3RVMA

Structure of the chey-mn2+ complex with substitutions at 59 and 89: n59d and e89r
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
129
structure length
129
Chain Sequence
MADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
total genus 47
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rvmA00
2LIVA 3FFTA 5FWYA 3O2QB 4NV3A 2IOYA 2MYPA 1SXIA 3CTPA 3CZCA 4Q7EA 1JFTA 1BAPA 1DRJA 1RXEA 5DKFA 5B3JC 1JDPA 2NZVG 2ZWMA 3OM1A 3H75A 1E6KA 3F6PA 3O74A 4EVQA 4G0MA 2FMFA 1U2PA 2PL1A 1L5YA 2FQWA 4MR7B 4RK5A 5GQSA 2HPHA 3T95A 1KRWA 3EQ2A 4JA2A 2FSPA 3IP7A 1ZVVA 4MS4B 2PE5A 4W5OA 4F8JA 3LUJA 4NQRA 4G0OA 3LUKA 4IMJB 4WXEA 3C97A 5JNWA 1AB6A 1DC7A 1A0OA 2QV0A 4IRXA 2OENG 4KK4A 2FQYA 2N9UA 3HZHA 4MS3A 1RZRA 5B3JA 3O2SB 4MRMB 4TN5A 2L2QA 1MIHA 2GBPA 1QO0D 3T38A 1K68A 1M5TA 1FFWA 1QO0A 3H5LA 3ILYA 3JY6A 2QSJA 1JDNA 1KGSA 3HEBA 3O75A 4N76A 1JLKA 3T8YA 4KREA 3CHYA 4LRQA 2HQOA 4RS3A 3SG0A 4NCAA 2A9RA 1GUBA 1JWLA 3H5WA 3IPCA 4RKRA 2JVIA 3H5TA 4E7PA 2ID9A 3OMWA 3OO0A 3O1JC 3N53A 4NICA 3KLOA 5BRJA 4MLCA 4KNYA 4PICA 1D4ZA 4OATA 1JF8A 4Z9AA 4G0PA 1MAVA 4YS6A 3FGZA 2P9HA 1GCGA 1YMVA 2B1JA 1QKKA 4RY9A 3RVOA 1APBA 1E6MA 4OG2A 3Q41A 3E61A 1NXWA 3FDFA 3RVRA 1MB3A 3DGFC 3P9YA 9ABPA 4EUKA 2E4WA 3EULA 2LBPA 5KC8A 3OLWA 1U04A 1GUDA 1NXVA 4HNSA 1ZDMA 4LDAA 3OLXA 5CNIA 2WY2D 2JB9A 2RGYA 4LE1A 5T3YA 1BDJA 4RY8A 1JH9A 2PUFA 1CYEA 2PJUA 5CNKA 2FLWA 5EWJA 1WETA 1NXTA 1QP0A 1XHEA 3OMXA 3UK0A 1NXXA 2PUBA 1YK0A 4OBBA 4MQFB 4ZPJA 2WMYA 4XAQA 3VNAA 1C0EA 4Y9TA 4OTZA 5EWLA 4RK6A 3SQNA 4XXHA 4IF4A 5BRAA 3N0WA 4DADA 1DJMA 4RK0A 1VKRA 3BBLA 4XASA 4YWHA 4KPYA 4H3HB 1DBPA 1EWVA 3KHTA 4MAAA 2FEWB 2NT3A 3GWGA 4MQFA 3FFXA 5EWMB 5ABPA 4MS1A 1YS6A 1ZH2A 1LJLA 2H3HA 1S8NA 3MIZA 4RK7A 2FW0A 4FE7A 1M2FA 3GV0A 2JBAA 1Z16A 3EGCA 3MA0A 4LE2A 2V0NA 4XARA 2HJ9A 2VUHB 2R4QA 4RU1A 3NHMA 1JYFA 3N75A 1PNTA 1GCAA 4HNRA 3HJFA 2NUBA 5ED4A 3T6KA 1B00A 5FBHA 4MLDA 4KV7A 1DC8A 4P1ZA 4Z4EA 2JK1A 1YMUA 4QYMA 2MSLA 5IBQA 3URMA 4EVSA 4F3TA 3C6QA 3DZDA 3O2JA 1DCFA 4OLBA 1Z12A 3OQOA 1BDIA 3MYYA 4DQDA 4D74A 1RZRD 1U0SY 1USIA 4RV5A 3LUHA 2QXYA 1FFSA 1E2BA 6ABPA 3HDGA 3JTEA 2TMYA 3CU5A 3OLVA 3OM0A 4MR8B 2RJNA 3QEMB 2CHFA 2R25B 5IEBA 3C3MA 3KLNA 3O1IC 1TVMA 5BR1A 1JX6A 2AYXA 1QMPA 2L18A 1LJUA 3KKEA 1EFAA 2IPLA 4ML3A 1A2OA 1QNLA 3JPYA 3Q9SA 5KQGA 3QELB 1K66A 3TB6A 3A3KA 3I42A 1ZY2A 3H6GA 3Q7SA 3KG2A 5JS2A 1YIOA 5DLEA 4ETNA 4WWHA 2L17A 5JNVA 3K4HA 1CHNA 2HSGA 4N0QA 3CG0A 1Z17A 2FEKA 3LKVA 4ZJPA 1ZESA 5TQJA 3N6VA 5E3JA 4Z0NA 2MSWA 3H1EA 5KQLA 3Q15C 2WRZA 2MSKA 3MF4A 1ABEA 1ISRA 2GX6A 4D6YA 1PHRA 2FQXA 4RKQA 4YP9A 3JVIA 4MR8A 5JS1A 2LPMA 4MQEB 4JB0A 4IGAA 3QLUC 1JYEA 1Z26A 2FVYA 1M2EA 1DRKA 3HDVA 3KS9A 1P2FA 3O1HB 4Q6BA 3VNBA 4ZMSA 3C3WA 1C4WA 1JHZA 2WB4A 5KQPA 4OLAA 3NNSA 3LUAA 3I09A 2FN8A 1YK1A 2QVCA 2I6FA 3R0JA 3KSMA 3H5OA 3LUDA 4IMIB 2E4YA 4Z9BA 2QZJA 2JVKA 4TLMB 4B09A 5FBKA 3JPWA 5FWYB 1EWTA 7ABPA 2MYTA 2CHEA 5TPZD 1OXKB 2MYNA 3GYBA 3HS3A 4LZLA 4Z4HA 3HUUA 1DBWA 3GT7A 4O1HA 3LFTA 3EDCA 1D5WA 5FWXA 3RVPA 3QLVC 4L4UA 4YO7A 5IUNC 3TX6A 2JBAB 2IPAB 3CRNA 4G0ZA 1RNLA 1TLFA 4ETMA 5EWMA 2Q5CA 1VRVA 3JS5A 2WWVD 3G1WA 3EAFA 1USGA 2GI4A 4RK1A 3M9XA 1EAYA 3Q7TA 5EWJB 4W5TA 3CFYA 1D1PA 5C5CA 4KQCA 3K9CA 6CHYA 5DGCA 3W9SA 3QX8A 4ZYLA 4KZKA 1ZGZA 1GLGA 3HV2A 3QLVA 2PUEA 3HO1A 4KK3A 3ROTA 3H1GA 3S99A 3O21A 4EY3A 3A10A 2MYUA 2PLNA 3EJWA 3N8IA 3TO5A 1USKA 2HQBA 4YR7A 3CNBA 3GRCA 2JRLA 3HSYA 3QX9A 4RXMA 5JNTA 5HKOA 3CLKA 4YGXB 3M9WA 4F12A 3OQMA 2A9QA 3LKBA 4MR9B 3QLUA 4MQEA 1E6LA 2IPMA 2KYRA 3A0RB 1UDRA 2BGGA 4KRFA 2DRIA 4O1IA 1FSPA 2VUIB 5DTEA 4CBVA 4YLEA 1BVHA 3QLTA 5IX8A 3HVRA 3DLHA 1NTRA 3RVKA 2M98A 2XDYA 3L6UA 4W5RA 1BA2A 3KTOA 5C5EA 4MGEA 3HM9A 1EWKA 4QYWA 4RSMA 4NCBA 3NBMA 4JP1A 4PE5B 4RXTA 4E7OA 3MM4A 1ZHHA 4MPTA 2CD7A 1U2QA 3NNNA 1D2AA 4IILA 3TD9A 3HCWA 4PYRA 2WJAA 4MRMA 4TMYA 1U8TA 1XHFA 3QELA 3QEMA 1MVOA 1ZGGA 2NZUG 3KJXA 1FQWA 2IYNA 1NXPA 4N0PA 1JL3A 3SM9A 2JVJA 3JVDA 5IUKC 1IIBA 1RXIA 3DLBA 2QR3A 2PUCA 4XLTA 4Z4CA 3OLZA 4YCSA 5TQ2B 4Z4GA 2ZAYA 3C3KA 3IPAA 3H5VA 4M88A 1YVUA 2QU7A 3F6CA 4MR9A 2YHAA 3IP6A 1SXGA 1DG9A 2CWDA 2FLKA 2FXIA 2LP4Y 2RDMA 3KYJB 4JAVC 4RZSA 1P8AA 3D02A 2GKGA 3EODA 4H60A 4F06A 4RXUA 1DZ3A 3EQZA 1VPWA 3LUGA 3KCNA 1QP4A 5IC5A 3MQ4A 1LBHA 1TJYA 4GPAA 1FFGA 4EVRA 1Z18A 5PNTA 4G0XA 1BDHA 2R47A 2X7XA 1RPJA 3GBVA 2H0AA 1SXHA 3GBPA 2PUAA 3UKJA 4W5NA 1DCKA 3L49A 5F64A 3CZ5A 3QK7A 8ABPA 2J48A 4Q6WA 1ZAYA 1QQAA 1M5UA 4WUTA 3SAJA 5TQ0B 3I5AA 2OQRA 3UUGA 5D2CA 4EYGA 3HXMA 4GNRA 2PUDA 5CNMA 3OQNA 4WZZA 1NY5A 5EWLB 1ZN2A 5FWXB 2L19A 2YHBA 2E4XA 4Z4IA 4WXMA 3SY8A 4JB2A 1ISSA 2FMKA 3IP5A 5HQJA 2F8TA 3RVMA 1Z25A 5TQ0A 5TPZA 1NXSA 4P98A 4ZMRA 4HNQA 1DCMA 2ID7A 1YS7A 5HM6A 1ZITA 1F4VA 1SD5A 1XWWA 3N0XA 4G0YA 4RDCA 2FN9A 1DBQA 4PZ0A 5GOTA 2WJWA 1PUXA 1HEYA 4KVFA 2JCGA 1PEYA 4EYKA 5JNSA 3H5IA 3LOPA 4O5AA 3LMKA 3CG4A 4EYOA 2E4UA 1P6QA 4LX8A 3FMVA 1TM2A 1AB5A 4G86A 2PAFA 3LUCA 3F73A 4S04A 5TQ2A 3DBIA 3E3MA 2FMIA 1ABFA 3G85A 2QVGA 5KI6A 1JFSA 5CNJA 5CHYA 1URPA 3QEKA 4WT7A 4YV7A 2RJOA 4LE0A 4QICA 4MYRA 4EYQA 3RVNA 2VK2A 3BRQA 1SRRA 1KMIY 3RVSA 2W42A 5DCLA 2PUGA 2QW1A 4JASB 1KRXA 1LK0A 1YTUA 3DGEC 3BREA 3GL9A 5IUJC 2E4VA 4YRZA 2O20A 4KMRA 5TPWA 3KYIB 2B4AA 4N47A 1VLZA 2F8SA 4EGSA 4MS3B 1QQBA 5JNRA 3RVQA 3CKMA 3NNDA 4DN6A 5IEJA 4W5QA 5KQMA 3OLYA 2R48A 4KFCA 4RWEA 3RVLA 2FEPA 1NATA 2M1ZA 3H6HA 1OXBB 5TPWB 4N41A 3OO1A 2PKXA 4RY0A 2VYCA 1QPZA 1PEAA 2FMHA 4QPJC 1P6UA 1H9CA 4MS4A 1Z2DA 1JBEA 4FE4A 4G97A 4XFKA 4F11A 4G0QA 1EHCA 1W9HA 3RQIA 3D8UA 3F7NA 3LTEA 4LDZA 4JOQA 3RVJA 1F51E 1I3CA 4MR7A 1DP4A 4TLLB 4L85A 4S05A 1QP7A 3ILHA 3NHZA 3RH0A 1D1QA 1Z13A 4Z99A 2A9OA 1Z15A 1Z2EA 2PMCA 2IPNA 4D6XA 1J56A 2FKAA 5KWSA 4Z4FA 1NXOA 3N0RA 1TMYA 3HUTA 3FFWA 4UHJA 2LUOA 5I4CA 5BQ3A 3M6MD 1CEYA 2IKSA 2NT4A 3BILA 3HK2A 2GWRA 3ROFA 2PL9A 3TMYA 3SNKA 3I45A 3LUFA 3H1FA 4H3KB 5KC9A 4PEVA 1JFVA 3BRSA 1L5ZA 3Q7RA 4ETIA 1Y1LA 3IP9A 1R8JA 4UHKA 1W25A 1LBIA 1MB0A 2FTKE 4MS1B 2HQRA 3A0UA 4RK4A 3IDOA 3MMNA 5TE9A 3GA5A 2A9PA 4FB4A 5JNUA 2IDMA 3CS3A 2AYZA 4N03A 5IULC 2P4UA 1ZH4A 4KQ9A 5HSGA 5T7BA 1PNRA 1A04A 1T34A 3B2NA 4HYEA 2E4ZA
chains in the Genus database with same CATH superfamily
2J4FA 3IIJA 3QKSA 2UYHA 3FLAA 1IQPA 3OESA 4PIPA 4EPWA 3M82A 4K40A 5KJ1A 3EQ8A 5EMLA 3KXPA 4R31A 2R6HA 4YUZA 5A6SB 4AO6A 4IX9A 5AW2A 2VAWA 4X54A 4ND3A 5T3UA 2R44A 4EZIA 1VPTA 2GCOA 1P7WA 1E2DA 4X63A 5A3VA 1CUWA 1BMFA 3CJTA 4O4IF 1RHRA 3DW3X 1R0CA 2GK7A 2XRZA 1SEPA 4LZZA 3M1IA 2DWPA 1WUIS 3C7AA 4A6PA 1PG5A 4D4MA 3WLLA 3DD5A 4B9AA 1FJ2A 4PYLA 5GPBA 2G5CA 4RDXA 3H8JA 2XUHA 4Y7DA 1UAYA 1K27A 2MSCB 3QVTA 4MS4B 1H2YA 1LQTA 4KYVA 1N2XA 5BSVA 4MRSA 1KR5A 4QPZA 1MRSA 5EVJA 4F5ZA 4JDUA 2EQAA 1DC7A 1SM4A 5SZHB 1GEEA 1I51A 2ON6A 4HVAA 4IEIA 4M7OA 8LDHA 1HQCA 2RC6A 3RRNA 2NVWA 4W9NA 3VO8A 4DBZA 3A9SA 3F71A 4DLZA 4QUKA 4XQ9A 1UK9A 2QMQA 1HFWA 1DXQA 2G07A 3DC7A 1K68A 3MG9A 1TF7A 3H7AA 4PLHA 2AJLI 2R65A 2VK8A 1X2BA 4KG7A 4YC7A 2NU8B 3NAMA 3DL4A 1IBLB 3DO6A 4LN1A 4F3NA 3SG0A 4KR2A 3ZQJA 5EUMA 5AJWA 1Q11A 1ZM9A 1TQ8A 3JZDA 1Z29A 4PHCA 4UE6A 3O47A 2BONA 5EIBC 1KETA 4C0BA 1X1CA 2QRZA 2VBFA 3O1JC 2DPLA 2PS9A 2WU8A 3W6PA 1VGRA 1OBCA 2DQSA 3I53A 1IUOA 3PL1A 4LY3A 4JGIA 1CEXA 2WI8A 3S29A 2I99A 5JXWA 5BSWA 4CUZA 1Y7HA 4OG2A 2ZAMA 1JIVA 3FDFA 5HE9A 1OLSA 1UZAA 1PR5A 2IJGX 3GD7A 3QTLA 4EUKA 2FCAA 3VPBA 3P0FA 4AUMA 4N3NA 1VLJA 3FF4A 2VATA 2Z9BA 4RDIA 1SB8A 2PS0A 1O95A 3VKHA 2HGSA 3CZ9A 3QE2A 3E9DA 2IP4A 1V25A 1U4OA 4KSCA 4QPDA 2HDOA 3JAWB 3IEUA 5DBIA 2HCFA 3QMMA 2Z08A 5F5XA 1QP0A 1G20A 1KXZA 2ZB3A 2ACVA 2P1RA 3QRWA 4YO8A 5EP1A 3F9CA 3QYPA 3ZZMA 3BMOA 3CCBA 5G4LA 4E1AA 4NABA 2QLMA 1SKYB 2V6BA 4K5QA 1TA9A 3OAAD 3EDMA 3SVZA 2G9ZA 3DMTA 1DRWA 2B30A 2O5RA 3NHJA 4Q7JB 5HF9A 5L3ZA 1E92A 3GJXC 3JQGB 5AM1A 4IH4A 2QL7A 5C51B 1BWSA 1XRQA 1D03A 3BMOB 3HCFA 5CVJA 4DA0A 4PPQA 4BP1A 2PZEA 3FKSD 5LQJA 1G20B 2GHRA 2HLNA 4II3A 2FCRA 5ECWA 2P0EA 1JGTA 3JAWA 4X00A 5DB4A 4MO2A 2OHJA 3D43A 2WF6A 3SS7X 2UUOA 2YH2A 2WJZB 1I3LA 1FDSA 3G1UA 3KSBC 5E9WA 4CEHA 5H68A 3L05A 4PGAA 4IOLA 1ZK4A 4TVBA 2MSLA 3QPDA 5ALQA 3URMA 5AVVA 1MH1A 3RIXA 5HDBB 1V7PC 2IYUA 1OLSB 3QPVA 1QE5A 3OC6A 4XQCA 5I48A 1BIFA 3PNKA 1BDIA 3TZ6A 1PJBA 5M2QA 1FRNA 3G8DA 5DLDA 2W6CX 4HDQB 5A2GA 1QIGA 4QASA 4NJOA 3PUKA 2EP5A 2O7QA 3HDGA 2Z2IA 3CZPA 1EVKA 1JLLA 5A4JA 1E9RA 3TW4A 3QJGA 2KMLA 4IF6A 4UPVA 1BQ4A 1CFJA 1MDBA 4YK7A 1ATZA 1E3LA 1PYDA 2CNOA 1LX6A 5JCJD 1D6NA 2PUHA 1VKOA 1A97A 1V48A 5B6JA 4PZAA 5F2EA 2FE1A 3TE7A 2A7QA 4DDTA 3TFWA 1NI5A 4C05A 3V9AA 1ULAA 4D8XA 5BNFA 4MQ5A 3EAQA 3RU9A 3WRXC 1MOQA 3ANXA 2JIBA 1JIQA 1UQRA 4U9HS 4AO8A 2VG8A 4K0KB 2EEPA 4ID3A 4KLAA 4MB2A 4MI1A 4LYJA 5CP8A 2J7KA 5DLEA 3UHFA 4H3SA 3USCS 1P29A 2BL4A 1PWEA 4DIFA 3KTAA 2L17A 3VHRA 3YASA 5JJ5A 1E2PA 3A4IA 1IDN1 1LKZA 2JH3A 2VP4A 5DZSA 3EC1A 4O29A 3THWB 2YINC 1P7VA 3EXAA 2Q46A 1XEXA 4JC4A 2BMAA 2SBTA 4L02A 4DANA 4JYCA 3R9XA 1J7KA 2SKDA 1Y7LA 1ABEA 1IC6A 3MJRA 3KT6A 2Z4RA 3S6JA 4RTSA 1T8UA 2R62A 3HB0A 5KVAA 3F1LA 3GLTA 4JEIA 1SKQA 5EHIA 3WNDA 5BV0A 1JYEA 2BMFA 2NSJA 2HC9A 1DRKA 3HDVA 3KDSE 8GPBA 3HJGA 4EX6A 1YUBA 3AHCA 1TTTA 3WDLA 3UKOA 5GTDA 3I9OA 3QKSB 4KYTA 3ZD9A 1YK1A 3PVZA 2EX1A 4B3XA 2QUJA 2AQIA 2F1JA 2VF5X 2Y1KA 3QI7A 4CM6A 3DL7A 1ISMA 4MHSA 1YQTA 3KJNA 1EGQA 2IHVA 4M0EA 4PFSA 5NLLA 1Z0DA 1U7XA 2WA1A 1SBHA 1E2NA 3LKZA 3MAJA 3WL8A 4QVIA 1EEXB 3AV0B 2WWHA 5K2MA 5TPZD 3EAGA 1OXKB 3EASA 3OY2A 4M9RA 4CCYA 2YV2A 1WPQA 1SKYE 4B80A 1JYSA 4CCYB 1YDEA 3NBXX 3FE2A 2XV1A 3JQ9A 1BWPA 5B7NA 1NULA 2XNHA 4MV0A 1B76A 5HFAA 4JJ7A 3E27A 5JQGB 4XLZA 1ZBQA 2XY4A 3CRNA 2AN9A 3PQCA 1VPEA 4FEGA 1CZUA 3RM3A 4HDMB 2QQEA 1DARA 4ON9A 2J31A 3RARA 5E3IA 2AN1A 5E4FA 4DDHA 4KODA 3I2IA 4A0HA 4AZVA 2GI4A 2AN5A 2BUBA 1G8MA 1JVNA 2ZBRA 3G2IA 3TKYA 4J0IA 4OQPA 1RQGA 2H1RA 3O94A 3QVWA 2P2GA 5EWJB 5FWAA 5T6BA 4AY4A 5IBCA 1I1NA 4MVJG 1F14A 1GCOA 2VOEA 5BWNA 1BOOA 4QOIA 3BXOA 3GXBA 2IUYA 3DBVO 2I1QA 4NENA 4W8GA 2DCMA 4UTZA 3WK4A 2B5OA 2IEDA 3EB9A 3UOAB 3W9SA 4AQDA 2IE0A 2EX4A 1GPDG 3UV6A 2HRQA 1J6UA 3DLAA 4Q4HB 4MPRA 4KK3A 1JQAA 3BPSA 2VHWA 4C6SA 2ZYIA 3LX8A 3NW9A 4LTMA 4A2PA 4C1BA 5F2NA 3CLVA 2VTDA 4KJZA 3LNTA 2JGNA 3CNBA 4KE6A 4MW5A 2FZEA 3HSYA 1LNZA 3WOVA 1DAFA 4YRMA 4UEJA 3BHIA 3OD5A 1YL7A 4XZ3A 1CQXA 1UP6A 3CZQA 3D54D 3QLUA 5DYYA 3SOZA 1PN3A 2ZSUA 4IV0A 1J8YF 4KNWA 2NTVA 3G9TA 1KK3A 3JYHA 5D85A 2O8BB 4C0AC 2W90A 3WZ2A 4CBVA 3O4IA 1X13A 1RADA 3IEIA 2QD5A 2RHTA 3L6UA 5KYWA 1IWOA 3D6VA 1YBMA 4TYWA 4G0WA 1U11A 3STYA 4H31A 3THXA 1WOYA 1HDCA 2O8VA 4HNAA 1YJ5A 2CXRA 2PS1A 2WD7B 3ABRB 3PDCA 1ZHHA 1EGVB 2XVAA 1PGQA 5FTKA 1QIKA 5FPKA 1ZKDA 1FNBA 2FRXA 5CX1B 1RM3A 2HT6A 4BB9A 2DBQA 4YMGA 3W6ZA 3L2OB 2WJAA 1W0KD 2A84A 4TWZA 4UFOA 2C54A 2C3OA 3KOZA 1T9AA 1J8QA 4UFPA 4MZDA 1Z37A 3LPLA 3N74A 1NXPA 2BBWA 5J9FA 3TR5A 1OSNA 4O2BA 3MGBA 5LM3A 3CKLA 3KLPX 5HUJA 3FOWA 3TZBA 1T4GA 3IT3A 4E5NA 3GROA 5CFMA 1QKJA 4S1TA 4QXMA 4AJLA 2QR3A 3DB2A 4NHOA 3KRTA 3EWSA 1RI3A 5TQ2B 2WKPA 2ZAYA 3VPAA 4RSGA 4PC7A 3LBHA 4YCNA 2XXAA 1LK5A 4B75A 1GSOA 1OWLA 3EWNA 3WLKX 5A5VA 1JEOA 1QF7A 2XBUA 2YN2A 3CF4G 4XD2A 4AP6A 2R8XA 1PZXA 3G2QA 3SU8A 4RTRA 3BGVA 3LIIA 1Q3TA 2WT9A 4C4PA 2GKGA 2EFGA 1X7XB 3D7NA 4F06A 1PRYA 1VLQA 4RXUA 2XWQA 2A3RA 1IM8A 2QN1A 2VDWA 2AWNA 3EBOA 2X4DA 4I0WB 2YVUA 4L2IA 2ZTMA 1ZCZA 1EM6A 3H99A 2CD9A 1ONBA 2H2IA 4LHVA 4AMVA 1U2EA 2X7XA 1GQSA 3GFRA 4YONB 5CW1A 2R1ZA 2CHQA 5J43A 1PQYA 3ONDA 1YI1A 4EYSA 2ZETA 1WB4A 3PCTA 5BT9A 3KOOA 1GAJA 3SAJA 3UY4A 2Q2VA 1RCFA 1N2EA 5B3AA 3N3BC 4Y6LA 4B6JA 1FZTA 5G3YA 1U9IC 4LJKA 1O3YA 1B7GO 1K0UA 4ZT2A 1UFKA 3OQNA 4RZIA 5DNUA 4GU5A 4PBTA 1W0JD 3WKDA 3PJFA 4FWTA 2DU8A 2C7QA 5AHOA 2GXAA 2O2IA 3D2AA 3OJWA 4J1TA 4X97A 3SY8A 2Z98A 4L50A 3ZGVA 4BJ5A 4EM6A 2WHEA 3G0OA 1A7JA 3INYA 3CZMA 2N46A 1GGVA 1HC7A 1JU9A 1AZLA 1RABA 4RIIA 1VFNA 2ZLBA 4S2UA 5CJPA 2NTNA 4FR5A 1SD5A 3ZLUA 2P62A 1WKVA 4FYHA 2PUWA 3VHQA 3SLGA 1P1KA 2XNDD 2QTNA 2V9ZA 4TXLA 4BO7A 1VPLA 2CT8A 1HYHA 4DIBA 1T0UA 4PAOA 4M3NA 3VOBA 4QNNA 4ZI7B 5BVGA 2WOOA 4CM9D 2REOA 3HBFA 4GL4A 3BMQB 3KAQA 4R1SA 4TRMA 1A2BA 4WNAA 2CC2A 1M8FA 2P1DA 2RIRA 2XPCA 3LXMA 1P2VA 2W5UA 3NV9A 3QOFA 4K2HA 3F73A 2Q8PA 2WVHA 2QUKA 1WXEA 1BJKA 2QAGA 4JT2A 1URPA 4W7IA 2NTJA 3BWCA 1CG6A 4LE0A 4BP9A 4GP7A 1W36D 3DZBA 2HL6A 3GFSA 1MIOB 2VHVA 4Q39A 3F7OA 4X24A 4JFAA 4Z53A 4NBVA 3MB5A 4P7KA 2BDTA 4M89A 2B5VA 4U00A 1KWGA 3UN1A 1B15A 3A26A 1M76A 2WNIA 2E4VA 1XNJA 2PY6A 1TCAA 2G1AA 2GETA 2VNSA 3IDQA 4R8SA 3A6DA 1ZNWA 3O31A 4PPNA 4C0XA 1QJCA 3UMBA 5HRAA 4Z3DA 2CE7A 4EJ6A 5KNDA 4FSHA 2AKEA 1FP7A 4EITA 5HJ5A 1PZHA 4XWYA 2B4YA 1NOJA 3NPAA 1EBUA 1FTQA 3QXHA 3VOTA 5IEJA 2R48A 1QM5A 3OCUA 3OTOB 3L8ZA 3ZN2A 4ZTBA 2M1ZA 1GDDA 1QRDA 4KACA 4Q3KA 2QRGA 2G09A 4TT3D 4BNHA 3OO1A 2PKXA 4NE2A 5AOAA 5FULA 1QH1B 2IWHA 3DZFA 4JQYA 3KPUA 4CG1A 2XGJA 1OYVA 3NH6A 3NTQA 2OO3A 3L79A 3KZKA 4RD4A 5EIAA 3KT8A 1UP4A 2FHSA 1KVQA 2PU5A 3LTEA 1LDEA 3DZGA 3AB3A 4O8CA 3QE4A 1L2TA 3KVRA 1O96A 3ZGXA 1SQSA 2YC4C 1E0KA 2P40A 4D8UA 1QRSA 2A57A 1GNTA 3AF5A 3PQEA 3D5QA 2H4WA 3HJNA 3RIGA 3T5GA 3VR4D 3BQNB 1HTBA 2Q0SA 3MAAC 1M0TA 4D7AA 3GHHA 4Z5XA 4OSPA 1IU9A 4XEHA 5H70A 4UBLA 3HUTA 4RTNA 3P0JA 4RD3A 4EG3A 1WZCA 5E6SA 1G0OA 1QZTA 2AGVA 3TTXA 4Q3AA 5BMVA 4GR4A 1UKAA 2FPPB 5KC9A 3FWZA 3IT2A 3PRHA 4K1LA 1T10A 5AFSA 4UBOA 4KDFA 4B2LA 1B42A 4YT4A 2G88A 5GJWC 2IZOA 3KTFA 3VC7A 2P1ZA 2I2CA 3L6EA 4UCFA 4F3YA 1HYBA 1AO3A 1JEQB 1W25A 1ECJA 1ZGBA 1BSVA 4D97A 4QECA 2APJA 3R5XA 2NVUB 2ZVQX 1O8BA 2QTTA 3EMDA 4FNAA 1RWXA 3OCJA 1JLRA 4A0RA 4BWYA 2FG5A 2OB2A 5HK8A 3DMGA 1IZ9A 2HLPA 2ZJZA 4BJHB 1NPYA 3CS3A 1N5KA 3I76A 1ULBA 4G5SA 4JJEA 7AT1A 1A7AA 1W4BA 2YCLA 5EHQA 3QBJA 3VTZA 4RIHA 1EE9A 2XKKA 1A04A 4U2GA 1G2OA 2DFTA 3WHKA 5DKFA 3IHLA 1G8FA 4EELA 1C1XA 3DMDA 4FYIA 4RVFA 3GAMA 5CDTA 3W5UA 5BPFA 2XHEA 5FWYA 5JYEA 4FMCF 1SHJA 3HKDB 3LT0A 3DNFA 1OZGA 2W2LA 4IZOA 4BGEA 3EG9A 3GGOA 2AFIE 1DRJA 5AXCA 3GLQA 3HC7A 3OJFA 3VUEA 4YCDA 4WZBA 1PQPA 4DIMA 4U7HA 3UJDA 2AR0A 1IPEA 2UZ4A 4EHNA 1QHGA 1TADA 1PGPA 1F0YA 2B78A 1TA4A 2VHYA 3GJ8A 1KK0A 4QG7A 3SI7A 3QIAA 5B4VA 2A9FA 1ZHFA 2DHRA 4JD5A 1BS1A 3ZLBA 5K0NA 4AI6A 1XQXA 4I5DA 3WLAA 1ZVQA 3L7CA 4GR5A 4CG3A 2JDIA 5JLAA 3LZCA 4PFKA 1H2AS 4IIGA 3DDZX 1AE1A 3QJYA 4H18A 1UKVY 3LQ1A 2PZMA 3PTZA 1VIMA 2O2EA 3EUFA 1PG2A 5EP4A 4G4SO 2Q1YA 4IMJB 3GEPA 3C3PA 3ICQB 4LZJA 3S2YA 1XPRA 3OZRA 5AOVA 1G8HA 1L9XA 1ZIOA 3N2ZB 3GNSA 3SDSA 1X1TA 1AMUA 2IHKA 5B3JA 1E2HA 3HHEA 2AXQA 4HNGA 1O95D 3L77A 3ZHSA 4BO0A 1XZBA 4HHEA 2TYSB 5T41A 4XSVA 2Y0EA 3GIWA 2VOJA 4D0RA 1FFWA 1RKBA 1OKKA 1KGSA 4ND7A 4XYGA 1A71A 2GLXA 4JYMA 4J2TA 2D2XA 2J6CA 5I7UA 4NCAA 1CF4A 5JC8A 3FRHA 2XTNA 4ARUA 4GRAA 1A2KC 1KBOA 1PUJA 5JCXA 1VM6A 1MOPA 3QLJA 3LECA 4KNYA 1J0CA 1U0EA 3ZDRA 3D8TA 5AIBA 3PX7A 5BSGA 1NKTA 3FJYA 1C4KA 2NV2B 5CM9C 3REQB 3FGZA 5JCOA 1CVRA 1USVA 1WNTA 4GDMA 4EPVA 4FB5A 4YCLA 2P6RA 4W6ZA 4I3GA 2GNPA 3VBCA 5KJCA 3U7FB 4MV6A 1VXOA 2GM9A 3B1VA 1WAMA 3VZSA 5DGIA 1OVGA 5IXJA 4BMOB 4X93A 4KOEC 3AY3A 3HO6A 3FF1A 4JI4B 3HR7A 1KXJA 2YHUA 5JTTA 4EG0A 1FDWA 2PX2A 1M33A 1T2DA 5T3YA 3PLNA 3VV3A 1JH9A 4ZK2A 3BXEA 1A98A 3GRRA 3HBNA 1PV4A 2B35A 2OB1A 2LZ0A 3OMXA 4QOSA 1U9IA 3PD0A 2BFFA 4JYBA 4D3FA 4O6VA 4EY7A 1N6NA 1SK8A 4JLKA 3LA6A 5HJEA 4RHFA 2E7ZA 3S2FA 1OX4B 3P9RA 2XODA 3KVNA 4I1SA 4OHKA 3IA7A 3M34A 2AOUA 4XAQA 5CK5A 1M1YA 5SYAA 3HUFA 3Q9NA 4RK6A 1Z75A 3TQFA 1GILA 2QLJA 3OX3A 4HYQA 4IF4A 4XXHA 1G8AA 1QONA 2RG7A 3SC3A 1S2NA 1VKRA 1ZC3A 2FF5A 3UAOA 4CCWA 1JKFA 1XMJA 2WAYA 1XTIA 3GEEA 4N3AA 2Z1NA 3IR6A 2A58A 1ETHA 2ZRAA 3KKNA 4FKZA 1OZ0A 1I3OA 3GJYA 1KY2A 3IRVA 1FYXA 1L3BA 4C14A 4OBXA 1I4DD 5H5JA 1T1IA 4MKGA 4CR7A 3NTRA 1AKRA 1HLGA 2JLAA 4PU0A 1U6KA 2A0WA 2ATEA 2C99A 3IAM1 4M55A 3NIFB 1Z4IA 2C61A 3A4YA 2HLDD 3A8TA 3EUAA 5L95A 1AQJA 4UREA 3L0IB 4XSHA 3MAGA 2Q4RA 5HOQA 4C4SA 4MEBA 4O4IA 1KF0A 4L5CA 4RGVA 1OD6A 1P45A 1YZYA 2I2WA 2BFCA 3FI9A 3C6QA 4JLDA 1U9JA 3NFYA 3SDBA 4PV7A 3LV8A 1T25A 3PQFA 1RZRD 4BVBA 3VDMA 3QKIA 3ZD7A 1HOXA 1HDZA 2XQVA 2Z2KA 3HXLA 4NYMR 2W6JA 1WNFA 1C3OA 3W2GA 1JALA 3OE5A 2B8JA 2A59A 2TMYA 3MGAA 4UARA 1U0BB 3TLEA 4OFBA 1NBIA 1ZJ6A 2GJAA 1N5MA 2UKDA 1RC8A 3WGMA 1ECLA 5BQXA 1FFDA 4HH3C 3GPCA 2GEUA 2I80A 1LRJA 1M8PA 3K0BA 1XNRB 2A4KA 2HN9A 2PSEA 2AOTA 2IHBA 2ZJBA 1O57A 3HA7A 3HDHA 4WOBA 3UNXA 4XX1A 1HMPA 1QNLA 3DE1X 3Q9SA 2CYAA 4N82A 3ZCPA 4WPGA 1UCFA 3QELB 1LWOA 1K66A 3M3DA 1NMSA 4U2EA 1A5ZA 3JQRA 4LVOA 5LLTA 2VCEA 3DWIA 1FSSA 1L7BA 4ZYUA 1L7AA 3NHYA 4FC6A 3SZRA 4F4IA 1QCZA 2WC1A 4XD7A 5CDHA 4ZAGA 2REQA 2DVMA 5TT0A 5FQNA 2H2DA 4B3IA 3C6MA 1Z17A 2HRCA 721PA 4HXYA 1MRZA 3EFOA 3IUYA 1YVEI 2BTEA 1W4AA 2EBWA 3OEWA 4UEOA 1EUYA 4YP7A 3LX5A 3N6VA 3VR0A 3N1UA 2H2HA 1DEOA 1Y1KE 4ZQCB 2HI0A 1YA6A 1OAKA 5F23A 1OASA 3E22B 1ISRA 3MF4A 4OBEA 4NPHA 2X42A 3AM5A 2HCJB 2BHRA 4PQEA 4QDTA 2O7SA 1P4RA 1QGYA 3KT0A 2GJSA 4IGAA 1V43A 2OFXA 4EKGA 1WD7A 1VI6A 4Y9RA 5REQB 2GCEA 1AOXA 1UFQA 2Z2XA 1AMNA 3ZZUA 1I30A 3BS4A 3I2FA 2GEBA 3NCTA 1OWPA 2QLFA 2P79A 2J5KA 2X4GA 3DXYA 5J58A 4Z4QA 5FI0B 4QXQA 3ZIUA 5SYMA 2O5CA 2D5CA 4ZQHA 3RKSA 3QF4A 1A1SA 4J2HA 4OI2A 1P81A 3GYBA 3G2LA 1G9TA 4MUMA 4OHFA 4BN5A 4IIFA 1KEWA 5GZ1A 4ZO7A 1P6XA 1V4NA 2D00A 4HLUA 4DT1A 2YZ7A 5A5GA 3QLVC 4YO7A 4Z9XA 4KXLA 3S70A 4QOGA 3LU1A 1XTBA 4FFVA 3I1IA 4TMKA 4ENWA 2MSDB 3JALB 5C8YA 5DM1A 4AZ3B 4CEIB 3OWOA 4TYPA 1Z36A 1K7FB 4KNVA 4BNYA 1KC1A 5ALSA 3O73A 4PAMA 1AHPA 4WEOA 3FDIA 4YMLA 3Q7TA 1JFLA 3BH6A 4YRTA 3LO5A 4LHZA 2PMDA 4M0LA 4OQ4A 3KE8A 4Z1MD 1DWPA 4O4HF 3WHPA 4TM7A 5DGCA 3TQSA 1LGYA 1UPAA 4YIHA 3TSCA 2RGGA 2SICE 2WP8J 3QX8A 4XDZA 1CSEE 1L4BA 1M1ZA 2A1TR 2A2ZA 2BW0A 2C20A 2GYYA 4ZVRA 2VP6A 4C5AA 1MQ8B 2PKQP 4OXKA 3BB4A 4QO8A 1YUNA 3MCAA 3RBXA 3ZG6A 1ZXXA 4BX3A 4IVQA 4FPXA 1OC2A 4KZPA 3LS2A 3CT6A 5ICCA 2MYUA 3FPBA 5JOQA 2CBGA 4WK2B 1N2CE 3VAZA 1X8KA 1NJ2A 2WIDA 2WUEA 4CMJA 5L3RA 2P91A 1OBHA 3PNLA 1MV5A 3CEMA 2J0VA 1QF9A 3WGYA 3ONVA 1WB5A 4B6RA 3AJDA 3LAWA 3EBLA 4L22A 4WA7A 1N6IA 4GX2A 3CVYA 1O87A 1LNSA 2JZCA 1GPBA 2C3YA 4HYTA 2BM9A 1HQDA 2OHGA 3CCFA 3IOBA 4UUOA 4XB1A 2LXNA 1OTXA 1XXHE 2OP0A 1D9ZA 5IX8A 2DZDA 3MTJA 4K86A 2VBCA 3VH1A 1O97D 5AP9A 1Q84A 4D4KA 2BIFA 2IK8A 5CG1A 1E1QD 1TEXA 2XA1A 1YJAA 4TSFD 2MDTA 1JEDA 3LK6A 1XKLA 1XU4A 4BOYA 4ENVA 4EH1A 1V8OA 2XGGA 3E5NA 1YO6A 3R3JA 4NF2A 4FNOA 5CYFA 3SLKA 1UEXC 1YDFA 3Q3EA 3QWFA 4LBWA 3GLUA 3PGJA 3AF1A 1M8GA 2X8BA 3KEQA 3PPWA 5DBFA 2EIHA 1SEVA 1P19A 5AJTA 5IYZA 2WVJA 1EDZA 1RFGE 1FQWA 2D3TA 2FOXA 2IYNA 4NZOA 2C9MA 3ESBA 4WXRA 2JKZA 3FMOB 3H0CA 2BGKA 5AKZA 4B5KA 3HB9A 1CB0A 1BW9A 1U1CA 5AIAA 4B7ZA 3VI3B 3AZQA 3LRTA 4FHFA 3IPAA 5DBEX 4Z4GA 1D8TA 3IPYA 3LCCA 4MRPA 4QQKA 2AIRA 5LR6A 3IJ5A 3C5EA 2GN4A 1XZAA 4XSGA 3IP6A 5KYGA 3DOHA 1LWNA 2WMNB 3WHLA 1LZKA 3O4VA 2LP4Y 4PGHA 3QUAA 2NZ8A 1GKLA 3MXTA 1HWYA 3JSAA 4MTCA 3HCOA 3P9ZA 5COBA 4RTQA 3ORFA 2DTDA 4O4JA 2A9KA 2CLLB 1P0PA 2YJZA 4HH1A 3ZHZA 4K8RB 5ITSA 2QBYB 3BRCA 5PNTA 3U3OA 4E31A 1YRYE 3Q0IA 1NONA 3OOYA 5G3ZA 3EA4A 5FIUA 3GBPA 2GKOA 3E03A 3ND8A 1F3OA 3M4JA 1SVLA 4Q24A 1TTPB 3OX2A 2IYOA 1W4LA 2XZDA 2AL7A 3HGMA 4JB8A 4PLVA 4Q6WA 1M5UA 1ZX1A 2AJTA 3BWVA 3FSRA 1MORA 2ECKA 2I4LA 2OQRA 3E9YA 5TSDA 2ALJA 4EQZA 3ER9A 5T4BA 2PUDA 1GA4A 2KHZA 5TQVA 2HJWA 3M2TA 1DKQA 1JHAA 1QKIA 2W37A 7YASA 3UEOA 3HL0A 2WZCA 4JB2A 2MWMA 4G9BA 2O7VA 2I2BA 5TQ0A 1YA8A 1BS2A 2ANCA 1WIWA 1AQYA 2I6UA 1T5BA 3MCUA 4DA6A 3SJCA 5LPNA 4GMKA 3RU7A 4BECA 1M2WA 2ZBDA 4NS1A 3F1KA 4ACAA 1RHJA 1GT91 3ABIA 1IEVA 4V0ME 3E9QA 1HEYA 3PUYA 4JDPA 3S2IA 2JFZA 4NAVA 1XQYA 4QOHA 3MZ0A 2D5LA 3SJZA 5J4YA 2I4TA 2OKGA 2VZLA 4EYKA 2XB2A 4W63A 3KKZA 5C3UA 3NGMA 5A4DA 4HQ0A 3R5SA 3WL4A 1JSXA 1VCIA 3WAKA 2CFOA 4TT3A 5H4HA 1UC4B 3GVPA 3E3MA 2FMIA 2QVGA 4OXYA 3BULA 2PYIA 2ZYUX 3X2FA 1AURA 3OZDA 2ZCVA 3VMFA 5I7HA 4YV7A 4CMIA 2WWWA 1Z6TA 3CRVA 4Y18A 5BWOA 3JQAA 1G7RA 3SZMA 1MF7A 4IWXA 1V41E 3RVNA 3IH5A 1UPXA 5LZ7A 2PMEA 1T1GA 3ZCSA 3T3GA 2QW1A 2XUIA 5GGYA 3TOZA 2B6NA 2XJ4A 1Q83A 2RHRA 4J07A 1L4HA 4FX2A 2WNSA 4Q4CA 4S24A 5TPWA 1UDCA 5CB6A 4GS5A 2WG0A 5EXTA 3OT1B 5D8DA 4YAKA 4N01A 5J2TA 1I5EA 1ZD5A 4I6JA 1TU4A 3RBZA 2BJWA 3RS7A 4DN6A 4ZYWA 1C7FA 1V8FA 3MCVA 4TKUA 4KFCA 1VMKA 1LDGA 3DVQX 3RK0A 1GA1A 4HRXA 4M36A 4M9CA 5BMVF 1N33B 3GLFB 1LS1A 2ZTHA 4OV6B 5LIPA 4HTFA 4HWRA 3LYHA 3NJ4A 1YI8A 4XEUA 4B6EA 4I1OA 1B6TA 1Y8RA 2BF7A 3IMGA 3FR7A 1E0DA 2RGEA 3DOOA 4C3VA 1EFHA 3CW2A 1C4OA 1MJNA 4GE0A 1Q0TA 4FFMA 4X3OA 4RACA 1MQ9A 1L4GA 2O0KA 2IW1A 3EIEA 4GZ6A 4XLLA 4OCZA 1MU0A 1IN7A 1ZR2A 2EU8A 3RKUA 1IUKA 1QZZA 3VRHA 3ZDCA 1UEIA 3ORYA 4WNYA 4YAUA 1GZVA 2P4HX 5CDFA 1RVV1 2FG7C 4YI3A 1BU5A 2WHQA 3BCHA 1JHPA 1E5TA 1CD5A 2DTXA 4MCJA 4N0EA 1KJYA 1OT3A 4LYEA 1NWHA 1ZUWA 1DO2A 1DDIA 3C8UA 3CEPB 2WM8A 1U8ZA 3QFFA 5ALTA 1RM4A 5EZQA 5G4KA 3TL6A 3DT6A 5I4CA 1KPHA 1UL1X 1SU8A 1IG0A 1KYWA 1XT6A 2JGEA 3V4FA 1XLTC 3CKKA 3O2NA 3QV2A 2GWRA 3ROFA 4EFNA 3OA2A 2F3RA 3PYXA 2HMTA 2X2EA 2D1RA 2V6FA 1UKYA 1I2ZA 4YACA 3FYHA 3P96A 2O54A 4JVSB 3RV4A 3CH5A 2II6A 1ESMA 4BGDA 4QDJA 1DAIA 2A0UA 2DFNA 4FWBA 3VR2A 1KP9A 4BFYA 5A9RA 4P80A 4XW2A 5FWNA 2ZI4A 2X7JA 2UXDB 4KUGA 2Z95A 5BWBA 2J3EA 3H2HA 1X1AA 1RAHA 1YZVA 3WSVA 1PZMA 3HGTA 3IAUA 1VI5A 3THOA 3HXKA 2OCDA 3RVBA 4WN3A 1JG4A 1KAEA 2HIGA 3NIDB 4IGIA 4CLEA 5B57C 5KYUA 1Z4JA 3K31A 5AICA 3A36A 4TTRA 1N8SA 3EC7A 2H2WA 4QUJA 5TARA 1FVXA 5HTKA 4PGMA 1SIWA 1T9DA 2P41A 2H9AA 4OQQA 2YWRA 3GFQA 2PS3A 3EOAI 3T1NA 4U4AA 1FS5A 4A0SA 2LIVA 4UBMA 1Z4MA 1KO4A 4XIGS 5HMLA 1C1YA 1OXSC 1W52X 1Q7EA 4LV6A 1DBRA 5F1OA 2ERCA 3HP7A 5LL6P 2J4DA 1R0SA 1TJPB 2HJSA 3PDIA 4R7TA 3OPQA 5F78A 3CTPA 1UXOA 3NV7A 2J9XB 2IEAA 4MQ4A 4ZV9A 2X0DA 3GH1A 4CLHA 5MFPA 1YU6A 5K20A 2NZVG 3EMKA 4JI6B 3N58A 1N9GA 1PZEA 1BCSA 2H11A 2ONCA 4Y2QA 1TT5B 4LVCA 3F6PA 4I4TB 1ZUNB 1JR4A 1MG0A 2F4NA 1YU9A 2PL1A 2SKEA 3CPEA 5FL3A 4ND4A 1Q57A 1C9YA 2PGAA 4MIEA 3ONEA 4HZIA 4QFMA 4WN9A 4EW1A 3I5YA 2C94A 2HPHA 5J5VA 1Q7RA 3TZCA 1KRWA 2HQ1A 3TNYA 3DEIA 4IBOA 2V7VA 1KJJA 4RA9A 5F3DA 3RO7A 5HGXA 1HR0B 4G0UA 1QQ7A 1YQDA 1AZSC 1N6RA 1Z0UA 2O2HA 3D0OA 4DLVA 2CYBA 3RR2A 3JVEA 4TWBA 4WXEA 2F55A 3V8MA 1A3CA 2QV0A 4HAZA 3N2KB 1H66A 1RMTA 3FRJA 1NVKA 1VIVA 4QDZA 5LQCA 4I4TF 1YT5A 2HRRA 3BFXA 4ENSA 1I0ZA 3HXTA 2H08A 2CFRA 3P20A 2J85A 3JQ8A 4NCXA 1GGJA 4RF5A 3L0YA 3H5LA 2R1TB 4R8RA 3HU5A 1P9RA 3GEMA 4MB0A 3RLIA 3R3YA 5CM8B 4F21A 5EMHA 3GLGB 2HSEA 2C03A 3L7JA 4H77A 3WO1A 3KOYA 1Q44A 2M6RA 5EJFA 1T5TA 2J6HA 2Q2WA 2YXLA 4E5YA 3DS8A 3VTKA 1SUSA 2D5IA 4GBJA 4Q9DA 1HFKA 1TKAA 1XAJA 5H80A 3SP1A 4ZFNA 1E8DA 4DG5A 4JBWA 1MAVA 2O0MA 2Q45A 3KM0A 4OF4A 3BE5A 5JG7A 2EHJA 3VZRA 1KVTA 1X6VA 4POOA 1N1MA 2ONYA 5HE8A 1AKUA 1G21E 2WWFA 3EFEA 3BF8A 4RO0A 1ACMA 1MB3A 3DGFC 2JIZA 5K0LA 1RYZA 2ZBVA 9ABPA 4I66A 3P2IA 5J2UA 1GUDA 1NXVA 2IOHA 5BN4A 1VJRA 1SKMA 5JS7A 3RUFA 3V7WA 1VPVA 3QTBA 4HPXB 1RRGA 1L7PA 4XUEA 1I6LA 1GTRA 4YP1A 1XMPA 3WBJA 4CNBA 5JDIA 1GZ4A 4F46A 1CYEA 16PKA 1W35A 1SUPA 3ENNA 3KWLA 3L1KA 2ZYVX 2ATIA 4OYLA 2Q2QA 1XZIA 2OAQ1 3BEDA 4BNXA 5KOHA 2BGNA 1EFVB 3TRKA 4HGOA 4GW3A 2AW5A 3FNFA 3H2BA 1DKOA 4MWBA 4U7TB 3DNPA 1G5IA 3PFHA 1RYHA 2DULA 3H11A 1Q2UA 3R5KA 4HN2A 4REMA 3W5VA 5LA6F 4ENRA 4DGQA 4OGKA 4TTJA 4ZANA 1MXFA 1YA4A 3HJTA 1PSWA 4D9EA 2BFMA 4HEHA 4ERNA 1Q1ZA 1EP3B 3JXEA 1ZHOA 3HA2A 3H9JA 2OCBA 5F2OA 3LI2A 3S8EA 2H4ZA 4IIJF 1ZH2A 3DLPX 2CK3D 4NL4H 1E7RA 1KY3A 2DJ5A 3QKRA 4FR2A 3ZW7A 1NDQA 3AYXB 2O8EB 1AXRA 2VRCD 3Q40A 4IHJA 3OTWA 3ZJ4A 5JVDA 3E58A 3ACBA 5DSZA 2B4QA 2VUHB 4XCVA 5DW3A 2D2FA 5HJ2A 4EBBA 3PR2B 3IP8A 2PCLA 1GCAA 4I9GA 2ZI5A 4L5JA 3ZJVA 3LLUA 3NHLA 4EPRA 2IS6A 4CF3A 1P0MA 4ZOLF 4CV0A 4D45A 4JCCA 4L5AA 4CM1A 5EJ9A 3NHWA 1GTMA 4H7HA 4KO4S 4NJMB 1QE3A 5CU7A 1UR5A 1ZMTA 2Y1LA 1Z12A 4OLBA 5FPPA 3IQWA 221PA 3EXIA 4LXYA 4O1MA 1ZJYA 4D74A 5TRTA 3R7WB 4BO9A 1HT2E 3AP3A 4NY1A 1ECFA 1NVGA 5DULA 4JLNA 3TDNA 2UUAB 2YWDA 2BKXA 4Y2TA 6ABPA 2XUJA 3S81A 1P0FA 2MT9A 3ZKWA 8ATCA 2C5BA 1X80A 2MMGA 3D6FA 2VUSA 4FSXA 3QVUA 3IURA 4BZQA 2OVBA 4OUDA 2CXPA 5KX5F 1QMPA 2ZQYA 4K9DA 4QL3A 3NT5A 1U5BA 3HN6A 4RL4A 2VTKA 5AVQA 5CTAA 1B8OA 4QREA 2R79A 2B25A 4G1BA 4TGLA 1WBDA 2FX5A 4PWYA 3T3PB 2OV8A 3L18A 4Q4AA 2P90A 2OZVA 5HZMA 2SECE 1R5JA 2I6TA 2X58A 4F1JA 3F6SA 2HD4A 1A9XB 2C9CA 4DY4A 5H4GA 5JD6A 2JGDB 2UUPA 5KTNA 2X4LA 3AQIA 4JODA 5FOSA 2A7XA 1J2YA 1UIMA 1P1FA 4V1CI 4ZZIA 2J08A 1I94B 5L7WA 2EWVA 5IDWA 1IPFA 1MAUA 1SUIA 4MULA 3M1LA 2LDBA 3DWEX 3G49A 5TQJA 3U1TA 2MSEB 3R8CA 3UWPA 1DHTA 4B45A 3D6HA 3OPXA 3VU3A 2AXPA 1YR2A 1WHSB 5KKNB 1KHTA 2J0QA 2GX6A 1FFCA 1TZCA 3C5VA 4Q1AA 1Z6XA 2DKOA 1R4ZA 1A27A 2PMWB 1KU0A 3HA3A 3B8HA 1FP6A 3LW7A 2YR0A 1JHZA 3TQOA 4BJ6A 5KSYA 3GUVA 4BCDA 3B12A 2QM0A 3BFKA 5KVVA 3DVAA 5JBNA 2FPKA 3ED1A 5IN4A 2GDZA 4IHAA 2NO0A 2QRVB 4DPKA 1FCJA 3AWDA 2BTOA 4BXOB 1EWTA 3CXRA 2BFAA 1S2OA 1YVDA 3NXKA 4G0NA 4H0FA 2B7CA 3NHSA 3P26A 4Z3KA 1O5TA 2W2TA 3HR4A 1KEVA 3C2QA 4ZCTA 4KXUA 5FLXA 3HE3A 1Q50A 4QXAA 2H0RA 3KHUA 4QBFA 4XTRA 2IPAB 1G2IA 4H2DA 5FO0A 1NWCA 4QT4A 4LBZA 3PEUA 3GJ7A 1QGUA 1C0KA 3OEEA 2IUUA 4BVGA 3AR5A 3L4SO 5JATA 2QX7A 3VNVA 3U17A 1C8KA 4KO8A 3NC4A 5A62A 2HPZA 5HF6A 4ZGGA 4S12A 3LJKA 3OQPA 5D5HA 2CLDX 2X8JA 5JAHA 5LJIA 4QC2A 5KPJA 2ZKIA 2X22A 2QIPA 1HQYE 5FI1B 2BGJA 3S7ZA 5ALLA 4NYIQ 1MEEA 4FHEA 3O8RA 3LXUX 4TQ9A 3MOGA 2OAGA 5G1PA 1XTZA 2C59A 5LB2A 2FSGA 4WFIA 1PK9A 4ADSG 5JHHB 3PD7A 1P3JA 2O52A 4Y2PA 3W34A 1F17A 1MJ5A 3ZZ1A 1WM1A 3IUPA 2QXTA 3LDHA 5GY7A 3MRSA 4OP3A 4ZYZA 3SZ3A 3TOXA 3ANTA 2HQBA 5AM5A 5AWFC 4C03A 5K5EA 3GRCA 4X62B 3TTWA 2EKDA 2NYRA 3PGA1 4LZWA 4ECAA 5IXSA 3RYCA 3QX9A 5L45A 3E7DA 5MHTA 1ZWLA 3DFZA 5BO5A 4ABTA 2YV4A 5BWLA 4M0CA 4MI6A 3ILVA 2Y0BA 4JJKA 1JV2B 4BNLA 4RBNA 4DIOA 1Z8FA 3JVVA 5JZ9A 3QG1A 4JP2A 1V95A 4CF4A 3IJPA 1SOUA 4L5IA 3R7AA 2DG2A 1NF8A 2LCIA 3HKBA 1ZJ4A 3OZEA 4HADA 4JR2A 4L0MA 4MP6A 4AJEA 3JWJA 3JQBA 4R83A 4RXTA 4L8WB 2MJLA 2CLFB 3E4CA 1GKKA 4NK5A 3SBEA 3WYDA 1BXGB 3GJ3A 4ZV4A 1DB3A 2CD7A 5KYVA 4XPIB 1G64A 4AMZA 2H7YA 1YR3A 1GITA 2XMRA 1D2AA 2WF8A 4GKAA 4K05A 4LOJA 3BORA 1U7OA 2JLWA 2LDXA 4CQLB 4OB8A 4E08A 5IXYA 2P67A 1EHIA 3OZXA 3P4YA 1ORTA 3FYTA 1Z7EA 3HU2A 1E96A 1ZS9A 2K5UA 4NTZA 2BE9A 5PGMA 1JJAA 1KAGA 1S89A 3PQ6A 2QENA 1CF2O 3KK0A 3U09A 1UT5A 5E1DA 3MTGA 3DBOB 1PJLA 3EDRA 1IWPB 2HBZA 3AEQA 2R1VA 2R1UA 4D92A 5FH9A 1S3FA 2NYAA 2IF0A 3L0OA 1ZNXA 1YC2A 2PYZA 2YHAA 4IUBS 4V39A 4RJ2A 1SQ6A 2ZI6A 1O0BA 2NU6A 4R2XA 4DDWA 5ALUA 4D9KA 1VOTA 3BXFA 2RHBA 1U02A 1WS6A 3HNPA 3L7IA 4KTTE 1ENOA 1R1DA 3H6KA 4O25A 3NIWA 1LBHA 2HYIC 1TE2A 1QUEA 2D4AA 4ZIRA 3F4LA 3VTAA 1VHTA 4HDKA 3U13A 5A3JA 4BUCA 4LBYA 5JJKA 2PV7A 1M34E 3OWHA 3WGZA 1LLQA 2PUAA 3ZGYA 3HFGA 3PSHA 1CS0A 3GD5A 2OGUA 5FF9A 5JSZA 3O8LA 4X3CA 4BMCA 1DKUA 1IXYA 2IYYA 2A5GA 2G1JA 2JLZA 3NIGB 1TQ6A 2Y6VA 2JCBA 4U7WA 4P0QB 4DCUA 3BK7A 3F4BA 3KUUA 4R84A 4GPBA 4P92A 4ZD6A 2I55A 1F3LA 2RI6A 3S2ZA 4HQ6A 2LCQA 2ZBEA 4X7BA 4HD8A 3IEMA 3OSZA 3WIVA 2HCTA 2XSZA 3C4JA 3I73A 4HZUB 2GTPA 3O03A 2AT1A 4P4TA 2G08A 1SCUB 4LK2A 3RVMA 1G59A 1TM1E 3G3EA 1HLPA 3MJDA 3ZY2A 5GONF 4BFTA 2DM6A 4UOQA 4X6YA 3GJRA 1YS7A 4BQNA 1GO2A 2P5YA 2X9QA 4P81A 4UAVA 5KS2A 2AMVA 2QGNA 2ODNA 1KE2A 3R7NA 3RADC 1T8TA 1AGXA 3GLHA 2XMBA 4LBVA 2XDWA 3W3AD 4E5PA 1K6MA 5A9SA 2JJ8A 2H65A 4F72A 1EWRA 4ZVVA 3AEKA 4Z1MA 4EMSA 5FL7D 4MGYR 1FXWA 2E3JA 3LMKA 2VAPA 1KNXA 4I14A 3VGPA 4NCJA 2UDPA 5HMMA 1X1QA 3HVJA 1ESZA 5FI3A 2VQEB 3AR4A 4WZ6A 1N3YA 5LBTA 4KXXA 5IKXA 2C7OA 4IJ6A 4B82A 4U63A 1G4AE 1HE1C 3EPPA 4C01A 3OZAA 2W4QA 1QO9A 1XX6A 2QT0A 3SC2B 2PKWA 4BVFA 3LCVB 1E2JA 5ALYA 3KR9A 4Y98A 4J0EA 2AG8A 3SKVA 3I8XA 1OXUA 4QWWA 1X8JA 4LY9A 5JAOA 2ZXFA 2FW1A 3BGSA 1LK0A 2DPMA 3CSUA 4OXRA 4O4HB 4R16A 4KUHA 4NDZA 1H69A 1T1SA 1QYWA 3DV0B 4CMEC 2GFQA 1QRRA 2FWJA 1CRWG 2F3UA 4KMRA 1E1KA 2Y1OA 1I10A 4FZJA 4Y7CA 5ALDA 2XTAA 3HY4A 1Z34A 4B2PA 2F8SA 2HRZA 5AW5A 3DOJA 4PPFA 3KQLA 3I39X 2H2AA 4OHRA 2UVDA 1KBZA 3TLCA 1TYDE 5LYJA 1JXMA 5DLQC 1CY0A 1KOJA 2FEPA 1EINA 2XCQA 2WTEA 4JWTA 2AZ4A 2YDYA 3EFHA 4JX9A 4WY2A 5HS6A 3TJZA 4E2WA 1A9YA 2I1LA 4HL6A 1N2IA 3GUZA 4JGGA 1WE2A 1UODA 2NACA 4O4HA 4CN9A 4GICA 5B3LA 1AS3A 3MWJA 1MKYA 1TQDA 3DPUA 3W3AA 2J7PA 3QVGA 5IABA 2WP0A 1WW8A 2PX0A 2K4MA 3PS9A 3HCNA 5B2ZA 1UPFA 1FQJA 2L42A 4QODA 5JMOA 5SY6A 1WXHA 5HCUA 1N7IA 3AFHA 1NGSA 2Q6VA 3FSGA 2EOAA 2OORA 2Y4NA 3N2YA 3KJFA 3NHBA 1PJRA 2P3OA 2YFKA 4R98A 6REQB 4UNRA 1D1QA 4V2UA 1G5RA 4AK9A 1BXRB 2H07A 5G40A 5JYDA 1D2GA 2GBCA 5GONA 5LP6B 1KOGA 1C8LA 2ZUDA 4YB8A 2YX1A 2A94A 1T36B 2GZ3A 3D6AA 5I51A 4M98A 1ZLYA 1DBVO 2OWDA 4WEQA 1NQTA 3OZGA 1GZSA 3CRMA 4BC1A 1BDBA 4V2IA 1J4AA 4DLXA 3ZPXA 1AGPA 5A9SB 5BQ3A 1IXRC 4MWCA 4C7KA 1PNOA 1FTSA 3U4CA 4LGVA 4C78A 4XRGA 1S2IA 1X39A 3I37X 1I1HA 2JLRA 4EB3A 2DBYA 3BWMA 3NHRA 4J4TA 2NQ8A 4EO9A 1N7HA 1J00A 1AS2A 1ONNA 4HWPA 4ZI5A 4UCQA 1ISPA 3CGWA 3BG5A 2WTBA 3OPYB 2ICAA 3VYSB 1A2QA 4DLBA 5HQ3B 1E98A 1A8QA 1RJ9A 4IM7A 1EM8A 4C21A 3MMNA 4EMBA 4BFLA 2X7HA 5DK4A 1VA5A 3H1AA 4JI3B 1XEAA 3HYSA 5IM4A 2HBYA 4ZAWA 2W6JD 3LVFO 1N6OA 4B7UA 2NQTA 1ETUA 2QSYA 4JNKA 2YASA 5BVHB 4Y2GA 1J97A 2WM9B 4QU9A 1T34A 5IT5A 2VZEA 2ZJ0A 1PQ4A 1X0VA 3WTBA 4ZI7F 5KOYA 2DFVA 2E4ZA 1Y5NA 1QH0A 2GPTA 1ZGCA 1UC9A 4HDKB 4XDYA 4PC1A 1MTOA 5EP3A 1OV4A 3C45A 1I13A 4ZIRB 2I66A 2XYPA 1TK9A 2QN8A 3CXUA 4IFTA 1LSSA 5ALJA 2VLBA 1DMRA 2K2WA 1GTJ1 1Z5VA 4FIZA 3TR6A 1AMOA 1JFTA 1JDPA 5DX1A 2IOFA 4FNGA 3U16A 1NMEA 1EVZA 5CT4A 5ALVA 1RWKA 4PCLA 2H7CA 3L7MA 3VQTA 2V5VA 4MK4A 4CU5A 5A7HA 1U2PA 1E5XA 5K0GA 1WP9A 3KQOA 5K0ZA 2UZ1B 5KSWB 3FW1A 1QLWA 3TIIA 1H85A 2YMPA 3IKJA 4PLCA 3RU3A 1MPTA 3AEQB 4XQ0A 2VJPA 2Z1DA 4EY4A 1TGVA 4G1UC 3EXHC 1FS6A 1DRUA 3IP7A 3JQPA 3HM2A 3R3ZA 1QVZA 1Y8QB 2VH1A 3MLEA 2CJFA 3NOOA 3P7MA 1QO7A 4DLSA 3NWEA 4RUKA 3BDVA 5ULLA 3NTVA 521PA 4NMXB 4DMFA 1F6BA 3SHFA 4COKA 3IMKA 4ZGWA 1XLWA 4MI9A 4CLOA 2K6GA 3B38A 3A1WA 1HYGA 1M6YA 3RRFA 3JRXA 2P2LA 1MX5A 1Y5MA 4NNJA 2BZGA 1FU7A 2HIMA 3MWFA 5THQA 4RM2A 3T8YA 3ZWVA 1T0IA 1D0IA 2A1TS 2JKVA 4JQOA 4PX5A 3V3TA 2N47A 3H5TA 3HKBB 3V34A 3TMKA 1II9A 3J7AC 4OQNA 5BRJA 2GNOA 1AUVA 1T5SA 2P4SA 2VDPB 1NMZA 1WHTB 3B1YA 4MLCA 4PNPA 1JPNA 1RRFA 2RGNA 1KDOA 4YS6A 4PSVA 5ECDA 3P9QA 1YMVA 5EG5A 5L7TA 1QKKA 4HQNA 5FADA 4A26A 4EEKA 2XCTB 3EX7C 2Q9AA 4X45A 4DIUA 1X2EA 4UUAA 3ICEA 4A23A 3UJ6A 3I52A 2JNWA 3EULA 2OG1A 1AZTA 1HDRA 4DCGA 2IL1A 1VHWA 1BWRA 2ZWAA 3ILXA 4HDSB 4RMJA 5F33A 2ILTA 4EG4A 4BRUA 2QVZX 2FN4A 2PXAA 3LC0A 2BFBB 2DPGA 3KVVA 1VJ1A 1V0JA 1QZXA 1RKXA 2PBFA 1OGYA 1S2MA 1ESDA 1NBOA 3PHLA 1LF5A 4N5MA 5ALWA 1PR2A 2PJUA 1YKGA 2IEGA 1DDOA 1NXTA 2CFSA 3PR3A 4C4AA 2COEA 4O3MA 1W5TA 3WWEA 4Y1EA 3KTDA 1P7YA 4Y1GA 4RZ3A 4YRPA 3SZOA 1GFWA 3TMAA 4ILEA 3WKCA 2FDCA 4DQVA 1AN0A 2WLSA 4WINA 2GEFA 4X20B 4Y9TA 3KQKA 1GU0A 2BTQA 5LXTB 3G9QA 3HVIA 4KQ6A 1IJKA 4FYWA 4RK0A 4ZAVA 5A05A 3PC4A 3KJZA 1I6WA 3GJQA 2CVPA 3BBLA 5D3MB 4UDNA 4PHTA 2RGWA 4GO1A 3H4IA 2RCNA 2XMSA 1W0JA 3O92A 4GG1A 4MYHA 1X1EA 1K08A 4DSTA 5CCXA 1K1EA 4IZHA 1IY8A 4HWGA 1CJUC 3K6KA 5I9LA 4TZ6A 3T9BA 3PFBA 3R7LA 5C80A 5FORA 3LXRA 1AV7A 4IS2A 5B6IA 3QJ5A 4RPCA 3EYAA 4JR0A 4PXYA 2XZLA 4MVCA 1HDYA 4FW9A 4U7GA 2VF2A 1NC3A 4C3OB 4LRYA 1HRKA 2R4QA 4Z49A 3A2KA 3N75A 1DQZA 2QQ0A 3NDIA 2XE7A 1QX4A 2Q6LA 2Q1UA 2C04A 1R6TA 1SY7A 4MYUA 4INZA 3G9XA 5FBHA 4C0LA 5EIBD 3LF2A 1NZJA 5CB8A 2ZB4A 1KRHA 2VA8A 4ZGBA 2R87A 5SY9A 4BY9E 1A8PA 4ENPA 3IEKA 3VR5A 5K45A 4BBZA 2FW8A 4LJ5A 1GKIA 1U0SY 2SCUB 3SIXA 2Q4EA 3B2QA 4XKJA 5G0WA 5IDQA 5L53A 2QX8A 3LC2O 3D0KA 1QYRA 2DT5A 4WE3A 4URWR 4G1EB 4NDAA 1X86B 4WOPA 4N6OA 3Q3JB 4EHDA 5JY6A 4KE9A 1VBNA 4RHEA 1PS0A 1GARA 2QORA 4P35A 3ESXA 3FLMA 5A4KA 1SCIA 1NN5A 1TDJA 1R18A 3RNLA 1WUKS 1U8UA 3T3NA 3VZBA 1P1CA 3ETCA 3HWSA 3H1TA 4QGBA 5LJLA 1MA0A 3HWX1 4RDHA 1V3UA 3WQQA 3ZNNA 4HEJA 1AQLA 1A4UA 1JKJA 2Z09A 5EQFA 4B43A 3K2IA 4I4LA 1BQEA 1Y7IA 2HXSA 3NATA 2XMZA 4KXFB 1ZY2A 3DV0A 4W7HA 5JYCA 3IBTA 5FUMA 1Q7GA 2PKYX 2B92A 1VL8A 5JS2A 3UFXB 1NUPA 3R0IA 2VO1A 3CA8A 4OHPA 5C18A 1UADA 1XZCA 4WY8A 1E3SA 3E7PA 3TNLA 1Q1QA 7REQA 3T0GA 4WI1A 2AHOA 4MW1A 2AD1A 4IUDS 1XRLA 3MMPA 3DHNA 4RPLA 3NPMA 5CLLA 1I6MA 2XKJE 4PRKA 5AW0A 2GXSA 5HUHA 2MSWA 5K8LA 2O3TA 3RAEC 1HEIA 1RI4A 2Y8EA 4MJXA 1PR4A 2OAP1 4DAOA 4GMXA 4NMWA 2ZJ7A 4XX0A 3CWQA 3R41A 2QSZA 2FQXA 4RJKA 1KNQA 2PXCA 1IYZA 1ZD2P 2FVYA 4A27A 1UZLA 4MMXB 3FJOA 2PSFA 3PHBE 3VNBA 1SQ0A 1H22A 5FAXA 3V55A 2HF8A 3DJYA 3UHAA 2VBIA 3H04A 1A5AB 3HRHA 4LUCA 3W4JA 4DKXA 2VBGA 2D0IA 4RF3A 5EN4A 1XTPA 1N92A 2Q1SA 3RG8A 3BHMA 3WZLA 4LWOA 3QWHA 4IMIB 1Z2CA 3G0DA 1RJWA 5C1BA 2KI5A 2HIAA 3BDAA 3ZU3A 1U6JA 4JXXA 2CHEA 3O4GA 3O8NA 1N7JA 1BQ3A 4F1KA 1J0XO 4J75A 3GNLA 2JBHA 3D2CA 4Y1RA 5JISA 4II7A 1DBWA 1IHDA 2L0XA 2NAPA 3SZUA 3B1XA 2WZDA 1EX7A 1SUCA 2XEXA 3T4XA 2W48A 5ALIA 3UWKA 2O2GA 2BOVA 3ZDQA 3WWYA 1PAUA 2G28A 3KZVA 4GQAA 4KAJA 4KYUA 4UNNA 4YCAA 1OLOA 3KX2A 3R7FA 4OJKA 1Q0LA 3EC2A 1ADYA 2Z04A 3PDUA 4LSMA 1HG1A 5JV5A 4Q9IA 3QF7A 4DC1A 1JHUA 1QJ4A 3GARA 3HSKA 5HKAA 2FEOA 4O4LB 1TMOA 2ZRJA 1SB9A 1PD0A 4JBNA 4CCSA 1T9KA 1DOZA 2PGNA 3K9CA 1T24A 2PSHA 5CLJA 1EXVA 4DR7B 4EVIA 2FSUA 3DTTA 4BVEA 3F2IA 1CR4A 1FUKA 1GLGA 1WCWA 4JL6A 1QC5A 4G67A 3TG2A 3GP5A 3K0FB 4KHZA 4R1PA 3NXSA 3TQIA 3ETLA 3QYFA 2GZRA 2WF7A 4JL8A 3VU0A 3A10A 4DIDA 4F3RA 2CL5A 4NDNE 4C2UA 3CUSA 1PP4A 1Z8HA 1NT4A 2FG6C 3ET4A 3ZBQA 2CJWA 4KQFA 4ZC8A 4UZSA 5AHWA 4EKIA 4CIYA 1EGHA 1P0CA 3CLKA 1KVRA 4RJJA 5JH7B 1I5OA 3B60A 3O7WA 4MR9B 5DNWA 3CZRA 4MQEA 2OM6A 4RFSA 1W30A 1CJBA 1P72A 4C1NA 5B1YA 1U65A 2Z2YA 1JILA 1VKJA 5ITWA 3DB1A 5CGQB 2WV7A 5DIFA 2ZSHA 3ZEIA 1YB4A 2NV6A 1IVSA 3DZCA 4XCXA 1C2YA 1AY0A 3GLSA 3OPYI 4P7BA 2GARA 4MH0R 3KKMA 3FUUA 4R2HA 2P3SA 2KM1A 3C5HA 3FSJX 3TLBA 3C4VA 4O3FA 2YJ4A 1VGVA 2JEOA 2G4CA 5J4HA 1IK4A 1N9KA 3WJAA 3GPBA 3N6RA 3QWIA 3K5IA 3GLGA 4I50A 1H5NA 1FRZA 5GGXA 2NU7A 4Z86A 1QHHB 3GGDA 3WJ1A 1TYAE 1QHHA 3W79A 3JQ8B 4OKSA 1N57A 3I4FA 4RNCA 4N5NA 1ZGGA 2H8KA 1B26A 3N5CA 1NSYA 5IT0A 1QR6A 1UPCA 2CFCA 3V4VB 3BJIC 5DM4A 4HT3B 2FPRA 1M5RA 1DAPA 4LF9B 1XA3A 2IY7A 1FSZA 2XA9A 4CPDA 2Y2UA 4JLSA 6Q21A 2F48A 1ZRSA 4UUQA 3W0LB 2WUWE 3CRRA 2IVFA 2V03A 3MPOA 4EMUA 3VYVA 3NDRA 1D4AA 4WN9B 1Y6RA 3ORHA 4MR9A 1H3FA 5IFKA 3ZVMA 1MB2A 3D8SA 2W8ZA 3H2GA 4C89A 2FMTA 1XCOA 2PDAA 4IYJA 5CFOA 2WSIA 3EF0A 1EX6A 3DUFA 1O6BA 3W5CA 2F3SA 2XXBA 3A1DA 4I6GA 3W5AA 4YDHB 4FT4A 4PAGA 4ODIA 4BTVA 2J5BA 3NT4A 4JJ6A 4HEA1 2Z5VA 5P21A 4CLRA 2AJ8A 1I0LA 3T3IA 4GPTA 3R7BA 2HEIA 3I2GA 3OU2A 3ZWPA 1WPGA 5MN5A 1T1RA 2VQSA 3F8WA 1CJCA 2YOFA 1II0A 3U80A 1X92A 4D43A 8ABPA 3B8EA 1QGUB 3OD1A 3OQ1A 2ZSBA 5AK5A 3Q1KA 4GPZA 4O4LA 1K6EA 4Q1BA 2ZOSA 1MZVA 2HA7A 3KB8A 4LJLA 3TIGA 4LVUA 1M6WA 3O4JA 3H1BA 4YBZA 1W6RA 1XF1A 4NZNA 4WZZA 4IHQA 5EE1A 4CE6A 2V7PA 3G2NA 2NUTA 2C58A 2WIFA 3VISA 4AT1A 1QIJA 3MUFA 1PFVA 4J0CA 4LMPA 5TGTA 4E14A 4R69A 4DLLA 4UHCA 3QVXA 4FYJA 2BKLA 4RVCA 1PG0A 1JZQA 5HQJA 1W0CA 3FKSA 1F4PA 4HLQB 4AJIA 1ZSYA 1TOAA 2ZRLA 3IKVA 4OMDA 2ONZA 2YXBA 5HM6A 2HRBA 2F6RA 3MMSA 4GOLD 1CQWA 4PZ0A 1E8MA 5U4XA 5ALGA 1EH5A 3WLFA 4C2TA 3VPFA 3V2HA 4IO1A 5DXFA 3NVAA 5B64A 1I2BA 1DGQA 3UK7A 2JATA 4HRAA 3DTVD 2OKCA 3SF8A 4TYMA 2CV1A 1EK0A 1EG7A 1ZSVA 4MVJA 3DVLA 5D7BA 2OUKA 3FZYA 4J0JA 4KKVA 5AKGA 1JEAA 1WHSA 1PJCA 3ROXA 3ZU6A 3DE2X 4XI9A 4B6SA 4BKRA 5I7EA 1O7JA 5ISMA 1JSCA 1E3MA 2W22A 2WINI 2RKBA 3BJZA 2OXTA 3B1FA 3VR4H 3WQHA 1GR1A 3QM1A 4LDJA 5T4HA 3ELUA 2V7QA 4IEFB 1IHYA 1LU9A 2AB0A 2R3SA 2W0MA 2R8EA 4F4HA 4RZQA 1H0KA 2YZMA 1USWA 3OURA 1YTUA 3BREA 4LJ7A 3UQZA 3ENVA 3FZEA 1P2SA 4ZEOA 1CRZA 1MCZA 3I6IA 4HTFB 5A3RA 3PYLA 3GUHA 3DVRX 2JW5A 2ZPTX 3KYIB 2IHNA 3A31A 1O8CA 4I5EA 4DA8A 1VLZA 3SYNA 2O50A 4MS3B 3FGNA 4BDSA 3B13B 4FZRA 2DWQA 3MCTA 1O5OA 2CEKA 3NYIA 2F9LA 4MKHA 2BRUA 2ZSJA 1M2OB 1ZK3A 2QG4A 4JSTA 4LOKA 1QHYA 4AJ1A 3BERA 1QV6A 3K35A 5TPWB 4N48A 3E8MA 4Q1FA 3MHTA 1K9VF 3PXBA 1X80B 4L73A 1I80A 3C87A 3NG1A 2QMHA 4QYSA 4RQUA 3RTBA 4XGKA 3E82A 3BTOA 1O1YA 5H59A 2PGJA 4H08A 1QAQA 4RH3A 4PNZA 3WGKA 1TM7E 3PFIA 3SEZA 4CMEA 3KU4A 3IXMA 2M2IA 3I9KA 2CGEA 3JAKA 1J39A 1WWKA 2FUG6 2KBFA 4G89A 1MPXA 1E64A 1K7SN 1TYZA 2IYVA 2Z57A 3BCSA 3SSNA 4EQ6A 1T3LA 1HORA 3EG5A 3I32A 3ZEAA 2VSQA 3BC1A 2IV7A 3QFRA 4F9GA 2IWRA 4LSZA 1YAHA 1JTEA 4RIGA 4QFDA 4EUEA 5AW3A 1F8YA 1ZM7A 2OYSA 3UUEA 1CRLA 5MN6A 2Z0MA 5KINB 1J56A 3KYCA 2J33A 4NNPA 1FX0B 1DQYA 1QV7A 2V1XA 3EVGA 1XKQA 4HX5A 2QLLA 4IHJB 4KTVE 5JVDB 1PUIA 2GZ2A 3PC2A 1JHDA 2JLYA 4B31A 3QVMA 1YQWA 2WIJA 5ADUS 1PVOA 1E6WA 1MJGM 3KOXA 1JDSA 1F4LA 1KU6A 1PR6A 2DT8A 1SG9A 2JJYA 4LF6B 4B7AA 1X9IA 1NIPA 1SVOA 2H1WA 3B36A 3TBFA 2VZ8A 2V0GA 2R0QC 2WIBA 4BNDA 3FXAA 5EJ5A 3KPWA 1JPUA 1M0WA 4MQ6A 3V5NA 1YOVA 2W6ID 5CJJA 2YXPX 1UFVA 4EF5A 1R0BA 1L5FA 2FUEA 1GYRA 3N6XA 3UA4A 2P9ZA 2J3DA 4GQIA 4D9HA 3VAYA 3DMFA 2NNLD 3DMYA 4Q3EA 4KBGA 5CT9A 3PNOA 1GQOA 3UMVA 1EP2B 3IPLA 2PAAA 3PVCA 4KQ9A 4ARBA 1RQNA 2GPNA 2PCJA 2VF7A 3OU7A 5DNDA 3NEYA 3TRFA 3WBFA 4EJFA 2M1XA 2QBYA 4DWJA 3URKA 1PLLA 1WCIA 4P4NA 2JAUA 3WK6A 5I9BA 2CLHB 1ULUA 2ZT8A 1NX6A 4X8HA 4NONA 3WO0A 4BAUA 1UJ6A 5FLKA 1UOQA 3U0BA 4O33A 1BU8A 4MKIA 1US8B 1RWMA 1QDEA 1G66A 5KIAA 1I4OA 1PT5A 5E3HA 1WCV1 2X41A 1BJRE 1KFEB 1UZNA 4FX5A 2AW3A 4PVCA 4RK5A 5IDVA 4XVCA 1EJ6A 5G0VA 1QYXA 1NVTA 3KFXA 4RMHA 4HFRA 4DUZB 4E30A 4RVGA 1PE0A 4A15A 2C0PA 5B1EA 3U1BA 2G1PA 4DAEA 1NRJB 2PUTA 3THSA 1SPBS 3L8YA 4D8YA 5CDSA 1SUFA 3AVWA 3FTDA 5I8ZA 2J3KA 2RH9B 2XWPA 5K3AA 4J16A 1JQJC 2QMEA 5JYBA 1R66A 1X14A 3D0QA 3Q3HA 1S02A 4GI5A 4R51A 3P5SA 1TZBA 1YIDA 3EGXA 4FYVA 3U7QA 4TKVA 3IVXA 3ZJTA 1JHYA 2CXHA 2V5UA 4R3UC 1FFAA 3EXFB 4N1AA 3I05A 3T38A 2ZUVA 2KWIA 3ILYA 1KFJB 4KO1S 4KREA 3AINA 3WOHA 2O3RA 2RIPA 2GBFA 3M6UA 2G1KA 3BT7A 2JJQA 4RA9B 1JHQA 1ONPA 1RAFA 4HCJA 4J0QA 2QGFA 4KXNA 1TZKA 4QNRA 5EZSA 1SH7A 3RI3A 3SR4A 2N0SA 4GC9A 1V11B 4Z0PA 1YQQA 3H2ZA 4M76B 1D4ZA 2CKDA 4LF4B 1EUCB 2CJWB 1S2DA 3ZVKA 1D7AA 4U2FA 2KW5A 3GDHA 3AR2A 2IODA 1TMGE 3D7RA 4IKPA 3W04A 4ZVTA 3FPGA 4EJ0A 2UZ1A 1NXWA 3Q7IA 1V2GA 4CMBA 3G2MA 1NVVR 3WWOA 1LD3A 2XF8A 4DABA 4DYHA 4IMPA 3NH9A 4WFKA 3B6JA 4YHHB 1QC5B 1Q20A 5CXSA 1DRVA 1NN1A 3F78A 3GPLA 4ZEMA 2A67A 4BCBA 3FMIA 2VHQA 2C2XA 3QU4A 4GRIA 4QDUA 3I04M 1JNYA 4HUJA 4F2PA 4NPAA 1RLMA 4FFSA 3QUBA 4LE1A 5JXHA 2C42A 1F60A 5AVRA 2PUFA 1AHNA 2W2KB 1SHZA 3QVJA 3JD3A 3TK1A 4E5VA 4ZO6A 2PIAA 2UVQA 4ANFA 1M8JA 2PUGA 4OBBA 2QG9A 5GAJA 2AOVA 3M33A 1R6VA 4GOXA 2G5GX 1JJBA 4L57A 5DI9A 2PLRA 5JPIA 4IJUA 3TQTA 1J20A 1DXHA 1L5KA 4YEDA 1FMJA 2Q7DA 1KP2A 4PZCA 4QQ8A 2GFHA 2IBMA 4MUYA 3MTAA 3PEEA 2YS7A 2VJKA 3KR1A 5AI5A 4YWHA 3ROMA 4B76A 2C0CA 1OFGA 2G70A 2RAVA 4FQ5A 4M9XA 4MQFA 4GYWA 3TCXB 4UD6A 1WBJB 4PS1A 1Q5PA 1G5QA 2WU3A 4Y1RB 1PYGA 1S8NA 5AHKA 2JG3A 2QRUA 4RC9A 2NG1A 1QX3A 2BY4A 4RCVA 2EKBA 1EUDB 2RARA 5AI8A 1IPHA 2AZMA 1G1MA 1WMSA 4PYOA 2IY8A 4YRAA 1R7RA 1OX5A 1EMDA 4PZPA 1CCWA 1PFYA 1PWXA 2HWUA 2JARA 4XYMA 2ANBA 2MIIA 4AUKA 1SVSA 3Q0TA 4YLGA 1OWMA 2CLIB 2ES4A 2YVLA 1K86A 4H3VA 4RZ2A 1CRPA 3MIIA 1T36A 3MYYA 1LDYA 5FQOA 2RAPA 3DXFA 3EW9A 2XA2A 4RV5A 3QY9A 4M9UA 2B2XA 4MVYA 2H85A 1E2BA 5CM2Z 4HLDA 3JTEA 2UZ0A 5EUCA 2Q9CA 4QA9A 2QMUA 3ABZA 4ZV7A 1LZLA 5FNZA 3PJRA 5KJFA 2H18A 3GEGA 1EG2A 3HU1A 4TX1A 1VHJA 4N3CA 3U3KA 3VZPA 1X15A 5BR1A 3MINB 4GI2A 3BKXA 3VPHA 5IBRA 4RHYA 4G9EA 2LKDA 1Y3DE 4EJSC 3OFND 2O4CA 3IR7A 5IF3A 1Z62A 1BGVA 1Y81A 2QY6A 3T9FA 5BUCA 5JSUA 5KQGA 5KVSA 1CK4A 3OT1A 3WNVA 1KI8A 1Q1EA 4G25A 2OCIA 4XB6B 4JEHA 1XK6A 3RTEA 1QTRA 1RXCA 2AMLA 1ENPA 2HA4A 3D4LA 4IXWA 1XWFA 2LNDA 3Q7SA 4EP1A 4ZJUA 1H05A 4J0GA 3VC3A 1PSZA 4WSOA 5JSKA 1H2BA 2EXXA 1H4VB 4X91A 3UT0A 4HWKA 1LB1B 3INTA 3LKDA 4OL0A 5DNYB 4G5GA 1Q0SA 1T4MA 2OESA 3RREA 2VDVE 2VS1A 4F91B 1ZESA 4JYZA 4JSYA 1FQOA 1SHUX 4BO3A 4GGPA 1OXVA 4DV0B 4CMIB 4Z0NA 3F97A 3PX3A 1QG0A 1NQUA 1U0OC 1VKHA 2V65A 1DUIA 1OBOA 4R2IA 1LBQA 1NM5A 3R6LA 2ISCA 5H0IA 1DJNA 2SCUA 5HCIA 3TTTA 5CFQA 5JS6A 2XDQA 5FHQA 3SC2A 2Q3HA 2P3QA 3QLUC 2ZITA 4IH9A 4UU0A 1VLVA 4J1TC 2P4EA 4PO1A 3I2KA 2YV3A 4RPJA 4CDRA 1RI2A 4AF6A 3N8NA 1ZZEA 2H92A 3JTMA 1CUUA 3GOHA 3SFZA 3WA6A 1D4OA 4TTTS 1F0KA 4LX0A 5IJXA 3IUBA 4U39A 3UJ8A 1X7DA 1STOA 3WRWA 1TF5A 2GSWA 3WDMA 5JMPA 1DLJA 3LX6A 1EDBA 1KL7A 4ETWA 2O07A 3PHHA 4IGEA 2YN0A 1FXUA 3SSAA 1J0EA 4Q4JA 4TKZA 4URUR 3GUYA 2V59A 1NOIA 1Y7PA 4ER3A 2OD2A 1OLXB 2R8YA 4GH5A 3RIYA 5JEDA 4NBTA 1DIBA 3D4OA 3U5ZB 2BSAA 3O9ZA 1YTLA 4HZUA 2WTUA 1KQFA 3DZIA 1VRVA 1JQBA 3F8TA 4C9BA 2BSQA 2X2PA 3A9CA 5JAIA 1U8FO 3AJRA 3D9QX 5T8KA 3NEJA 4ACBA 3R75A 2OHFA 4F60A 3FCCA 1M2GA 5T67A 2IIBA 1YB5A 3LCMA 3ZBUA 1NT2A 2ZB7A 4H4CA 4EI8A 4K6CA 1U2TA 4ZEWA 2E85A 3P1JA 2IC5A 1XA0A 5HNKA 1KP3A 5C1DA 1O6ZA 1ZU5A 2C00A 4JI1B 3C8HA 2BFBA 2RHOA 2ADFA 4JJFA 4LJ4A 3HV2A 2HJVA 2VNAA 4RQAA 4R7GA 3W6UA 2FEMA 1T8WA 1UOPA 3E5RA 2O3SA 3AONB 5D3QA 5DCUA 2V8BA 3ROTA 5C7OO 2J0EA 3FA2A 1EDEA 2DWOA 4P4SB 4PRZA