3RVRA

Structure of the cheyn59d/e89r molybdate complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
130
structure length
130
Chain Sequence
HMADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
total genus 47
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rvrA00
1WETA 3SNKA 2CHFA 4XASA 2F8SA 4P1ZA 1SXIA 2FW0A 3DLHA 1D5WA 3ILHA 1DBQA 5JNSA 1FFSA 2N9UA 4RK5A 5FBHA 2FSPA 2H0AA 1JYFA 2PLNA 1M2EA 3F6PA 3IP9A 4RY9A 2M1ZA 5CNKA 1LBHA 1D1QA 4MPTA 1QO0A 2ID7A 1MB0A 3KLOA 3RVQA 4S04A 4F3TA 1DJMA 3W9SA 1KRWA 4N47A 3ROTA 3C3KA 4HYEA 4FB4A 2XDYA 4Y9TA 2R47A 3IPAA 3CS3A 4YLEA 4MYRA 1TJYA 4WT7A 4MRMA 1CEYA 4L85A 4KQCA 2FMKA 1NY5A 1LBIA 1TMYA 3FGZA 1E2BA 2P4UA 2QW1A 2PUCA 5IUNC 1NXTA 1NXVA 1EWVA 2A9QA 1NXOA 2A9OA 4QICA 3LUDA 1QMPA 2FEWB 1JDPA 4W5QA 5KC8A 1GCGA 3G1WA 2PUFA 1NXWA 2FN9A 3O1IC 4OBBA 2MYUA 4Z4HA 2IDMA 3EQZA 4LDAA 4EVSA 1URPA 1FFGA 1GCAA 3JPYA 3QLVA 1T34A 4LX8A 2FQXA 5EWLB 5JS2A 1S8NA 2KYRA 5JNVA 3KS9A 4NCBA 2JVKA 2PKXA 1PHRA 4WUTA 3KHTA 5DTEA 3MM4A 4N76A 3BILA 6ABPA 3C3WA 4Z4FA 2E4VA 1KRXA 1LJLA 3G85A 3L49A 3CFYA 1ZH2A 2WWVD 2JVJA 3GBPA 4JB2A 4KK4A 4RK4A 5CHYA 1VKRA 4LE1A 4L4UA 3JVDA 5KQLA 4UHKA 5T3YA 4IMJB 4N41A 5F64A 5BRAA 3HCWA 1D4ZA 1Z18A 3CTPA 4G0XA 5IX8A 4Z4EA 1XHEA 5BRJA 1JDNA 3LUGA 4DN6A 4RXMA 3RVPA 3HVRA 2WMYA 1Z17A 3KCNA 3Q41A 4N03A 4MS1B 3KJXA 2RDMA 3JPWA 1YTUA 2PAFA 1QNLA 3OLXA 5EWMA 4TN5A 1YK0A 3C3MA 4MRMB 4XAQA 4OTZA 5B3JC 2HJ9A 4KFCA 1KMIY 4Z9AA 1QKKA 1NXSA 4E7PA 1JH9A 4F8JA 2PUAA 4TMYA 2O20A 1VLZA 5TQ2A 4Z4GA 2MSWA 4KVFA 2YHBA 3QX8A 3HZHA 5DLEA 5JS1A 5CNIA 5B3JA 4IRXA 3VNAA 2M98A 3UK0A 1Z13A 1DZ3A 3KTOA 2JK1A 3CU5A 3CKMA 3FMVA 1LJUA 2E4ZA 1USGA 2MYNA 3HDGA 3JVIA 4RKQA 4OATA 3H1FA 3OO0A 1ZGZA 2CD7A 3C6QA 1RXEA 4G0YA 4OG2A 3H1GA 5EWLA 5TQ0A 2FMIA 4G0PA 3A0RB 2IYNA 1P8AA 3DGFC 4LDZA 1Y1LA 5CNJA 3FFXA 4Z99A 5IC5A 3M9WA 4G0ZA 4KK3A 2QU7A 2ID9A 3L6UA 1F4VA 4PICA 3TD9A 1CYEA 1RXIA 2LUOA 2IPLA 4IGAA 3LUHA 4MS4B 4YP9A 1LK0A 1AB6A 3A10A 1YS6A 3QX9A 1A04A 4ETMA 4KQ9A 3K9CA 4Z0NA 5PNTA 4JASB 3QEMB 3JTEA 1PNRA 3O2QB 5HKOA 3OLVA 3H5TA 2FLWA 3QLUC 4Q7EA 2NZUG 2R4QA 4YS6A 2JBAA 3QLTA 4LE2A 1TVMA 2WJWA 4MAAA 4MQEA 3LOPA 3MQ4A 1ZH4A 3MYYA 1EWTA 4RWEA 5TPZA 3RVNA 3TMYA 2OENG 2RJOA 2FQWA 1DCMA 5TPZD 1QP4A 4MLCA 3DBIA 4YV7A 2X7XA 3H5VA 3CZCA 4LE0A 3UKJA 1JFSA 2PL9A 2PJUA 2QV0A 5JNUA 2A9PA 2FTKE 4P98A 3B2NA 3ILYA 2NT4A 1PUXA 1ZESA 2B4AA 3URMA 2LBPA 2BGGA 4LZLA 4NICA 4RY0A 1ZDMA 4LRQA 4RDCA 4KREA 1DG9A 3MA0A 1JHZA 4RK1A 4G86A 3NNSA 1DRJA 5KC9A 2IPMA 4RU1A 2E4WA 4GPAA 2ZWMA 5TQ0B 3CZ5A 3E3MA 3HUUA 1GUDA 3FFTA 3SM9A 3GL9A 5BQ3A 4G0MA 4XARA 3NNDA 3RVLA 3I45A 1BAPA 2TMYA 3GBVA 4ZJPA 3HM9A 4UHJA 3OQMA 3SQNA 4IMIB 1DRKA 1PEAA 5JNWA 3H6GA 4IILA 4QYWA 1OXBB 2GX6A 3RVKA 2R25B 3CNBA 3HS3A 1DCFA 4ZMSA 1K66A 3DZDA 3S99A 3RVJA 2QSJA 4MLDA 1I3CA 2QXYA 1Z26A 4MR9A 2FVYA 2NT3A 3HDVA 5HSGA 1QP0A 1JFVA 3EGCA 1TM2A 1JWLA 2FEPA 4Z9BA 3BRQA 2JB9A 1MVOA 3NNNA 3O1JC 4EYQA 4JP1A 1JFTA 1MIHA 4WXEA 2FN8A 2MSLA 2YHAA 1IIBA 4O5AA 4MS4A 3SAJA 4EYGA 4MR9B 3N75A 1H9CA 2FXIA 5ABPA 5DGCA 3KYJB 1YIOA 2NUBA 3OLWA 4HNRA 4OLAA 4RXUA 1Z2EA 2AYZA 3N0RA 1ABFA 1JYEA 3OM1A 1NXPA 4F11A 2FMHA 3H5LA 1SRRA 2LPMA 3NHZA 1MB3A 2P9HA 4N0PA 4ZYLA 1ZY2A 3FDFA 3O1HB 3F73A 3OMWA 1Z12A 4W5TA 1A0OA 1DC7A 2JRLA 5FWYB 3QELA 4KZKA 2PUEA 2IPAB 4RZSA 4E7OA 3T95A 1XWWA 2B1JA 1DCKA 3H5IA 2JVIA 2MYTA 4RS3A 4PZ0A 3T38A 1BDJA 2L19A 4PYRA 3BREA 4MR7A 4H60A 6CHYA 5TE9A 2AYXA 2HPHA 4HNQA 3CHYA 3RQIA 1DP4A 3CRNA 3BBLA 2JCGA 1JBEA 2E4YA 3RVMA 4JOQA 1K68A 3JY6A 4KMRA 3NHMA 2LIVA 2GKGA 1YK1A 3H75A 2W42A 1C4WA 4MQFB 3TX6A 4Z4IA 2HQOA 3I5AA 4FE4A 4OLBA 4D6YA 3SG0A 1L5ZA 3D02A 4YRZA 4B09A 3KLNA 4Q6WA 3M6MD 1JL3A 3LTEA 5TPWB 1R8JA 3QLVC 2CWDA 1KGSA 2FKAA 1EFAA 3HJFA 4TLLB 2I6FA 4H3KB 3IDOA 4MS3A 3N0WA 3CLKA 1QPZA 2GI4A 4RY8A 3C97A 3K4HA 3KSMA 1USKA 2CHEA 4XXHA 1M2FA 5DKFA 4EY3A 3H6HA 3Q9SA 4NQRA 3FFWA 3KYIB 4RK7A 4WZZA 1FQWA 4ML3A 3T6KA 1W25A 4ZMRA 3Q7RA 4QPJC 4W5RA 1W9HA 1YS7A 3O74A 3QELB 4DADA 1U2PA 3A0UA 4MR8A 5IEJA 9ABPA 4DQDA 3F7NA 5KQPA 1QO0D 3N53A 4F06A 1B00A 2VK2A 4RSMA 1JX6A 4F12A 5T7BA 5C5EA 1RZRA 2PUDA 3HK2A 2PUGA 2RGYA 3HO1A 1BDHA 1P6QA 2WRZA 1J56A 1C0EA 5TPWA 4W5NA 1YMVA 5CNMA 4MS1A 3EQ2A 4O1IA 1PNTA 1SD5A 3H5OA 1E6KA 3KG2A 1CHNA 1E6LA 3RVSA 5KWSA 1NATA 3KKEA 2FMFA 2GWRA 4YGXB 4S05A 4KNYA 3OO1A 4EVRA 2WB4A 5IULC 1USIA 3P9YA 5EWJB 4Z4CA 1L5YA 1Z16A 2GBPA 3LKVA 2VUHB 4MR7B 2IOYA 3VNBA 4EVQA 1OXKB 2E4XA 2HSGA 2FLKA 3CG0A 3OQNA 1RNLA 4EGSA 1MAVA 2Q5CA 3RH0A 3ROFA 4PEVA 1DC8A 3O75A 3TO5A 5JNTA 2L17A 1P2FA 3EDCA 2MYPA 4ETIA 1QQAA 4H3HB 3OMXA 1GLGA 5D2CA 3BRSA 3IP6A 3LMKA 3CG4A 3I42A 3IP5A 1U8TA 3GT7A 2ZAYA 1ZN2A 5BR1A 1ZAYA 4YWHA 4PE5B 3O2JA 1EHCA 1VRVA 2R48A 1BDIA 5GOTA 3MF4A 1EWKA 1EAYA 2IPNA 4MR8B 3RVOA 5KI6A 4RK0A 1TLFA 3D8UA 4YR7A 2NZVG 2VUIB 3HUTA 1FFWA 3HV2A 4MGEA 3SY8A 2J48A 5KQMA 4KRFA 4EUKA 1ZVVA 1JF8A 4HNSA 4JA2A 5KQGA 3E61A 7ABPA 2IKSA 2PMCA 3HEBA 1YMUA 3N0XA 4W5OA 2RJNA 2DRIA 3NBMA 3OM0A 2L2QA 1ISSA 5EWMB 1U04A 1SXGA 3GV0A 1SXHA 4MS3B 3EJWA 4XFKA 3DLBA 2F8TA 4O1HA 5FBKA 1ISRA 3GRCA 1XHFA 3M9XA 2QVCA 2PL1A 3LUAA 3QK7A 5DCLA 1NTRA 2QZJA 3Q7TA 3I09A 1U2QA 1GUBA 1D1PA 3LUCA 5TQ2B 1ZITA 1BA2A 1FSPA 2MSKA 4JB0A 4YCSA 2FEKA 1ZHHA 1RZRD 3LUKA 3MIZA 2QR3A 4GNRA 4WWHA 1HEYA 5EWJA 3GYBA 5IUKC 5HQJA 4EYKA 3QLUA 5E3JA 1DBPA 3UUGA 1JLKA 5JNRA 2PE5A 5FWYA 1Z15A 1ZGGA 3N6VA 2H3HA 1ABEA 3OLYA 3Q7SA 3QEKA 4ZPJA 4N0QA 4ETNA 4EYOA 3GWGA 3A3KA 3HXMA 1U0SY 3LKBA 1E6MA 3OLZA 1Z25A 2E4UA 3R0JA 3DGEC 1APBA 1Z2DA 2L18A 3LUJA 4WXMA 5IBQA 3GA5A 1BVHA 1D2AA 3IP7A 4KPYA 1F51E 1NXXA 4G0QA 4YO7A 5TQJA 2HQRA 3O21A 1PEYA 3F6CA 3LFTA 4G97A 4TLMB 1A2OA 3LUFA 5I4CA 3H1EA 2VYCA 5IEBA 4IF4A 1VPWA 2QVGA 1AB5A 4MQEB 4D6XA 4XLTA 4RXTA 5IUJC 3EULA 4D74A 4RKRA 2A9RA 3TB6A 4M88A 3O2SB 3HSYA 4FE7A 4Q6BA 4RK6A 3Q15C 2FQYA 3OQOA 3QEMA 1QQBA 5ED4A 4JAVC 1P6UA 2WY2D 4CBVA 3RVRA 2LP4Y 1RPJA 2HQBA 4QYMA 5FWXA 1UDRA 3MMNA 5HM6A 2V0NA 4KV7A 4MQFA 1YVUA 4G0OA 4NV3A 3T8YA 1M5TA 3H5WA 2OQRA 1DBWA 1QP7A 3JS5A 5C5CA 4NCAA 3N8IA 5FWXB 1M5UA 2WJAA 2JBAB 5GQSA 4RV5A 8ABPA 3IPCA 3EODA 3EAFA 2PUBA
chains in the Genus database with same CATH superfamily
1XEWY 5C8YB 3PGVA 1SQ6A 5K0CA 1EJ6A 1JKJB 1W2WB 3TEJA 2XDWA 2N47A 4XIYA 4BGUA 1DBQA 4TXHA 2OOKA 4OREX 5FF9A 5C1IA 3TRHA 5M5BA 3O8CA 5DIFA 4Y1FA 3I01A 2HU5A 4A1FA 4F56A 1G21B 3VSBA 4BN0A 3O4IA 5FP0A 3OSZA 1BVYF 3A4NA 1Y3HA 3BXHA 2UDPA 3GWZA 3ROMA 5KHLB 4L76A 1DG1G 3IQEA 1N5LA 1E2UA 1ZYUA 3ZU3A 5L4LA 5EP2A 3UJDA 2NVBA 1DJMA 1JALA 5DNVA 4C4ZA 3GD7A 2CN1A 3OETA 4PINA 1N5OX 3RI3A 3FHJA 1JLSA 4HYEA 4J1NA 2V03A 4QPCA 4Q24A 5JJKA 1CS0A 4DA4A 3CT6A 1OFUX 4P4GA 4HEA1 3QBDA 2BFOA 2ZUSA 2I62A 2NGRA 3G7NA 4NG4A 4XUCA 5F7ZA 2VYFA 3C3CA 3LLCA 3UXYA 1LBIA 1Z4KA 4KFSA 3B1XA 2RAUA 3JU3A 4EKGA 3A4IA 2QW1A 2R87A 4X97A 3U81A 5IN4A 3QUQA 2F17A 4FHFA 3EGWA 3LRPA 2QRPA 1QMPA 2ZE7A 3OJ0A 3KPYA 1ECBA 3ZDDA 2WWGA 4CEHB 4DGSA 1CZUA 1QWSA 3NMUF 4QTYA 3FDJA 5DN6A 3MWEA 1UCFA 4MQ5A 1SURA 1XRMA 3TD2A 3W9UA 3PQ5A 1FTSA 2HPZA 2PAAA 3L4BA 2A84A 4ACBA 3O93A 3N2GB 1PD1A 1TUIA 2P3QA 1POXA 1KK3A 1UP7A 3K0AB 1YKFA 2Q28A 3BZUA 3ADKA 5EHXA 4TV8A 1BU5A 4ZAZA 3A26A 1E7WA 3ODGA 4IV0A 1SUCA 2EL9A 2IL1A 2YDXA 4XYEA 1DTSA 1Q92A 2GLXA 3BEDA 4NHOA 4NYJR 2ZAMA 4PX3A 3SBEA 3DFMA 2JFXA 4LTNA 4O4JB 2SKDA 2WKWA 2ZBFA 5LZ2A 1KRXA 4BGEA 4LF8B 4D9JA 3UBTA 1US8A 4OL0A 1DWOA 4QWWA 1WDLA 3MT9A 2K2WA 5CJ2A 4OGLA 5JHHB 4J0HA 2HMAA 5HIMA 2QL5A 5EAIA 3TOCA 4QSMA 5LD2B 3AR3A 4CM6A 4IMJB 1OV6A 5EIBD 5LDHA 2WIGA 1IN5A 4GSYA 3ESBA 4TYYA 4H15A 2FSGA 4O33A 3KXLA 2I4TA 1ECPA 3A1WA 2D2VA 2Y1LA 2QZ4A 1RI5A 1TIBA 1JEAA 1XZNA 4HEJA 4ADSG 3CUUA 4G5HA 5K01A 3ULKA 5HF9A 3UW1A 1YVPA 4IIXA 1TNDA 1EG2A 4JITA 3MCAA 2W93A 4ZV7A 5CLLA 1C0KA 2VHUA 3MWYW 5CB4A 1EK0A 4WKPA 2UYHA 1YTUA 3OLXA 1MVLA 3KALA 1PR1A 3MMXA 4RENA 5HMLA 5JH7F 3PR1A 3DMDA 2GXAA 3LL7A 1JLLB 1R6DA 3D3JA 2H9IA 3FUCA 1DB3A 2ID4A 5DOVA 5B3JC 3AIKA 2D1RA 2JIBA 3E35A 3I30X 3HGMA 5EYPA 1H0HA 2QM7A 2YOFA 3FZEA 3VR4A 3VJLA 3BT7A 3FTCA 3I12A 4UCQA 1H2XA 3G1TA 5F5XA 1UBMS 1ONPA 3ESCA 4KVFA 3QVVA 5LOVB 4IYRA 1C30B 1F9AA 3HZHA 1M34B 4QOFA 4EI9A 4K1XA 5C46F 4DR7B 1KVRA 5B3JA 2CHQA 3L6EA 4MAMA 5SYAA 3KTOA 4CVNA 4KITB 3CU5A 3JYQA 3V7WA 5JALA 4EEKA 1WDWB 3EYAA 1ZUHA 1LJUA 2OQIA 3ZX5A 4LJKA 5DMXA 2B0CA 3GGPA 4Q39A 5CGZA 4QM7A 1Z8DA 1S01A 2OUKA 3ELYA 3ENNA 1XVVA 3NBZC 3S4YA 1DTWB 2Q1WA 4J16C 3T99A 4JQSA 3BDIA 4B71A 2VJYA 1ZWKA 1OLXA 5LZ8A 4AI6A 3CX4A 3D6VA 1KFCB 2J7PA 1EFVB 2JFGA 5DIZA 3W4IA 4A8JA 5F23A 1E6EA 2BKAA 1MW8X 5LP6F 3U7JA 4PAMA 1QX3A 1CE8B 4PICA 5K6AA 2JGLA 3TD9A 3E6AA 4M87A 1K5DA 4HKTA 1E1QA 3SS9X 1QYDA 4QTUB 3UJ9A 1A04A 1TUBA 1YTLA 4J3FA 4D0SA 1RWPA 5PNTA 5K6RA 2QJFA 3KM0A 2PRJA 3BHJA 3F4LA 5CYOA 1IK6A 2D06A 3H5TA 3X1MA 2AFVA 1E4OA 1O9BA 1UPFA 3BERA 3HB9A 1ONSA 4L08A 4YS6A 3ZWNA 5L3SB 1GJRA 3IDSA 4DCVA 5B2FA 2HA4A 1I0IA 2QK4A 2NSHA 4BPBA 4EKIA 2ZJBA 1TO2E 3GFPA 1HORA 4KNWA 3GXOA 1UOOA 2FQWA 2RJOA 1N3IA 4X8LA 5IG2A 1G9XA 2F3RA 3RIGA 4YRLA 2PFKA 3IQGX 4LWPA 4TL9A 1IOLA 5K8LA 2QZ9A 5AI5A 5CM9C 2EHJA 3LA6A 1NPDA 1GPMA 4OY3A 1U8ZA 2JL1A 4W5JA 5F4ZA 1DOAA 1W94A 3R7DA 2F1RA 4M1OA 4LZLA 1NFRA 5EQTA 2BJWA 4KAJA 3DDHA 3OQVA 5I3ZA 3RU9A 1R1DA 1OXTA 2Z2JA 4IDEA 4ZEOA 5SZIA 3QNUA 5JSQA 3KZMA 2OHOA 2ZWMA 3CF4A 3FH0A 4K9MA 4BRZA 3THXA 5HIJA 5IBRA 2PMEA 3FFTA 3WIBA 3P4YA 1AD2A 3T1OA 4IAOA 1RAHA 2FZWA 1DRKA 3TW8B 4D8TA 1VDMA 4FD3A 4C6HA 4FHGA 2AC2A 2VWPA 1I6LA 1M76A 2DUWA 2H5IA 2HUPA 1NN3A 2VRCD 2J3IA 1XRPA 4C0LA 4KNVA 3BSYA 3GR6A 4HUTA 4Y98A 1CU1A 2WWXA 1KI3A 4TWRA 3ZU6A 4D46A 1DUIA 4GGPA 3S1AB 3R9XA 2GAIA 3V7NA 4Q4AB 4V0NA 3LFHA 3DOCA 1YS9A 2C4UA 3M1IA 3WL5A 2O8NA 4BLUA 5HSGA 5JARA 2QZSA 2FEPA 3ICCA 4WLOA 1RFLA 1PR2A 1U0JA 2V7PA 2NTYC 4O4IA 3BL6A 4URUR 4X3OA 5SYNA 1CQIB 3HP7A 5F9MA 2H1HA 4HNUA 1B0AA 4XQ0A 2HL6A 1JEQA 1G291 2VXYA 4MS4A 2JG3A 1H0KA 1Z2OX 2CLKB 3EF3A 3LM8A 5AI4A 3ZXIA 1BH6A 2ZQ5A 4L75A 3J81A 1U02A 2XE7A 4FSHA 2XMBA 4O4LA 4GMKA 3K94A 3PNMA 1EDOA 5E6SA 1JYEA 1N6RA 2FMHA 4YY3B 2XUJA 4YH1A 2IH5A 2OORA 2XSZD 3EG5A 1UC8A 3HMKA 3JW8A 2EZ4A 3L7AA 2WYHA 3B38A 3J81k 2R6DA 2Q49A 3ELDA 3C6BA 4L3WA 4PG7A 3EQ7A 1F2TA 3IAM1 1Z4IA 2QQ0A 4AF7A 4FNAA 3GAAA 2JRLA 5FWYB 5M29A 5BPFA 4C7VA 4N0DA 4WCDA 1V4BA 3C1AA 2NTVA 3ZCQA 1X7WB 4QDZA 2GCGA 1DT5A 5DSTA 3VTKA 1H3EA 2MYTA 1U3FA 5DJ5A 2DYKA 3T38A 2I3BA 3IL2A 2ASVA 1E9RA 4O3FA 4E5NA 2JZCA 2PZMA 3Q2OA 1YFJA 4OYLA 2OV1A 2ECFA 1YI1A 1YACA 5A9RA 721PA 2YVLA 3ZD9A 3VKWA 3IUYA 2WPDD 4B7CA 2JCGA 4BECA 2FCAA 3ROXA 3JY6A 4WNYA 2AVDA 4NK4A 2QVLA 3CPEA 4HG2A 2UZ4A 1J33A 1Z0ZA 2ZXEA 3H75A 2AN4A 4HWGA 2YV4A 4BUZA 4BQIA 621PA 2BCJQ 4Z4IA 1Q6ZA 3OJLA 5FRDA 1ST3A 1TJ3A 1Z45A 4M1EA 2WUVA 3NKLA 3ZGVA 4YRZA 4M1TA 1YL5A 3KLNA 3VGPA 4RL4A 2ZR0A 1DO0A 1K7XB 3DJYA 1KGSA 1I5OA 1LVUA 2DBVO 1L8AA 2V7TA 3QHQA 1N0IA 1NONA 2OECA 5AKZA 3UGKA 3EOBI 3C97A 1HGXA 3V8MA 1USKA 1VMDA 1J0CA 2WG0A 3OIDA 3V8VA 1UBSB 1Y1SA 4AIRA 2Q0QA 4UM7A 4OXRA 1A4IA 1PDOA 1VPLA 3RAFC 5JBQA 1Z7WA 4B3MB 1KSJA 4UMFA 4QPJC 2OHHA 4C4TA 3ONNA 3CIFA 3ITEA 1SA0A 6Q21A 4B1FA 2W2KB 1GRVA 1Y42X 3PFGA 4DCJA 1GKUB 1NTOA 1J2RA 1P4SA 4DHWA 2DHEA 3N53A 5B3LA 1PYOA 3CZ9A 3ZGNA 3SYMA 5BV2P 4RPJA 1H2HA 3R5XA 2QLMA 2XRZA 1P18A 4TMKA 1YMVA 2BZSA 4FZVA 1QH9A 5BPHA 4LRUA 1DARA 1SIBE 2C99A 3BYZA 4O1IA 1VYVA 1N8TA 3KKEA 3GW8A 4MSUA 2VZEA 1N0VC 1J8QA 3E9RA 4ZYUA 1L5RA 1M74A 2H18A 3P9XA 1VZ3A 1OFHA 3GGJA 4I5EA 1Q2XA 1Y63A 3FX2A 1ICEA 5ELLA 2X19A 3OFKA 5LQRA 2C0QA 3JD0A 4YUZA 2AI2A 4EGJA 4EMSA 5HX7A 4I99A 4B4DA 2G36A 4Z4CA 4B9EA 2C2MA 3H2IA 1UMBA 2X0IA 3LKVA 4DBLE 1JAHA 1ZQ9A 3U1VA 4RGVA 1X80B 1OD6A 1XZIA 4MVJF 1V5FA 3D8TA 3GDFA 1A5SB 1NMEA 2ZQZA 3JQAD 4FFSA 1CP2A 2ZJ7A 3EZ7A 3H8WA 4KRYA 4MQ6A 3DLTA 3MPUA 3EDCA 1AKEA 1J25A 4WK0B 4N49A 2FW7A 4FONA 4HDRB 2G83A 4AO8A 3OHPA 4EG5A 5B6JA 4H3HB 3TCXB 1EZ1A 3CPSA 4RHXA 1EGVB 3LMKA 4K3UA 3I42A 2GEBA 4BEBA 3QUTA 5B6PA 4C4AA 1IBLB 3NATA 3GH1A 1U3VA 3ZCRA 4F71A 4S1TA 5KYNA 2GEUA 2J9XB 1V2GA 1JR3D 1UT5A 2YJZA 5IT4A 3RYIA 4XIFA 1MJNA 1EGQA 5K0LA 4HJXA 4B33A 1DFGA 1Q2UA 1KMHB 4YV0A 5AVTA 1XJQA 1WHSA 4R0NA 3RTBA 2PUBA 4IWNA 2A9KA 4Y67A 3W9YA 5GVSA 1KFKB 4A15A 2ZR8A 5FO0A 5THQA 5KQGA 3PQEA 2YV3A 1G16A 3D3WA 3DOHA 3FF1A 3OU2A 4JI2B 1ACJA 4EKYA 3OY2A 1IN8A 2X6RA 4XB1A 3GEIA 3RS9A 2Z6UA 1IL0A 5LB2A 2PCJA 1A95A 2HPAA 2CJPA 1TMGE 1P7VA 4PYNA 4O63O 4KGVA 2XT6A 5CT6A 3ZI0A 1YNOA 3ZWBA 1MO2A 2QVCA 3H8JA 1RLIA 2GFIA 2QZJA 5LMUB 4G97A 4FM9A 2JGKA 3PP8A 1PWXA 4FLFA 4E94A 3D31A 2QAGC 1K7EB 5IM4A 4Q93A 5CA0A 3W9BA 2XRMA 3AV0B 3C5EA 4HFNA 3UB3A 3AINA 4LHEA 4Y8VA 4LQLA 1NUHA 4OHMA 4DRYA 1UZLA 3WZLA 4Z7QB 2C20A 2XNDD 4JOBA 2GJ8A 2QR3A 3VSCA 3BFVA 2R65A 4C14A 1F06A 2P6RA 3VR6H 1WPQA 3C1TA 1KWGA 4GIBA 1NMQA 1V8OA 4B5LA 4U0JA 5F7JA 2CXPA 5GVRA 3P0HA 4LW8A 5CB4F 5JDCA 2OUIA 3BX1A 3RRYA 1T8YA 1K86A 4P3PA 3DF9A 3N6VA 3PHCA 4IH1A 2AQHA 3VU1A 3LVFO 4S1NA 4K26A 4W8GA 1GZ7A 2PGOA 1AC5A 3BICA 3KUUA 3NBKA 4WPGA 1V7ZA 1Z25A 1R2QA 5JBNA 4N12A 5IJ0A 1WD7A 3LUJA 3QWIA 1Q95A 4OSOA 2BFAA 1UFRA 4JYPA 1PK7A 1FUKA 5B1SA 3ZJUA 3A6HA 4OKIA 2OVFA 3MTJA 1NXXA 1JHXA 3PC2A 3WKBA 4KPYA 3CUWA 2NUPB 2P2ZA 2RGXA 5ALWA 2FK7A 5GP1A 2B4RO 4GLFA 1IN6A 2QL9A 1M8FA 2C5SA 3HCBA 3Q2IA 1KMMA 1J42A 5JAOA 1NVWQ 3BWMA 3X3HA 1VPWA 1AB5A 1VIVA 1CX9B 2OFWA 3Q11A 4MIYA 3VTAA 5IJ9A 1XXHE 2RARA 2QTGA 2NX2A 3AFNA 1DLJA 5IAKA 4R40A 4Q21A 3TZCA 1FBNA 3UT5A 4BO0A 4MDFA 4A9AA 5HRCA 5KUTA 5KYVA 2XUKA 4W82A 4D9MA 1ZGAA 3IAXA 4G8BA 4ND5A 2PMKA 4EB6B 4UXJA 3EZ2A 2ZULA 1TRKA 3CUVA 4PCVA 1GL9B 4QYMA 5EKSA 3C15C 2YVKA 1Q0TA 1NLYA 4A0HA 1WDMA 1FPQA 3T8YA 3F67A 3ORFA 1YFZA 3AKZA 1RKQA 3H5WA 1A69A 2QT9A 4NV0A 4AKEA 4BJ3A 3IV9A 4P58A 2ERYA 1JFFA 1M67A 3WLTA 5K8UA 1CUCA 4NH4A 5HNKA 4QOEA 1DIRA 1YJBA 3PS9A 2EERA 3AP2A 1N3YA 1AZWA 3O0TA 1CSEE 5HS6A 3OOWA 2W98A 5J23A 1YBHA 5MDHA 3N2KB 3LQYA 1TT5B 5TGTA 3LPCA 1XDGA 1B3RA 1CR6A 2B35A 4MPRA 1D5WA 1GNQA 4IDNA 2QRHA 5J5AA 3RYFA 3OQHA 2H54A 1G2OA 1R0XA 1QM5A 2NO5A 4JUIA 5ECGC 3IKVA 3UWKA 3D6JA 3IAS6 1DBSA 2ONKA 4QHYA 5E6RB 1QR6A 1H2RS 3PA8A 3OMLA 4N3BA 1X94A 3C14C 3IP9A 4FVTA 4M38A 3ZZMA 4IJWA 3TSOA 4AWAA 5EHQA 1QO0A 1RLOA 1Y3IA 4B7ZA 3FKSD 4LGCA 4F91B 5HM8A 4RTJA 5CM8B 1SU8A 3FXAA 1XZJA 2CUKA 1RRCA 4CMEA 5K3AA 1YHZA 5L7YA 1A27A 4W6ZA 2R47A 4H1UA 3BTOA 1G5RA 4MVJP 3CS3A 4G41A 1XJCA 4W6QA 1H85A 2M1XA 3H19A 3VPGA 4S24A 4HATA 1Q7CA 3N2LA 5E1MA 2CDBA 4DVJA 3N9IA 3TIGA 3H6KA 2D5BA 4GQIA 4LGMA 2PKQP 2YYZA 5G0UA 1ILWA 5M34A 2OD7A 3D6TB 3DBHB 4GU5A 3N6RA 1E18A 3U7EB 2HLDD 2GESA 2AEFA 5HTOA 1E9SA 3LD9A 1M2OA 1PR5A 4M8LA 4BS9A 4YRBA 1TKCA 2IUYA 4UHBA 4FMCB 2PDAA 4QRHA 3C3PA 4K6OA 4L78A 5AK3A 2RGDA 4A8PA 3KSDO 3U17A 2PKQO 3U3DA 2EQAA 1O0CA 4GW3A 1QVZA 3ESAA 1YB7A 1HL3A 1C41A 3BJRA 3G2KA 4OK5A 4C0WA 2WM3A 3FWHA 2XVMA 2HK8A 4MW9A 4CR8A 3U7RA 3CZAA 3U16A 1D2NA 3EWAA 4R68A 2PQ2A 3UWPA 3D8RA 2HI0A 3L82B 4EB0A 5JAHA 3C7CB 4JI0B 5SY9A 1M1ZA 1ZJYA 2Q3EA 4BBJA 4U1RA 4R5MA 2ZCJA 1E6WA 3NP9A 2AHOA 1ZM9A 2G0TA 5C81A 4O6VA 3V4PB 1SCDA 5CFMA 2GXUA 1UFVA 2RCNA 2RHCA 1GPH1 3G89A 2BBWA 4RK4A 2AFIE 4R16A 5A62A 1BRMA 2P65A 4Z3DA 1IYZA 2HXYA 4XD7D 5A4FS 4DDUA 3PUWA 5KQLA 4HL6A 1T9AA 3P4XA 1UFOA 4PC6A 4N41A 1LPNA 4PU0A 1ZRNA 2YJGA 3HXQA 3GDWA 3NXKA 1IAVA 4FW9A 1AA6A 2G40A 1R4ZA 4P92A 1Y6QA 1QG6A 4P4SA 2QX9A 4RXMA 4P4LA 4V0KA 4BNIA 2WIDA 2DY0A 3K92A 2EZUA 1QFZA 1UPUA 4J1TA 2UVQA 2C2BA 5DF1A 2IS1A 5CDHA 4J4TA 1VCNA 3GJRA 4EJSB 5C1BA 2A30A 4OX9Y 2VF4X 4G67A 2ZTVA 4XQCA 3JPWA 1JQAA 3JX9A 1AO3A 3TLEA 3OOSA 1QNLA 3FBTA 3SIXA 1QUFA 2YCLA 4MW5A 3VXKA 2C4NA 1S8OA 5KOYA 4RDHA 1ORVA 5CLIA 3L0SA 4L9SA 1XLTA 4X20A 2CSXA 1QKKA 3ZE2B 3L7JA 3E0QA 4IL5A 1DG3A 1Y4SA 3JASA 5IFKA 2A5GA 2F1JA 3AW8A 3ANLA 2YJNA 3I92A 4GYJA 1GTSA 2UUAB 4OP1A 1FUUA 2DE0X 2C5FA 1V26A 3G9XA 4LXQA 2FVXA 5CNIA 3S7ZA 2REQA 4N7MA 4QU8A 4PPNA 2J6BA 2O0MA 4GR4A 3GCZA 1N5KA 5FEMA 2A6PA 2YYYA 2Y27A 2A8YA 1RI4A 1OVMA 3PLRA 4FS3A 4J2HA 4R81A 2E89A 2C07A 1T26A 1T1EA 4F6CA 2RBGA 4PRLA 1KFEB 2BV3A 4OATA 4Q3LA 4QBTA 2CXQA 4TUYB 5K7SA 1NI4A 2PSSA 1P45A 4HDKA 3VPSA 3UGJA 2FZ5A 2PM8A 4MOWA 1WUJS 1KHHA 3BWDD 4M8IA 2NYVA 4O4LB 5CT5A 3KJIA 1Y7PA 2OVBA 4DBLC 4LVUA 3VYRB 2BGKA 3KKQA 2WHYA 3ZNNA 4AZVA 2GO1A 2ABWA 4PR0A 2HO5A 2XMZA 5BV1A 2AZTA 2YXNA 2ZJ3A 2C7RA 2HCBA 1RBYA 4ZVLA 3ACCA 1E4EA 1YS6A 2ZETA 2Q4RA 4J2OA 3VVCA 4CIVA 1TO6A 1SXQA 1KOGA 3K9CA 3B1ZA 3C3YA 1WXDA 3C8HA 2VSNA 4Z0NA 5LLSA 3OZVA 3BQ9A 3Q1KA 1A3CA 4B8ZA 1OZAA 1WZUA 3OTOB 2GNAA 3T35A 4QLAA 1OH7A 5AI6A 4B47A 1PK9A 1IK4A 4RMIA 4QNNA 2QSZA 3IJPA 1V96A 4ZOAA 4XJSA 4AP5A 4YAGA 2WJWA 2NU7A 1UJ6A 2Q6VA 4N39A 3D64A 5DT9A 1K5GA 2W2LD 3KTAB 4W7IA 5J59A 2R1TB 1Y98A 1KI9A 1Q7GA 1SBTA 4LV8B 3S29A 1ZH0A 4DKXA 1BE1A 3LY7A 3ZVNA 4AULA 4INOA 4ZU1X 2XVAA 4MLCA 3KQPA 2OCAA 2CLFB 1SPXA 3AZQA 3H5VA 3ZHOA 4IXMA 2IIQA 3DZIA 3DZJA 4NIMA 5C7YA 2ZSUA 3ILYA 2DFPA 4HTFB 1OOEA 3OZCA 4AB1A 4IXDA 4NICA 5CBPA 4HQLA 1Z38A 3B2QA 2WV9A 3RC7A 1BD4A 4DREA 3LBIA 1CULC 1OXXK 1UDCA 2ODEA 8ADHA 3TRIA 1M2HA 1SIWA 1DRJA 3A2LA 5EQJB 1FS5A 3N2EA 1E3IA 4FSXA 4LRWA 2H5JA 1HPLA 5A6SA 4UMVA 5DNWA 5CFZA 5AVQA 1R0WA 2W83A 2JIRA 3CH7A 3RVLA 2DETA 1BAPA 3D4OA 3FGNA 3GLHB 3K30A 4PO3X 3R75A 3ZDYB 1U7HA 4BFYA 3H6GA 2RB4A 3V1UA 4C7BA 5LU8A 1GAJA 2XA9A 2XZDA 2GWHA 1C1DA 3AOEC 4GBGA 4KVAA 2IC5A 4JBGA 1JHAA 4DUZB 5JYBA 3UZUA 4MIEA 1XLVA 2CHGA 1SVNA 3EVDA 1BZYA 1OWOA 3DZDA 3WY9A 3MT0A 3MTDA 1WCYA 2MMGA 2ZXFA 2EYUA 3JVEA 5FPYA 5LP1A 2DF8A 3HJTA 4Y6RA 2DC1A 1NASA 1UDWA 3AR8A 4OYHA 5DTQA 4YDSA 4YEDA 1YOBA 2VXCA 3PBKA 4IEIA 2QHXA 2R2AA 3FDIA 2UXBB 4EHIA 1Y33E 4YRGA 3TZLA 4BEVA 4V02A 3D43A 1W35A 2ORVA 3VZQA 4E21A 5EJ2A 5FUVA 2PWZA 4WAUA 2VP0A 1SBQA 4B3SB 2EIXA 3EZ6A 3X1WA 3WBJA 4U7DA 1CVRA 1PG5A 3TW4A 5JATA 3OVMA 2TMGA 3I9OA 1Z2CA 3ND9A 5EXEA 3EXEA 2Y77A 3MINB 1SRRA 2JEOA 4Y2HA 3NT2A 1T0PA 3ST7A 4DT1A 4KR6A 1MN6A 4TYMA 3RRMA 4Q1CA 3PYMA 4MGYR 3SXJA 3OG9A 3S27A 3W3ZB 1GXSB 3R3YA 3DR5A 4QBFA 2HMUA 2Q3LA 3NBQA 2BFPA 4GG1A 2AG5A 5BNTA 3RKUA 3W78A 3VH2A 4H4DA 5DX8A 1T0IA 3M6LA 1XDUA 3A3NA 4IQ0A 4L9WA 4X7MA 2JVIA 5E38A 4G8JA 4RS3A 3UJ3X 1D0IA 2OKCA 2Z0MA 2PJZA 1C4KA 3BREA 3U3RA 2PD4A 1TVCA 3LP6A 2ZJ1A 1COZA 2WIKA 2IEIA 1JNXX 4OJYA 5BV8A 4EQ6A 3LKZA 5TE9A 1MOZA 1P1KA 5GGXA 3SF0A 4W5WA 3KR1A 2DPGA 3V3TA 3HKDA 2ZAIA 2ZVPX 3RIYA 1G19A 3O0DA 2PSFA 1ENZA 2XE6A 2H4JA 4EZBA 4P7JA 3E4DA 1K68A 1P4GA 2OCIA 2Q5IA 1IOWA 2VK8A 3G0CA 1XWIA 2W4IA 3AYZB 3L07A 4ODIA 4UARA 4W1RA 4TL8A 4R05A 4KWEA 3KQKA 4B3HA 4ZOLF 1H4TA 2VHEA 2WYWA 4TMFA 3BTUA 1XNHA 2Q2QA 1ZGCA 5FLKA 1DRVA 3B9RA 2HGZA 2B0JA 2I4LA 3MQ2A 3SC3A 2IY7A 4JNKA 5EP3A 4M60A 4XWTA 1N25A 4CKEA 1XCLA 4EENA 5E2IA 4C6RA 3O94A 3G17A 4UAVA 3WDSA 4MA5A 1E1NA 4G4IA 4TTTS 4DABA 1GO2A 1NQOA 2PTGA 2ZBVA 3U4QA 3ZKWB 1YVDA 4HC4A 1FPMA 4P0TA 3FVWA 4C30A 1I0ZA 1R5OA 1M6EX 3GCDA 3H6HA 1UC9A 2CVFA 3JYNA 3FFWA 4Q1AA 3VM6A 1KU6A 1CP3A 1HDIA 2QG9A 1AGYA 3NOVA 5HCNA 1YHNA 1FL9A 1AURA 1CS0B 2W0SA 3AESB 3QELB 2VBGA 4PQRA 2C8KA 3ROZA 3A6KA 1T5OA 3H2JA 1HYEA 1FXWF 1RAIA 3OCCA 4LJSA 1XSEA 1OKKA 4DB2A 4Y2SA 3WB1A 1XEWX 1UM9A 1J56A 2PKRA 1ZXLA 2NXJA 1G21E 3MTGA 4TKZA 2C7QA 4LYHA 5LQKA 2EWWA 1KI8A 2G09A 3ESQA 3NTOA 1Z6GA 2GPJA 1JJIA 2V9ZA 3O8DA 3LHKA 3SIPA 3EEOA 4PWZA 1XTVA 4F7WA 1HDZA 2X0NA 4ZV9A 1W1UA 5FX2A 2G9QA 5ARBA 2AC4A 2HPVA 2HHLA 3C3AA 1TU3A 4MUMA 2ENUA 5CJJA 2FW8A 3ELWA 4EGFA 5A4AA 3MC1A 1XXLA 4HBGA 1RQGA 2NXWA 2FLKA 1DBIA 3SHVA 3TLYA 3FLBA 1IM5A 2XCOA 1WMBA 2ILTA 3E22A 5I47A 2VTBB 5KTKA 1RBZA 1F2DA 1PJBA 5CH8A 1P2FA 2BHNA 3HCCA 4G4SO 3FAZA 1U1IA 5JC8A 2PWAA 2XLCA 3H3JA 2WF9A 1B76A 4I6GA 2ZTLA 1RC1A 2P11A 2JH9A 4PLTA 4JXXA 1E5LA 3OPQA 1DNPA 3D7NA 4MCHA 5CX4A 3U7FB 1WU8A 4QOJA 3OPMA 4UBJA 4EW3A 3KOXA 1QR2A 1R5BA 3GGCA 3WJ1A 2BRUC 3AJ9A 2FWIA 3EXIA 3QKRA 2WFAA 3PNQA 2ZYUX 2NQTA 3R3HA 4Q15A 3KXPA 1QOPB 3PSHA 1QZTA 1ZCAA 3CLHA 5CMLA 2O4UX 2Q5FA 1A9ZA 1T1SA 1Z3IX 4ASUA 1L5QA 3WAKA 5CEFA 3BF8A 2FSIA 2OMKA 1GR1A 2C03A 1H0SA 2D3WA 4G81A 4JXKA 3RB8A 3OM0A 1ISSA 3I2GA 3BGWA 4RMNA 4I3HA 4PY2A 4DMUB 5CU7A 2QGNA 3DYBA 1P7WA 1WY5A 2WP8J 1QIEA 2WOJA 3WNCA 3CSDA 5DBEX 3FCEA 2ZRLA 5DCLA 4NYMQ 4Q3BA 4YJ3B 3IIMA 3L6OO 1PSZA 1ZISA 3QSYA 1R5NA 1GGJA 4Q5IA 5JMTA 5D84A 5LOVA 1Z4QA 3LO5A 2OV8A 3VKUA 1PSWA 3LT4A 4NPCA 4WA7A 3DHNA 1U3WA 1RZRD 1JQLB 4OM7A 2PMWB 4TWAA 3I9LA 4R3WA 2Y99A 3K1AA 3DP7A 4MVXA 5HQJA 4HADA 4CL3A 3HI4A 4GRAA 2YYAA 1DBPA 1W5AA 3AEYA 3EK2A 4HQFA 3ECSA 1PZGA 4Q1FA 4UBKA 3ZNOA 3UCEA 4H7DA 2POCA 3R7LA 1OLXB 5AJUA 3CNEA 3VTFA 1XJ5A 3H42B 5HCIA 5SYMA 1IXZA 1ZJ5A 1YE3A 9GPBA 1V5GA 1U0SY 3EIOA 2V98A 2VRCA 3GQBA 3HR8A 3RR2A 3TDMA 2YHIB 4HH1A 3OF5A 2FWAA 1X1DA 2DT8A 2VPYA 3GA5A 4KWIA 2AXPA 1D2AA 1W7AA 5DYYA 2W22A 3ZWDA 3H2YA 5C8YF 2WTBA 4PLFA 4TYPA 3O83A 1M34A 1QDLB 2BHRA 1I4WA 2REOA 3QG1A 4DNOA 3MYRA 4QBHA 4DB4A 5DSXA 1J0BA 2REQB 3QEOA 5BSVA 1G5FA 2I3ZA 2AZ4A 3T9CA 2HLDA 4L74A 5I4CA 5I7OA 2EBFX 4D6XA 5K3FB 2F48A 5KOJB 4KBYA 1BXGB 2HN9A 2JIZA 3CWZA 3CCFA 1DINA 3DTTA 3FHLA 3KTFA 2OAEA 2H7CA 4DIFA 1EEXB 1E3QA 2R6JA 2W0MA 3M1LA 2ZI7A 3V1LA 4Y1GA 4DJTA 4DV5B 1OXUA 4MCJA 3TEFA 4EBBA 3NDRA 4GYWA 4OHFA 4QC2A 5FWXA 4B32A 4YP7A 4U7JA 4CCSA 2BMWA 2ZZKA 4MQFA 1E3TA 4MW7A 2VAVA 5CDSA 5T3UA 2VAMA 3PPYA 1W49A 2X2FA 1SVIA 3HY4A 1IPEA 2IZOA 2NVOA 1ML4A 4X1KB 3A1UA 3QTTA 2PR2A 2FSHA 1H6BA 2R5WA 4QU5A 5C5CA 4B3FX 3RRZA 3PXAA 2J31A 3F96A 4OHBA 1C3EA 4YI3A 2OQVA 4FYXA 1FW8A 4OXQA 5M04A 2B98A 3QKTA 4MB0A 4B3GA 1P39A 1JG1A 2CHFA 1H1LA 3CCBA 4YRIA 2UZIR 2E4AA 4AKSA 3K9LA 3WTBA 2GUWA 2GPAA 4BX0A 2JFUA 3E53A 2IXGA 1RE1A 2BFCB 2J3QA 1G1MA 1K7SN 2P9TA 1FFSA 4DIKA 3NW9A 1KVTA 1Q0RA 3W5CA 5FBHA 4E22A 4P7GA 3UJ8A 3L7IA 5CLFA 3MFQA 1QV6A 4LK2A 4JELA 1CB7A 1JYFA 3EVNA 5BSFA 5HK9A 1VI6A 1VHQA 4QECA 1HEUA 2WYIA 3GVHA 4MPTA 4DZTA 3KLOA 3HYCA 3GDHA 3JZMA 4LNHA 2QXTA 4RHUA 3R8CA 1LPPA 3H2SA 4C0KA 2C7GA 3AQ4A 3EFBA 4ZO8A 4HPWA 1FNBA 5EHGA 3DPSA 2ZUEA 4QRDA 5LKRA 2HCRA 3WICA 3SEQA 2GZMA 1TA9A 2I7VA 4CM9D 3THWB 3NONA 2B37A 2HJVA 3M5WA 2H1LA 4MLPA 2XVYA 2X8JB 1RJDA 4JJ4A 5E7MA 1NP7A 2X0EA 1NXVA 1NJGA 1R88A 4HFJA 2HDNB 1NXOA 4O1MA 3RC2A 1AG9A 1SC4A 4AAYA 4B3TB 2QSYA 4AWBA 1KEPA 3G9UA 5ALYA 2NTJA 4XE5A 2DFTA 3O1IC 4GX2A 2I80A 4IQ4A 3MJFA 3CIOA 1L1QA 4V0ME 2G8NA 4KMSA 1KTVA 1UT8A 1H3FA 5FI1B 3FPKA 3QKSB 3TL3A 5HIIA 5IJ9B 3RM3A 3UA4A 2CZQA 2D1TA 1Z4OA 3KTDA 3EF1A 5F4BA 4RACA 4QO7A 1FRFS 4HGYA 4AQ7A 3MSCA 3SHFA 1PHRA 2CBZA 1RSZA 3ZXUB 4LVOA 1QO9A 4FJ0A 1HK7A 1V0JA 3CFYA 1N6OA 2FPIA 1II0A 3PHJA 3PFKA 3VOTA 2C8LA 2J0EA 7GPBA 2A3NA 1M8PA 4Q1BA 1PZNA 4GHWA 4BWYA 1ZONA 2HF8A 5CFPA 1OAAA 3RVDA 3VU9A 2PN1A 1Z0AA 3AHGA 1Y37A 2ANCA 3FPCA 3N70A 3DF7A 3OJOA 1Q14A 2QR2A 1R7RA 4YP0A 5JCOC 2YQZA 1Y5IA 4MV6A 5J1TB 5TS2A 5EUMA 2WMYA 3F3YA 5FOQA 1CWUA 4N03A 1XKTA 1R27A 1BW9A 5ALPA 3KUXA 4WK4B 5COQA 2PGJA 4B9AA 1P9WA 3IALA 4ARBA 2PAFA 2LXNA 3F7OA 1YQXA 4UTZA 2CLDX 1JA9A 4I7EA 2AKEA 3PUHA 3EGEA 4Q4HA 5BN4B 2IU0A 3H05A 1EE9A 1QV9A 4Q7MB 3HPRA 3CUSA 3GUHA 4W1QA 5BVHB 4WECA 5AKEA 2AXEA 4KFCA 2DOKA 1KORA 1YDHA 4F9TA 2O8EB 4TTIA 1E1DA 5L4NA 2P1RA 1WU7A 4RABA 3UJPA 1FDIA 4MMXB 4UUBA 1KEEA 3PTAA 5K4AA 3TAXA 1SXJC 1VJTA 3CRW1 1KYYA 4BY9E 1E2QA 1JXAA 2IU4A 3CONA 3W5UA 4Q1DA 2MYNA 4UTRA 3PJEA 3EDMA 1RXWA 3H65A 1Q11A 1O3YA 3FSRA 1TCCA 3RLIA 4BO4A 5DBHX 1NDQA 2ERXA 3HXTA 2Y9PB 3ROGA 1T4GA 1Z28A 1LDMA 3CO0S 5DO9A 4XSVA 2IPXA 4LDZA 5KOIA 2V1XA 2RI0A 4HWOA 2C9CA 4G0ZA 4KK3A 5TDHA 3MRXA 4O4JA 5EJAA 2ZTHA 1KY3A 1JKJA 2DU8A 1D7AA 2R8OA 4YP9A 1QFMA 1PD0A 1P7ZA 1SKAA 3NUQA 4KXVA 1NIJA 4UUQA 4QREA 5GV8A 1A7KA 4JD5A 3M4YA 4CM8B 4LMRA 3Q7QA 1IOZA 5SZKB 2H11A 4R1UA 4WJLA 2DPMA 4MICA 1DAOA 1N2CB 4OB8A 3LVBA 2G80A 4LE2A 2ZUCA 3QXGA 4F7DA 2FFHA 3WI7A 3CLTD 2DHQA 2EP8A 1AKTA 3ZXYA 2H8GA 3O82A 5K51A 2Q2VA 3C5HA 3P4UA 4GS5A 2QAIA 4XRGA 2VDNB 2KMLA 2VH1A 4PLPA 3JWIA 3TZBA 1GZUA 4CLDA 4JBXA 1XPUA 5KINB 1L4EA 1PVVA 3KOUA 1PTKA 4JKIA 4K28A 1TVKA 3EIEA 4RH1A 4XI9A 3AEQB 2HIHA 4M3NA 4V3CA 1KERA 2ALJA 3TE7A 1SCUA 3TVTA 3CZCA 4ALJA 2HIMA 2F55A 1HLGA 4OHKA 1OH6A 3RC3A 1YQ9A 2C83A 3M83A 3DMPA 4QTXA 1YUMA 3HFJA 2BISA 3SKXA 3C3EA 3PUYA 4JU9A 3QU5A 4A6EA 1YC2A 3ENWA 3GJ5A 2Y1CA 4UEWA 2XHEA 1G6KA 4ZK2A 1X1TA 4DSTA 2H2AA 3OEEA 2PG3A 3GZ4A 4ENPA 4CKEB 3FROA 4H4EA 4BXOB 1GUDA 2BFBB 2WE8A 3JQDA 3FVRA 4XQGA 3BE8A 4PQEA 4BASA 5GJBA 4MMYB 3BD8A 3T3PB 4CXMA 4NEHB 3N8DA 3AF0A 5CTAA 1XB2A 3HYRA 1PFQA 3EGVA 1F1JA 5BXYA 4H6XA 2F8MA 5H59A 4F3RA 4IMRA 1QGUA 2QRVB 2ZBRA 2EC5A 2AMFA 4R6WA 1EX7A 1U2GA 1Z7EA 5BMOA 4WNCA 3E15A 1OH8A 3EMDA 4ZVTA 2BSAA 1SOUA 4RHFA 4B87A 3L0OA 2IYSA 1RQ2A 1TM2A 4CDRA 2AHRA 5BMVA 3PPIA 4Y2XA 1JHMA 1QH1A 4IOMA 3H2HA 4Y9DA 1V41E 4UPDA 1U8CB 2QTRA 3MBOA 4KDFA 4CHTA 4UUAA 2MSLA 3T9BA 1Y89A 2Y66A 4IDGA 1VTKA 2R84A 1K7CA 1UJ5A 4PLWA 3L18A 5FO1A 1KJ9A 3IUNA 3KQYA 1FNDA 5IFLA 5LQCA 4MUXA 1GQRA 2F00A 2MU1A 2HEIA 3OPVA 4G4JA 3P2EA 2P8JA 3F9IA 5J47A 3FUWA 1YBAA 2BLLA 5JFGA 3KP1A 1U1FA 4A23A 2GPYA 2PA0A 2Y1DA 4B3CA 1MB3A 1ZY2A 1E98A 1FOEB 1GA6A 1M1XB 1R50A 1M6VB 2IHBA 4HGZA 3AJRA 1KNQA 2JCXA 3SQDA 3PJFA 2P78A 3DFIA 3W0LB 1G59A 2R6R1 3U44B 5JAPA 3WLLA 5HPYB 2WTUA 3FYDA 1W87A 1NRXA 1HNNA 1WMAA 3B36A 3L8HA 4RZSA 2B9VA 2VTVA 3RC9A 2ST1A 2H17A 1RQNA 2YHIA 3H5IA 4ISCA 3X2FA 4XJVA 1JXQA 3MUNA 4WFKA 4Y1RB 2IYOA 2L19A 3IURA 5FOVA 4DPKA 5C0OE 2GJKA 5MGBA 1AV6A 1OR8A 2CDCA 4OUDA 2Q6OA 1XEXB 4PZPA 1IULA 4R8KA 2PLRA 5JZOA 4KR0A 3G8BA 1YQGA 5HUQA 5JECA 3WIUA 3D8NA 5DCWA 2Y6VA 2X9LA 4Q1VA 3T7SA 5ARDA 1CDOA 1HL7A 4U7GA 1CUZA 1C4WA 2RGNC 2QN3A 3TX6A 5A5FA 4I9FA 3QLEA 3NPAA 2V0GA 5EIBC 3WWEA 1D8TA 2HQOA 1QUEA 2ZG6A 2GJ4A 3D9QX 1FRNA 3O4JA 4UJ3A 2VZ8A 1GYPA 5FTMA 1XMXA 3E3LA 5DI3B 5WRFA 2RHJA 1G8YA 5AW1A 3NAMA 1AQNA 2C2GA 2GFHA 5K0FA 5AUOB 2ZSAA 2PX3A 3SIWA 5E6RA 1T5SA 4H3KB 4MGKR 4R7TA 3DDNA 3PNBA 2CNWA 3BIFA 2VCHA 4MVYA 3U56A 2NZYA 1H6CA 2C04A 1RW4A 3TOVA 3ADCA 2BTEA 4QXRA 5MGNA 3P9QA 4PSCA 1SRQA 3DOFA 2J3JA 4AZ0B 4BV8A 2WJVA 1M9NA 1H0RA 1VKNA 2FYTA 2B25A 3L92A 3L79A 3PVSA 5BYJA 4BWVA 2DZDA 4FR5A 4GF5A 3NBAA 5FI0B 4ALLA 5AW0A 5K3EA 1FYDA 4LGYA 2H2WA 1ECJA 1KJYA 3OESA 3KR2A 1JHDA 2O50A 2WG1A 4QXOA 3HRIA 2DLCX 3TNYA 3A4VA 1AVTA 1IM2A 2WA2A 1P9OA 3QM1A 1WXWA 4R9RA 5C5DA 1G8AA 2A5JA 2V4MA 3P45A 5IKPA 1DQZA 1XCPA 4ZFNA 1FRVA 2P2YA 4PHHA 3PT9A 1ZD4A 1VMAA 2XNJA 3OPYI 3AL0C 1PLKA 1WXHA 2HYDA 5CNMA 3PQ6A 3QMWA 5CJPA 1KO8A 5A5GA 5CB8A 5LXTB 1OWMA 2HGSA 2FPWA 4IXWA 1BEEA 3ONWA 3FMGA 4HNTA 2XXAB 1KI6A 4L9RA 4XYBA 2JZOA 3AVQA 1C80A 1KJIA 3I2IA 3N1UA 2PYDA 4PYIA 1YSCA 3KIPA 4YONB 2PQ6A 1HLFA 4UHDA 2P68A 4RDXA 3DVSX 3RGGA 4LWZA 3HJUA 4RC9A 3U61B 1SG6A 4OXYA 4UFOA 3HP1A 3MAJA 2IXFA 4QWMA 5AKIA 2HLNA 3FB4A 3CG0A 1ZN8A 1TF2A 2DR3A 5T6BA 3DZFA 3TO5A 2GD6A 4DW8A 1CEXA 4X1YA 2L17A 1F8YA 4HUQB 1ZOIA 4LYEA 2DJIA 2OZKA 4ZI3A 3TPZA 3UK1A 1U9JA 4O4HF 4GX5A 3CJQA 3OE4A 1FNNA 3EZNA 1DU4A 3Q5DA 1VC2A 4YLYA 1WS6A 5AICA 1UEJA 1ZW1A 2VJMA 2ZU0C 5J2UB 1MUUA 2YINC 4BHTA 1YR6A 5BYBA 1G1AA 1E1RD 3QJGA 1AX9A 4U9UA 4GPTA 3FPSA 2CNDA 3PD1A 4RF4A 2QVZX 3THYB 1RI1A 3A3PA 4YO8A 4HMOA 1DQYA 1G0OA 1CQJB 1FFWA 1JZTA 2BCGY 4PNPA 4C0BA 5KQMA 1CRPA 4EUKA 4D3FA 4RULA 1VL2A 1MR3F 4P35A 2JD0A 4W9NC 5KNCA 2OCPA 2IKSA 1ATIA 2WF7A 4YAOA 2J3HA 4MA0A 2H59A 1QXSA 1I01A 1PO7A 2ZUTA 4W5OA 1U7DA 3LQFA 2HQ1A 2TS1A 2D1YA 3HVIA 3NR2A 3W1VA 1FDRA 3DFFA 4POAA 4EUFA 1SXGA 1EWYA 2Z83A 4CCYB 3Q8WA 4MIOA 4RTQA 1PQWA 3D7SA 4YASA 3TW6A 1EFRD 2WIFA 4W9NA 1OTXA 1TX4B 1RXCA 4X6UA 4Y0NA 3K9HA 1MJGM 1U5CA 2I34A 1BKDR 4XR4A 3TIXB 4RZ3A 3QK7A 4X0EA 4KOEC 1QF6A 4LHVA 1CUWA 1LQUA 4ZEWA 3ROKA 1P7PA 1U2QA 2AC7A 2A58A 1GUBA 2RGUA 2X9NA 2HNBA 3LUCA 3SDBA 1JKFA 1T2VA 4GSKA 3LHSA 1XYGA 4X60A 1ZZEA 4LFAB 2HKIA 4LC9A 4F4UA 1Y6GA 4GNRA 1VL6A 2HRQA 4C06A 3AMVA 4IY1A 5CPBA 1J0DA 1VRWA 4O29A 4DLXA 1Q1NA 2HA0A 1N8SA 5ALJA 2P30A 5ALQA 1TVEA 2VHVA 1YBFA 2E1PA 1JLKA 3JCZA 2K5UA 3P0FA 3PUVA 3PXUA 3TJMA 2XNKA 3CF4G 3VR2D 1Z0DA 2CHUA 1XT6A 2C9BA 2J4DA 4H7JA 4XWGA 4HY3A 4NJMB 3WIEA 3KFVA 3V8NA 4HAWA 3JQAA 1Z6PA 2W43A 4NKRA 2GCIA 4YV2A 3W5DA 4IQFA 5KVAA 1IDOA 1NR5A 3OJFA 3S5UA 1N2EA 1PR3A 2NV2B 4UTXA 2D8AA 4QEKA 2RHRA 4FHEA 3VNRA 1HNWB 4L07A 4ZT6A 1X8LA 3WX0A 1N7HA 5K6TA 3BJEA 3EEBA 1Z62A 3ZY5A 1IHUA 5JD5A 4PLHA 4LNUB 1KP9A 2P8SA 4D74A 4K1LA 1Y4AE 2W8BA 4FWBA 4MEJA 2AJ8A 4Y18A 4WJKB 3VVBA 3O2SB 3A31A 2RIPA 1YRAA 4ZQEA 3ZLVA 2CCJA 2MHCA 5JSUA 1OFGA 1J2YA 3RRBA 4F3KA 1G9SA 1VSQA 3EEIA 1B23P 5I7EA 1W4ZA 3HKBA 4FGWA 2YV5A 2X3UA 2RI1A 1P0CA 5FPSA 1XQWA 2QAJA 1OY1A 2YWHA 1DKNA 1M5TA 3RTAA 3I37X 1KZ7B 2QVBA 3MJDA 4C6SA 3G8AA 5I7RA 4PPGA 5H0IA 4DV0B 2PS9A 3AY7A 2CVQA 1XRRA 3N8IA 2EIHA 5A6SB 4E5DA 5FB3A 4G5RA 5GQSA 2CNWD 4RV5A 1YJXA 3DE5X 4ZVMA 2Q6TA 4MW2A 2GN9A 4WXRA 4S1VA 1QRTA 3W8RA 4MDEA 5I7AA 1D0VA 3V5NA 4DF3A 1KVQA 3ABRB 4P1ZA 4TKVB 4IJQA 1V4VA 4PZAA 4A2PA 3TTVA 2HF7A 4CF3A 1S3GA 5EIXA 4XD2A 4YDRA 3DLHA 3E3OA 4RNCA 1J06A 2GEDA 1OZGA 1WSDA 2ZRMA 2RAPA 2H7XA 3MGKA 2G17A 1EEHA 4OB7A 5FR1A 3SC4A 2SNIE 5FLYA 4TPKA 4UXHA 1K97A 3HL4A 4PQGA 2X1MA 5JTUA 2ID7A 3CPJB 1L4LA 4MWOA 1F3LA 3KJEA 5EQDA 2ZIAA 1K4MA 4EELA 3KOZA 4UOZA 2IODA 2CYAA 4C3UA 4RKYA 1K8QA 1PL0A 1F0YA 1W1IA 4JJZA 4U7PB 3HCEA 3OD5A 4WOPA 3O3OB 1DJOA 5EUBA 3FMOB 2OLKA 2FG7C 3NVKI 3DT6A 2O2EA 4LY9A 3IKJA 3TMKA 1E2JA 2J33A 1A50B 1DKLA 1QH8A 2GTHA 2OHJA 4JBIA 3RCBA 2XOXA 3KWMA 2ZCUA 1UZMA 1YV9A 1USVA 4MPPA 3SEZA 4CLRA 4I8IA 1EWVA 4Z86A 3DMYA 3BJMA 4CI9A 3I6QA 5JV5A 2JRCA 3AZPA 4B6JA 3GJXC 1CQWA 1JJVA 3IRUA 3O90A 1KAHA 1M2JA 1ZCZA 4KE6A 5JW6A 1M1YA 1EP2B 1E64A 4K9SA 1MORA 5AOVA 3LUPA 4BAZA 5ES4B 2YW2A 3HV0A 4KSYA 4KQEA 5EZYB 2FFAA 3BE5A 5JS2A 3TX2A 3G88A 4ZOEA 1XXHA 4PM4A 4PSDA 2Z09A 3ZVKA 4GYYA 1Q77A 3PIDA 4YAFA 1LI4A 1N8NA 1FVXA 2BGRA 3KU4A 1A8SA 2I2DA 2X1VA 4XCVA 3TR6A 3ZBUA 1FX0B 1X9HA 4ZO7A 1Z82A 5KAMA 2WWYA 3D8SA 2GKOA 1T3SA 3OIUA 4GPZA 4C6TA 1S1CA 2I4MA 3C3WA 5KYYB 3TI7A 4P0QB 1U0RA 2QWXA 2PUVA 4AMGA 4ZCMA 2R6HA 1V3UA 1L7PA 4XOUA 4XTCS 1U8XX 6GPBA 3IJRA 1U2SA 2QE7D 2A0YA 3N2KA 1H2FA 5A0FA 1LBEA 4ABTA 2CDNA 1YRQA 3SJCA 2AH5A 2R7MA 3IBTA 1SCUB 3RNLA 2GUGA 3IDAA 1W0CA 5BRAA 1RFGE 3LRTA 1RM3A 5IX8A 1MG5A 5LOVF 3OZAA 1CZLA 1XHEA 4PYOA 4BMCA 4C21A 1W0KD 1D6MA 4HFMA 3EXHB 2C4TA 5FJJA 1GKLA 2AB0A 1OXMA 4H7PA 4GKBA 2FEXA 2GK6A 1NNLA 1WRBA 2R1UA 1Q1QA 3OD1A 5FORA 1DX9A 2JLSA 3E5RA 3BWYA 4I4IA 4WXHA 3PKJA 3RIEA 4RADA 2FUKA 1NGSA 1ESCA 1DSSG 2QQ5A 2QRQA 4H31A 1X7ZA 3EUAA 4IICA 5EC8A 2L82A 2UZ1A 3RRXA 1IWOA 1OHHA 2JFPA 4LHWA 4AJPA 4CQMD 1ENPA 2P67A 3K4PA 2YS7A 1VYHA 3PNVA 2PO5A 2HF2A 1V9LA 1KMIY 1K08A 1CFZA 1G6Q1 2C4VA 1MG0A 2PCLA 3UT5B 5AM0A 2Q3JA 4H6VA 2V58A 3CRZA 1PFYA 4PZZA 4C0AC 3K5HA 2GZHA 5I45A 1P0PA 3G2LA 3OF3A 4JXJA 3RK0A 3CJTA 4F4FA 1COWD 2DB3A 2I55A 3A9VA 3QVXA 2WWWA 1NVDA 5IPFA 2VCEA 1PFKA 3D1LA 4I8DA 4JP5A 2VQFB 3CE9A 4ZAGA 4O08A 4RKQA 4DLLA 1JG7A 4EZEA 4NZPA 4PAGA 5IM5A 3U1BA 5NLLA 4M0KA 4F5DA 5ILOA 4WZAE 3GNLA 1C0IA 4UM8B 4LECA 5C5IA 3L46A 3A0RB 2EFGA 2IYNA 1VMKA 1V1RA 2ZATA 3CPHA 1T1JA 3FFXA 2H2IA 4RFSA 3USES 1WB4A 4UEKA 4Z51A 3QJ5A 3PE4A 5TGZA 4LJ4A 2RC6A 4H1WA 3IQDB 4DRXA 4UCFA 2AN9A 1CYEA 4M1KA 4UBMA 3M7IA 2I67A 3WGQA 2XUIA 4OHVA 1U3DA 1AB6A 4ETMA 5KTTA 4NS4A 1KKUA 2X23A 3K09A 1IRIA 1BXRB 1MC5A 4IWXA 3ZDQA 3HU5A 4TZ0A 3DDUA 4RIIA 4RTRA 4BGIA 3M2TA 1CF9A 4GM1A 4HAZA 3KDSE 1ZI6A 3NWEA 4OVKA 4X93A 1UXGA 2FLWA 2XI4A 2VG8A 2HBQA 3UTDA 4PLYA 1TZ2A 1GQ2A 1TVMA 3PL5A 4TRMA 4J49A 2AX3A 1HSZA 2YXBA 3LIIA 4GLLA 1V9CA 4KLZA 2QD2A 3NTVA 4DLNA 4KE9A 3X1DA 4P4SB 2Y4OA 3E4CA 4WZAA 2RC5A 2G9NA 2J0UA 4M4SA 1CIVA 1USUA 1DCMA 4YFVA 4WRRA 1YGPA 1OI4A 3C7DB 4OA8A 5K09A 2WUWE 1QAMA 3TL6A 1B0PA 1FSSA 2HMWA 1QS0B 1W88B 4LX0A 3OOHA 3VHXA 4QVKA 1XD9A 1OC4A 3PGLA 4RY0A 1T9CA 1GL6A 1ZDMA 2XYQA 4RDCA 1DG9A 2QUIA 2A5DA 4CQMA 3KLBA 2JGAA 3VDQA 3UJNA 3T61A 3GRKA 3OCVA 2XWSA 4LJ9A 2R6CA 4AZTA 2OEPA 4NYMR 2H2FA 3NM4A 4IJUA 2GCNA 2P1ZA 5IVDA 3E9YA 4I4LA 4M46A 3RBZA 2WD9A 4C2UA 5DBIA 2RE8A 2P9BA 2CL7X 1IONA 1I33A 1PQPA 3Q3VA 1YDFA 1J9EA 2G28A 5D3KA 4S2EA 3U19A 3T7KA 1GRQA 1Q50A 1LSSA 2GZSA 1D5CA 1Z2AA 2ES4A 2DWQA 2ZTMA 4F1JA 2P9EA 1JHUA 1T5LA 1DKMA 1ZCFA 2QZPA 4KWCA 5DNAA 1MQSA 1U6IA 1NKSA 1WXQA 4OFBA 1QYVA 2FCRA 1WMDA 1R6BX 5E95A 3GRFA 5J43A 2V7QD 2MIIA 4QYIA 3TLKA 3DE1X 3H9JA 1PS9A 4BZXA 3HPQA 3WGVA 1R3UA 4JJKA 2XB9A 1P4JA 3FFAA 1QFSA 1YIDA 2VO1A 4IIEA 4PTYA 4L22A 3JQ8B 2JLVA 1YDWA 2QDKA 5EIOA 3WKEA 2DQKA 2P2DA 5EJ7A 2YHAA 3OIGA 2A0FA 1Q22A 2FZVA 2FF5A 2JCBA 3ABSB 2VDWA 3O4HA 1M54A 2CFRA 2ADMA 1QK4A 4I1IA 3R1IA 4XFJA 2BTQB 2LZ0A 3SAJA 2R8XA 3VVMA 5ABPA 5I7FA 1W4CA 3BWCA 1E7RA 1YQQA 2WV7A 4BNWA 2GLTA 4MITA 4RJTA 4LC1A 1CJSA 1JKIA 1NOKA 4IKOA 3L41A 1U2ZA 2CFIA 3L1IA 4M83A 4MUIA 3I04A 2LR0A 1QKIA 2PS1A 2PH1A 3OT1B 2GMWA 3TPFA 5I01A 4LXGA 2RGWA 2P9HA 3G3EA 4JENA 5EJ5A 2XMPA 3HZRA 4I1OA 3SF8A 4N3AA 3ZHXA 2RHMA 2GARA 1G7CA 3AZOA 3SHTA 1NF2A 3L8DA 1VLJA 4TV9B 1DKOA 4MV5A 1M7GA 3H1BA 3KJQA 1U2RA 3VJKA 5AVVA 2PUEA 1QIJA 1EDEA 5ENVA 2XTAA 3EH2A 4FDLA 4AJ1A 2IK8A 5C4IA 3BDVA 3EC7A 1RYHA 5CBPB 3ZQUA 1NN5A 3V2IA 3GLGE 5LWQA 3HU2A 4W99A 3RAGA 1OASA 2VNJA 2Z2XA 4K0KB 1O1YA 2RGNA 3LIPA 1RTKA 3R9IA 4CM7A 3ESRA 3ZGZA 1DC4A 3GMTA 4PZCA 4YMSA 3O92A 3WOHA 4N54A 1NMXA 3FLEA 3K1JA 3B7WA 1A8PA 2IIBA 2RKBA 5DWDA 3ZVMA 1KOJA 3P71T 4MARA 4RX1A 3CSSA 4HXYA 4TT3A 1V3QE 1WHTA 1DXQA 5LYYA 1XALA 4FKZA 2IRWA 2LCFA 3ICEA 4OLBA 4EFKA 5JVDA 3H99A 3SG0A 2V6GA 3G5TA 2DUJA 3IC5A 4IGKA 4LBZA 1Y8RB 4WW0A 4A6XA 5IF9A 1P4RA 1IY2A 4ZQHA 5KB3A 3T7IA 3HMQA 1VKJA 2JBHA 4UCWA 3IHTA 2VATA 2YS6A 4L3VA 5J58A 5LYJB 1Z63A 2JFQA 3JQ7B 1UEXC 4F6RA 1Y0BA 3CNOA 1QRRA 5IASA 2DECA 3CLKA 4A6PA 4OGFA 1J09A 3BQNB 4BMVA 3FCCA 1Z4LA 2ZSFA 1BRTA 4YRMA 4KB5A 1GZ6A 2EW1A 3MVEA 4REQB 3F2VA 2BD0A 2FW1A 1MX9A 2QNBA 3ETCA 2R4TA 2XXJA 1TCUA 4AF6A 1FQWA 3T7DA 1KDOA 4KGDA 4ZMRA 2QBYB 5KKCA 1HRKA 2XRFA 1A2BA 1OLUB 3C48A 5LYJA 3TLZA 3ETNA 3C85A 4IIHA 3PSAA 4OOEA 4DJAA 4EHJA 2NV0A 1XRJA 1REQA 2NSLA 3ACDA 5FHRA 2X4DA 2ZSHA 4CRWB 4DQUA 1QO0D 1YS1X 4TVOA 2PUDA 2VK2A 4BKUA 5MHTA 2JIMA 1ZINA 2EQBA 5ENZA 4EHAA 3QEBZ 4HYQA 2OD2A 2J9GA 3D2BA 3UOAB 4OHZA 4DIDA 2XPCA 1PFWA 1EGHA 1G5QA 5A03A 1A82A 2VPZA 2D1QA 1E6LA 2YZGA 3QF7A 4LV5B 2NVUA 1BYIA 1Y9ZA 3VAZA 1A5TA 2W6IA 1I30A 5COBA 3LP8A 5FADA 4HRXA 2D59A 3TJZA 3UG7A 4KNYA 5HZGA 4D79A 3WGKA 1THGA 2RHBA 5EWJB 3EZFA 3T15A 4WV3A 3I5XA 2CVOA 1H65A 4AKHA 4FUQA 1QOZA 3OURA 2HSGA 3DXZA 3LUBA 4CM9A 3K2IA 3AF2A 2XZOA 2WSBA 2Q5CA 4II3A 3GPBA 1J5XA 3EUWA 4S1WA 3PQ8A 3VI3B 1Q74A 4DCTA 2OBXA 1AM4D 1KO1A 1NLUA 2HA3A 3SR4A 3PHIA 5HF5A 3SSMA 1BN7A 4YBZA 2IH2A 3LJKA 1KC1A 4OYRA 2KW5A 3WMWA 3UV6A 1IH8A 2FF7A 2ZYGA 2ODTX 3BCRA 3JZAA 4NYIQ 4ZYTA 4B83A 1U8TA 2BKVA 4WTOA 3CBGA 1A1VA 2Q9CA 2QLLA 3F6RA 5BR1A 3SJ7A 3TIIA 1SA0B 2O2GA 3GRZA 4MWTA 4B8YA 4V38A 4E51A 1CQZA 1R00A 5CYFA 5GJVC 4ZDKA 4ZCIA 2QN6A 2R7AA 2JD2A 4MCAA 4HYYA 5E9JA 1HDRA 1RWKA 5IKOA 1U0NA 2Q5EA 3LC2O 1TLFA 3JZDA 1TI7A 3BAZA 3MCVA 3QQPA 4BNDB 4C03A 3NHBA 2WT8A 2BFDB 1CUEA 3GJYA 3HLYA 4YMLA 1IXYA 1DFIA 1CJMA 1MCZA 1ZK0A 3F0TA 4JV5B 3IEVA 2XAUA 3BSFA 1IZ0A 2GZ1A 3ZV6A 3NEAA 1OH5A 4QPZA 2Q5HA 3PEYA 2HV8A 3SFZA 1HE8B 1SD2A 2OFFA 3WL3A 3T4EA 2DERA 3DLBA 4J07A 1TT7A 3OU6A 1VYUA 3A70A 1GV1A 1JI0A 2C4KA 5F76A 5LA6A 2ATCA 4BLSA 3BXXA 5JYEA 3NJ4A 2UYCA 5CVUA 5TMDA 2R97A 4C5CA 1Q57A 3VHQA 1JEYB 1B4DA 5DP1A 3RFTA 3NM5A 3PF8A 4G6ZA 3F7TA 1QHIA 2WVGA 2YOGA 4M1ZA 3ASZA 5JCJD 4HN9A 3LT0A 2WTXA 3M1YA 2FEKA 2DJ5A 4CF4A 1CF2O 2DUMA 3DM5A 5THKA 1KKMA 1WUIS 1XKXA 4L4RA 4TWZA 3QI7A 5EWJA 4DY4A 4PGHA 4ZVNA 1S3IA 2LD4A 1PVOA 1BW9B 3BIOA 1AKUA 1ZUNB 1UM8A 2WSSD 5MF6A 2RJ3A 2YFYA 3EUEA 4K87A 1KP3A 2YFKA 5I3CA 2NTEA 1UBJS 5EY5B 4AJHA 4YCBA 3A1EA 2H3HA 1ABEA 1ZK3A 2RHHA 3CT4A 3EFOA 3QEKA 4U5XA 4EIWA 1A4UA 2YX1A 4KQXA 1FA9A 2E4UA 3AM3A 4IX1A 2WW8A 4M36A 3S2YA 5B2EA 3U6BA 3W8EA 2BN4A 4WUVA 5IBQA 1N92A 1BVHA 1W9MA 3ZWXA 2XEXA 1G5PA 1F51E 3U7HB 1U2DC 1VE7A 5AVJA 1LBQA 4EPVA 1A9XB 3P20A 1K9SA 4KLNA 1YASA 4QARA 1QHFA 3RYHA 3BK7A 3V8RA 1L5OA 4QDXA 4A2WA 4IW3B 4PFQA 4D56A 2C3YA 3W06A 3RS7A 3KBBA 3ORHA 4F0JA 1VG0B 3QVOA 1R16A 5CVEA 3EX7C 3ZWQA 4WOCA 1QGED 4GOMD 5K0ZA 1RP7A 2FUG6 4HHEA 3RO7A 3QEMA 4UOEA 1YUBA 5ADWA 3NTXA 2VUSA 3HBJA 3AUAA 3OEHD 3QYFA 5CH3A 5CVCA 3B3QA 3T4XA 1RHKA 2F4VB 3ZQKA 5A7GA 2X14A 1TXGA 3H84A 3HYSA 3KOYA 5EKDA 1CR2A 3ORRA 3MCTA 3KE8A 1V11B 1M7HA 2QTTA 3TE6A 2JFZA 3BIXA 3W05A 1ZIXA 2MJLA 1GEGA 2H1FA 4JYBA 2ZDHA 4TRRA 2O8FA 1VCIA 2FN7A 1FK8A 1RBQA 3FAKA 3I9V1 2ZRDA 2HA7A 3ANYB 1JG6A 1OBVA 4R1MA 5BWOA 4LF4B 2ZW9A 3N7AA 4BJ5A 1WETA 1UDXA 4B2YA 1US8B 2P69A 2VDQB 1EXDA 2X1LA 4QTZA 1EUDB 2NUPA 5ICCA 3IEPA 1AKWA 1P73A 2A86A 3KE9A 5CYGA 1P9NA 4RE6A 4KPUB 3BHIA 3GH3A 2FFQA 2WFZA 3LV8A 2ARKA 3UICA 2PZBA 3VYWA 3FOAA 2KS6A 3PNLA 2KLBA 2D2EA 1S2DA 3PQFA 2GJSA 3LHDA 2VF5X 4R69A 4DIMA 3GIDA 3AI3A 2EU8A 3JQBC 3NVAA 4ZYYA 1SU4A 4HCJA 1Z5GA 3IUMA 2JDIA 2KI5A 3QHAA 1XD2A 3QPBA 5H70A 4FB4A 4RY2A 1P1IA 2XYHA 1GP2A 2HBZA 2JGDA 1S89A 3WYEA 4ZV4A 3RAPR 1DGQA 4PVDA 2ZYTX 3T7TA 3T9DA 4GMXA 3V32A 3FD8A 5BQXA 1Z4NA 2YVUA 1E2MA 3CRQA 3UQZA 4EVIA 3GIWA 1RM0A 1PK8A 4BYGA 1SO8A 4BNXA 3F8SA 3NHRA 3G8CA 1FP1D 2P4UA 1FJHA 3U4AA 1CLUA 3WB2A 4AROA 3K0FB 4HEHA 1P9LA 1GLVA 2PH3A 2BVNA 1IQ0A 4HDNB 2FEWB 3ETDA 3GRVA 1JDPA 4UE2A 1QAOA 1U5BA 3QXSA 3T9FA 4UPEA 4FQ7A 3S1AA 2HT1A 4DLAA 2JIZD 2MYUA 2QQGA 4HQOA 4OKSA 5K8CA 3ZWCA 2Y1KA 5JQGA 5KVVA 1EVKA 2D00A 4QATA 2BMFA 3WGHA 4XWAA 4LX8A 3LNTA 4YJ3A 3WXMA 4UQLA 3FW1A 5KJCA 1S8NA 3CVWA 1GRNA 2NU6B 3ZGLA 1XQYA 4JR0A 1N8KA 4DSZA 3UPUA 1YB2A 3QQ5A 2M6RA 4A27A 4ARAA 4DLBA 4UNIA 1W581 4M76B 2VJLA 3PU6A 3NGXA 4EFNA 3ODPA 4HN2A 1YL6A 4WLNA 4F45A 4V24A 2DM6A 5JJIA 1JVBA 2HLHA 1C8BA 3KYCA 3LG2A 1HFEL 1LJLA 4FIZA 1EVJA 4K05A 4P4TA 4BX3A 1H1LB 1FDUA 2HIAA 1JS1X 3KDAA 1MO3A 5CHYA 5AH0A 3DYVA 2M2IA 2YY6A 3KZOA 3ZE8A 1WZCA 2IP1A 3OC0A 5LDGA 3VMMA 4UHKA 3EGDB 5JIBA 4OXIA 1ZXBA 3GRPA 1U6KA 4NL4H 1UQRA 4UBLA 1POWA 2WSMA 2LDXA 4HP8A 3PWTA 3UY4A 3U7QA 1S9HA 2PXAA 1Y9JA 1RVV1 3HACA 4C01A 4YHHB 1I2DA 3P7MA 2EKBA 2EFJA 2B2XA 2DY1A 3DKVA 5U4XA 3SZMA 4EI2A 4ZVKA 5KTMA 2FX5A 4BE9A 1M2OB 1R0BA 4HF7A 3HHEA 3WYBA 5HXAA 1MW9X 5AVZA 1K5PA 1LW7A 3K0CA 1JAZA 4M54A 3DMFA 5I9TA 4ETWA 4JVOA 4C3VA 4HB4A 4NJEB 3DWFA 4M8SA 1JG3A 5H3LA 4MUHA 4CT4B 1U9YA 1OSNA 1X86B 3SHOA 2NV6A 3VR4H 3F46A 3OZEA 3R41A 4EKEA 4MVJH 3WGYA 1G41A 1ZSNA 5LQDA 1TLTA 4EQZA 5TQ2A 5K8IA 3L02A 1IN1A 1A88A 5FDFA 5L3ZA 3GGGA 1LV8A 2IYVA 4QUIA 4TZKA 5TQVA 4Q9LA 2NU8A 1S0UA 4K2HA 3GPLA 4EA7A 2D7CA 2KSQA 4D5EA 1HX7A 2GYYA 2PSHA 3CKMA 4CLHA 4UATA 3IUQA 3AIMA 4CMKA 4DDTA 2OSVA 2VPXA 4Q05A 5CA1F 1INLA 1TW2A 4LYYA 3RASA 1C30A 3LL4A 4OG2A 2NMVA 1FNCA 3KVOA 3ZDFA 4P93A 4C7MA 3LZCA 1JIIA 3NHUA 4NBKA 2G9ZA 4EL5A 4CF7A 3K09C 2FOLA 2D3TA 1Y1LA 2IW1A 2PKCA 3DGFC 4QUDA 4RL6A 4ZJZA 2RHWA 4RETA 1T5HX 2ID9A 2VSYA 3E9MA 1F4VA 4G1MB 5FA6A 3TDNA 2YRXA 3RV3A 2WAOA 2ZLBA 3A1DA 2FZCA 4AJ4A 3TFOA 1A8QA 5IXJA 3S55A 1MZVA 4M0FA 2V74B 2B5VA 2W90A 4V0MA 2NOAA 3H2ZA 3PXBA 1ZM3A 5JXWA 2JLYA 1ZMXA 5TV2A 5C1PA 4R3NA 3OA0A 5LLTA 4JASB 1D04A 5EIAA 3VAYA 2WJYA 2Q9AA 2OBBA 4BCDA 3SS8A 5B55A 1M2NA 5DDIP 1QV7A 3ECAA 4FMPA 5KNCD 2IYYA 3B3FA 3D2AA 3M4NA 2W5UA 3B1WA 5DE3A 2ZRNA 4N5LA 1TTQB 1XRQA 1Z5VA 4QGGA 5CURA 5H3CA 4ZU6X 3TAHA 4HV4A 4O2AB 1WW3A 3HBMA 3MS7A 3HWRA 3MYYA 4QNMA 2XEDA 3HJAA 2WWTA 5TSDA 3L2OB 3FPGA 1UADA 5KKNB 2NXEA 3VISA 1L3IA 3QPWA 4M6WA 1Z06A 2TECE 1Z56C 1L4MA 1W4RA 4IS2A 5L6MB 2G0NA 4UTOA 1PL8A 3ZHTA 5JR3A 4YCAA 1L4HA 1M72A 2LBPA 3ND6A 3NPMA 4IHJA 2O4CA 5CT8A 1WSWA 4URWR 5AK5A 4OJTA 4D57A 2P6MA 3BGSA 1Y8CA 2Y1WA 3RF7A 1G3MA 3EQ8A 4B4VA 1ZIDA 2Z30A 2E4WA 1MAHA 2F3SA 1UIRA 4EJFA 1KKLA 2WF6A 3A2MA 1H4VB 3OE5A 5TQ0B 2QLFA 4XARA 3B82A 5DBFA 3ACBA 5JPIA 5K45A 2AD1A 2JLRA 1Y5NA 1KHTA 4GH5A 2FZLA 4NNOA 4NU6A 4PC1A 3KSUA 4PX2A 1BNCA 3B8EA 4J75A 3WFIA 4B73A 2JAQA 1K1EA 1H3NA 1T9ZA 4OHXA 3EA5A 1GD1O 1CT9A 3H3FA 1WX1A 2WJZB 4ZMSA 3E03A 3QJYA 1YB4A 1CUUA 2BFFA 2GJ9A 3THOA 1EX1A 5JZ9A 4INJA 1DLIA 1Z26A 4C7OB 4KQ2A 2BKLA 4YI5A 2VWGA 3Q3JB 2NT3A 5E7JA 1WZ2A 3M8KA 3NS7A 2VSOA 1X38A 3DEKA 1R4MA 4BNTA 1UP6A 4NOKA 1Q12A 3NOQA 4DM7A 2V7QA 4O0LA 3P9NA 3AB3A 3ROEA 2YWDA 5EE3A 3UOGA 3HFRA 4BC0A 2FX3A 5B5SA 2A1TS 1CNFA 4IHKA 1V6AA 3A05A 3T9AA 2IHKA 4EF6A 2ATXA 4P7KA 4G5SA 2AOUA 4FMDB 1UWVA 4HDAA 4K8OA 2OWEA 4ZRDA 4Q4AA 1YRLA 2YIDA 1WPXA 4PZEA 4RGQA 4U8GA 1P0MA 1YCFA 1IBSA 2XD4A 4ROSA 3HNPA 1YIOA 1EA5A 4GPD1 4R9VA 1Y6JA 4RXUA 2FRXA 1UUFA 3REQB 3ZDAA 1JUDA 2BFMA 3VR2A 1SZCA 1H94A 2H9YA 2YWGA 1K06A 2GCPA 4ZYLA 3Q3CA 2HMVA 3SJUA 4KXWA 4G9BA 4BNNA 4A0QA 3CLUD 3F73A 4HWSA 4YP6A 4KTTE 2HR1A 5G0VA 3RUHA 4MUBA 2TRSB 4LXIA 2OB1A 5IMSA 3MCWA 4IIJA 1SCJA 3GLHA 4EYSA 1A7UA 1Z7GA 2EGUA 4PYKA 4A5OA 5JSFA 1NRJB 2OHIA 1HE5A 1EFPB 3SQOA 2I78A 4BVGA 2J9FB 3T95A 5KWIA 5CHEA 2V7VA 1M1YE 1AJEA 4QRIA 2ZYAA 2GA9A 3E58A 1TD9A 2G7ZA