X93A 2WJPA 1T13A 1UC9A 3A4YA 3D8HA 5HKAA 1B6RA 1ZJ6A 2Z9DA 1RTKA 4PX2A 4TZTA 1Z4MA 1ZQ9A 4HAUA 1U7XA 1GPAA 4PGAA 2WJYA 4RTQA 3PD1A 2ZRLA 4KWTA 2CXTA 3WFJA 4CT4B 1YWGO 1CZOA 5IRCD 4QOIA 4XD7A 4ESEA 3MQFA 4BRZA 1MA3A 2JFQA 4LMRA 2YVLA 4BNHA 4A2CA 4D0NA 4G0OA 2RK6A 2PX5A 2DH6A 4CNQA 5HP4A 3IOMA 1J8YF 2I2DA 3LX4A 4UZFA 2HBZA 2IWRA 3NC1C 3RVQA 4BGEA 1XJQA 1K6IA 2VRNA 3MAGA 4EY7A 5BN3B 3V1LA 2YMMA 1F06A 3OCWA 4AMBA 1Z83A 1ECCA 1VRVA 2BELA 4RMNA 5AVOA 5IUKC 4JP5A 5IDWA 4O2BB 4O4LF 2VNSA 2ZSUA 4LHWA 3FOEC 3T7IA 1ZA2A 3NYIA 4LVCA 5EGSA 2YJTD 3QA9A 2XF8A 3ET4A 5IKPA 4XXHA 1NUTA 1Z82A 1HBJA 2I4OA 2VS1A 2WYOA 2WVGA 3FBGA 4PAQA 4YUVA 3NAZA 5KSOA 1H42A 3CKMA 1HQKA 2PX6A 3AFHA 3KHTA 5JIBA 1VJCA 2AX3A 1U9CA 2BRUA 4FMCF 1ORTA 4PCLA 3DF9A 3OZBA 4I66A 4POAA 1EVQA 2NVUA 4ZVLA 2BBSA 1EE9A 1Z0ZA 1FP7A 2EQBA 3IB3A 4MZXA 4ATNA 3P5BA 1YULA 3ZGVA 2DR2A 1NVDA 4BMCA 3KSRA 4I6GA 2Z3VA 4KL8S 1VJTA 1RNLA 4HQKA 2QP9X 4N9QA 4N3CA 3C3BA 4X00A 1QP7A 3SFTA 1WU8A 1YZYA 1YR1A 5FD8A 4BUJA 2VIIA 4WFQA 1U99A 1QFYA 3T5BA 4ITVA 3HACA 3KJQA 2XLCA 2BSQA 5K4HA 4X6UA 1VL6A 4IQ4A 4R83A 2PZAA 4E03A 1NL3A 3QQPA 2FMIA 2W9XA 1YZUA 2BSAA 1UDAA 4IGAA 5KQLA 3U4AA 1MENA 1LLFA 1Z22A 3HB9A 2OYCA 3L07A 5FBHA 1ZW6A 4WL0A 5AYVA 1DADA 3QV1A 4WNAA 4DIMA 2PY6A 4P22A 4YRTA 1IQ0A 3CINA 2RJOA 5DI3A 4DSZA 1Z6XA 3D43A 1HR0B 5A0TA 5KCZA 3NORA 3BN3A 3EXEB 4RCYA 3C5CA 1X19A 3ESXA 4ND8B 1C80A 4REOA 2QGNA 1WPRA 3WXBA 4E5KA 1W36B 3N7UA 1NP3A 5GY7A 4HMOA 1UXGA <