3RVRA

Structure of the cheyn59d/e89r molybdate complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
130
structure length
130
Chain Sequence
b'HMADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 47
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rvrA00
3O1IC 3VNAA 2OQRA 1ISRA 3H1GA 3MQ4A 2PAFA 2PJUA 5JS2A 1YTUA 1QQAA 1FQWA 4D6YA 3FFWA 4YP9A 2PUFA 1USIA 5C5EA 5TPWA 2BGGA 1JBEA 2M98A 3CS3A 3H5LA 1DZ3A 4PE5B 5HSGA 2PE5A 3DLHA 3LTEA 4Z0NA 3KSMA 2IDMA 4Z4HA 4LE2A 4YLEA 2GI4A 1DP4A 2JCGA 3QELA 4O1IA 1DRKA 4OLAA 1E6KA 1I3CA 2ID7A 5EWMB 2QU7A 5JS1A 4OLBA 4G97A 1D1QA 1IIBA 3QLVA 4MQEB 2QV0A 4YS6A 6CHYA 3OMWA 5TPZA 4MPTA 3P9YA 3KYJB 5FWYB 3F73A 3MIZA 2B1JA 5IBQA 1DCMA 3HVRA 5KWSA 1Z17A 4MS1B 1W25A 1L5ZA 2IPLA 2YHAA 3QEMB 1ZGGA 2FMIA 4G0QA 3Q15C 3Q7TA 4L4UA 1NXOA 3Q7RA 3DBIA 2JVIA 4DADA 3FFTA 3HSYA 4DN6A 1VKRA 4H3HB 4W5NA 3OLYA 1A0OA 2R47A 4O1HA 3O2SB 4TMYA 3HDGA 3Q9SA 4RK5A 4W5OA 3TD9A 1PEAA 2VYCA 2PUAA 1W9HA 1DRJA 3TMYA 5JNVA 3K9CA 3OLXA 3G85A 1Z13A 1M5TA 1JWLA 1C0EA 4Z4EA 5EWJB 4PEVA 5DTEA 4EYKA 3HCWA 2AYXA 1SRRA 1AB6A 4RK6A 1QNLA 4RK1A 3RVOA 2MSKA 3C3KA 3OM0A 4LE0A 2FLKA 1Z15A 1D2AA 4FE7A 5GOTA 4EVSA 4ZYLA 2CHEA 1P6UA 3F6CA 2CD7A 5JNSA 3HXMA 3KCNA 4XARA 1XHFA 2IPMA 1EWVA 3LUFA 3G1WA 3FDFA 3IDOA 3KLNA 4IF4A 4QICA 5KC9A 3T38A 2IOYA 2MYTA 4KMRA 4F11A 5JNRA 1RZRD 4N0PA 4Z4CA 2NT4A 2LIVA 2YHBA 3RVNA 3FGZA 1YVUA 1B00A 3H75A 1GCGA 1USKA 3EGCA 1UDRA 5T7BA 2JK1A 3GBPA 3O74A 3OQMA 1D4ZA 4ETMA 4OG2A 3ROTA 3TX6A 3HO1A 3LOPA 2GBPA 3LUDA 2PUEA 2A9OA 1EWTA 3CU5A 2WY2D 2E4WA 1U2PA 2PUCA 2WJWA 5CHYA 4O5AA 4WT7A 2QZJA 2V0NA 4HYEA 3CZ5A 1QMPA 3H1EA 3IP7A 1KRWA 1TMYA 3MA0A 3HJFA 2PKXA 4H3KB 4F12A 5KQMA 2E4VA 3OO1A 3T95A 2MSLA 2HQBA 1JDNA 5EWMA 3GT7A 4YGXB 4OBBA 1LJLA 2JBAB 1TM2A 3E61A 1YS7A 3L49A 2XDYA 4JB2A 3JPYA 4JOQA 3T8YA 1NXVA 3M9XA 4MS1A 5BR1A 1GCAA 3RVMA 5D2CA 3LFTA 3QEKA 3C3MA 3QEMA 2N9UA 1CHNA 1F51E 1U04A 1RNLA 3I5AA 2QVGA 3EQZA 3N8IA 4ML3A 2WWVD 3LUJA 5ED4A 3UKJA 3LUHA 2VUHB 1FFSA 1Z26A 5JNWA 4H60A 5DKFA 5PNTA 4TLMB 3UK0A 5TPZD 1PHRA 3HDVA 2CHFA 3IP9A 1ZH4A 3QLTA 4MR8B 3OQOA 4CBVA 3IPAA 1EAYA 2NZVG 5EWJA 3KKEA 5JNUA 2GKGA 2A9RA 3CZCA 3M9WA 3N0XA 3KS9A 4D6XA 4EGSA 1DBQA 1LJUA 1NATA 3LKBA 4JASB 3BRQA 1SXHA 4LX8A 1FFGA 4YR7A 3LUCA 2PLNA 1QKKA 1ZH2A 1XWWA 2LPMA 4Z9AA 2LUOA 3HUUA 1DCKA 2HPHA 2MYUA 4MRMB 3EULA 3KYIB 4KQ9A 2IPNA 3N0RA 3O2QB 4RK7A 4RY9A 2AYZA 4WUTA 3NHMA 3ROFA 1LBHA 4IILA 4P98A 1CEYA 4N47A 2I6FA 1YIOA 3CNBA 3QX8A 5IUKC 1MB0A 1QO0A 1ZHHA 4HNRA 5E3JA 1DBWA 3GWGA 4IMJB 1CYEA 1JYEA 3GYBA 4WZZA 1NXWA 1E2BA 2RJNA 1TJYA 1JLKA 2FMKA 3RVRA 4Q6WA 1VRVA 1VLZA 4F8JA 5TE9A 2FEKA 5IUJC 1F4VA 2FVYA 1EHCA 3QLUA 4OTZA 2L18A 3OLZA 3BBLA 4XXHA 3EDCA 4FB4A 5FBHA 1FFWA 3A10A 4WWHA 3SM9A 1NXPA 3TB6A 2ZWMA 3KG2A 4ETIA 2LBPA 4Z4GA 1NXXA 4MLDA 1ISSA 3I42A 3T6KA 2E4XA 2NZUG 1Z16A 3FFXA 4MAAA 2L19A 4MR9B 1KRXA 4JB0A 4HNQA 3NNSA 2JVJA 2P4UA 3HS3A 4B09A 3RVPA 4RU1A 1GUDA 4IMIB 2HQOA 4YWHA 2JBAA 4GPAA 3BRSA 3IPCA 3M6MD 5KC8A 4EY3A 5HKOA 1M5UA 1QP4A 2IPAB 4XLTA 4EYQA 3ILYA 1M2EA 3RVSA 4ETNA 5IULC 4NCBA 3JPWA 4RKQA 5JNTA 2TMYA 1ABFA 1MVOA 3QLVC 2M1ZA 4G0XA 1E6MA 5CNMA 1JFVA 1P2FA 4Z99A 3RVLA 5FWXB 2QR3A 1TLFA 2FMFA 2W42A 4KK4A 3HZHA 4KNYA 4MR8A 3N53A 4RZSA 6ABPA 1RXIA 3HUTA 5TQ2B 3O75A 4RSMA 1JL3A 4RS3A 4KFCA 3CHYA 3SNKA 4MGEA 2JRLA 3UUGA 4KQCA 4JA2A 1H9CA 3JTEA 4DQDA 3QK7A 5KI6A 4UHJA 4KRFA 4KV7A 4KK3A 1XHEA 3K4HA 3MM4A 2FEWB 1PNRA 4RWEA 2J48A 3CKMA 2L17A 4XAQA 1NXTA 4Q7EA 4IRXA 4MRMA 4TLLB 1L5YA 4G0PA 1ZDMA 3L6UA 2FN9A 4LRQA 2RGYA 1TVMA 1NXSA 3IP5A 5IX8A 1BVHA 3I45A 1U2QA 1ABEA 1JF8A 1OXKB 1BDJA 3JVIA 5B3JA 2CWDA 3RQIA 1M2FA 5KQLA 3JVDA 3H5VA 1ZAYA 5HM6A 5DLEA 4YO7A 1SD5A 2O20A 3H6GA 1YK1A 2VUIB 3Q41A 2X7XA 3NNDA 4WXEA 2WB4A 4MR7B 5HQJA 2HSGA 1YMUA 1URPA 1ZN2A 2IKSA 4W5RA 4RXUA 2KYRA 3N0WA 1ZGZA 3O2JA 1QP7A 3OO0A 3OLWA 1RZRA 1VPWA 1Z25A 4ZJPA 1QO0D 2FW0A 2FLWA 3H5WA 5CNKA 2F8SA 3MF4A 1SXGA 2NUBA 5DCLA 2RJOA 4LDAA 1BDIA 1U0SY 4FE4A 1JFSA 2FQYA 5BRAA 3GRCA 4MR9A 4N0QA 3KHTA 4Z4FA 3CLKA 1YMVA 4UHKA 1DCFA 2WRZA 3H5IA 2FTKE 4MQFA 4E7OA 1ZY2A 2MYPA 1NTRA 4F06A 2FSPA 2WMYA 3CG4A 8ABPA 2PUBA 4P1ZA 4MS4B 3EQ2A 3C3WA 4GNRA 3H5OA 5IUNC 2HQRA 3E3MA 2DRIA 2PMCA 5T3YA 2A9PA 4Z9BA 4Q6BA 3MMNA 3F6PA 4RY8A 3H1FA 5FWXA 3DZDA 4KVFA 3TO5A 3CRNA 3N6VA 2E4UA 3MYYA 3GV0A 3O1HB 1DJMA 2FN8A 3LUKA 2RDMA 1YK0A 3RVQA 4QPJC 5C5CA 1JFTA 5TQ2A 3A3KA 4RDCA 1BAPA 2HJ9A 2QSJA 3FMVA 3NNNA 4RK0A 4D74A 1EFAA 4EYGA 1SXIA 2NT3A 3CFYA 4NQRA 4LZLA 3OM1A 3SG0A 2PL9A 4XASA 4W5TA 3H5TA 3SAJA 2PL1A 4KPYA 1DC8A 4G86A 3HV2A 3C6QA 1NY5A 3NHZA 4YV7A 3OQNA 2WJAA 1JHZA 1QQBA 1WETA 3SY8A 3RVJA 1Z2EA 2IYNA 2QW1A 4N03A 4S04A 4S05A 4XFKA 3LUGA 4G0YA 4MQFB 5IEBA 2QVCA 1OXBB 1J56A 4ZMRA 1GUBA 1ZVVA 4RXMA 1PNTA 5F64A 3HM9A 1PEYA 1JYFA 1P8AA 2L2QA 3H6HA 2MSWA 1USGA 3ILHA 9ABPA 4YRZA 2PUGA 1C4WA 1QP0A 1DG9A 2FEPA 3D02A 3EODA 3GL9A 4G0MA 5TQ0B 3O21A 4MLCA 4MS3B 4MR7A 1AB5A 4N76A 2LP4Y 4L85A 4RXTA 1Z12A 2B4AA 3BREA 4EUKA 4NICA 4QYWA 5CNJA 1BA2A 3GBVA 3KJXA 3JS5A 1U8TA 4PICA 4ZMSA 4G0ZA 5KQPA 4PYRA 5TPWB 1E6LA 1LK0A 2R25B 3F7NA 3QLUC 1ZITA 1T34A 4YCSA 4NCAA 1GLGA 4F3TA 4EVRA 2ID9A 7ABPA 1K68A 1MB3A 2P9HA 3N75A 3QELB 4Y9TA 3RH0A 2JVKA 1QPZA 3HK2A 4W5QA 2H0AA 3JY6A 2JB9A 3R0JA 2FQXA 5EWLA 1K66A 4MS4A 1D1PA 3SQNA 3W9SA 1EWKA 4RY0A 4JAVC 4KREA 2FQWA 3OMXA 4HNSA 3KTOA 2MYNA 1BDHA 4IGAA 3Q7SA 3EAFA 1DBPA 2ZAYA 4M88A 2F8TA 4RK4A 4EVQA 3NBMA 3A0RB 3S99A 1APBA 5DGCA 1KMIY 1S8NA 2FKAA 3HEBA 2A9QA 2E4ZA 2FMHA 1LBIA 3URMA 5CNIA 1D5WA 5IC5A 1JH9A 1JDPA 3DGEC 4OATA 4N41A 4KZKA 3KLOA 1KGSA 3LKVA 1Z2DA 1A2OA 4PZ0A 4TN5A 2GWRA 2OENG 3CTPA 5TQJA 4RV5A 3RVKA 1R8JA 2H3HA 4LE1A 1Y1LA 3IP6A 1PUXA 1MIHA 4MQEA 4NV3A 2FXIA 1YS6A 4MYRA 1Z18A 5BRJA 5FWYA 1JX6A 5IEJA 3DLBA 1ZESA 3LUAA 3D8UA 1HEYA 4Z4IA 5ABPA 4LDZA 2VK2A 4EYOA 4E7PA 5GQSA 3QX9A 3DGFC 4RKRA 4WXMA 4ZPJA 3B2NA 2E4YA 1FSPA 4JP1A 3EJWA 5KQGA 3GA5A 2R48A 3C97A 1MAVA 5EWLB 3O1JC 1RPJA 5FBKA 1RXEA 1A04A 3LMKA 2QXYA 3A0UA 3CG0A 2GX6A 5TQ0A 3I09A 3VNBA 5B3JC 4MS3A 4QYMA 1DC7A 2Q5CA 5BQ3A 4G0OA 5I4CA 3BILA 2PUDA 2R4QA 3OLVA 1P6QA
chains in the Genus database with same CATH superfamily
1W1IA 3VNAA 3G9TA 1UIRA 4PQGA 1EZ4A 2OO5A 2H92A 3AVWA 1B73A 1E0JA 4FFPA 4JSTA 3ZQ6A 4D79A 3B53X 5T41A 3IB6A 5J2UF 4CKZA 2QORA 4O5OA 5TQ2B 3W06A 4EJFA 3LFUA 1QZXA 3AP2A 3GF4A 3OCYA 1QFYA 2R8XA 4WA7A 5G1OA 3AY0A 5J47A 1Z88A 4MW9A 3SEZA 4N65A 3AUYA 5LFAA 1N34B 4KYTA 2ZROA 4DLLA 1CUFA 2Q49A 3FBGA 1JIUA 4A2WA 5FAXA 4GC5A 4OLAA 1F9AA 4P35A 3VGPA 1I3CA 2DU8A 4F72A 4ZZ0A 2R7NA 5EP4A 3FPKA 4EZEA 2EKBA 2AN9A 4MQEB 1Y80A 4KIGA 1PVDA 1G5HA 2AB0A 2CN1A 2WJ4A 4YS6A 4RVOA 3F73A 4DQLA 4Z1OA 4NCIA 1UAAA 3K0BA 3VBCA 1Q0RA 2YXLA 5TRTA 2IP4A 2AIRA 3VKFA 1NUPA 3MT9A 2R8YA 3Q7TA 1E5VA 4L4UA 4G24A 3REQB 5CFQA 1T0PA 4F6RA 3AKEA 3W6UA 1J99A 2XHEA 3T7DA 1LI5A 3WK4A 4RKWA 1JU3A 1QK3A 2PV7A 4OHBA 5JD3A 2F62A 5GZ3A 2BRUC 3LWNA 2O0LA 4BRWA 4L2IB 5TMEA 3OLYA 4BEVA 2GJ9A 2J0UB 4O1HA 2PGOA 2CMGA 1FUEA 5DM60 2PU7A 2Z8YM 5IVDA 2Y3IA 1PVOA 4FYYA 3CWZA 3ZU4A 4Y9UA 2R62A 1GQSA 1LW7A 3SQDA 3NBFA 2JKZA 1W0CA 3THWB 5H0IA 4D96A 2SECE 4R2JA 5KO2A 1SRRA 1KEEB 2ZK7A 3VVMA 3H4MA 3HZZA 1G2IA 4RK1A 4OGFA 3VYTB 4BX8A 1ECCA 3BL6A 1AJEA 3PFNA 2B3DA 2GYYA 1CD5A 1Z15A 2F1KA 3KYCA 3PNOA 4WNCA 5F52A 4DSAA 2ZRKA 1KJNA 1UEXC 3KCNA 1BFDA 4N0EA 1HNWB 4W7IA 4EJ0A 1NSFA 1QBGA 1OH8A 3DXYA 4MIYA 2DQKA 2C92A 5LUBA 1PS9A 1IZZA 1QCYA 1QIFA 2HCJB 3HRKA 4G1FA 4Q7QA 1D1TA 1E2JA 2C5AA 2HV9A 1YQWA 3K7EA 3KTAB 4GPEA 4INOA 3I2FA 4P5DA 5ITWA 3IUMA 3NPAA 3U3XA 5FP0A 1QOQB 4Y0NA 2G6TA 5ALFA 3HKBA 3R3YA 5ITZB 2J41A 5FB3A 2FR1A 3IP1A 4D3FA 1E7SA 3RVNA 1HDEA 1KTVA 1EUQA 1VC2A 1K7YA 4X20A 5ALOA 5BORA 1Q2UA 4E5MA 4P9NA 2UZIR 1BXRB 4OG2A 1XCMA 1WW2A 2Z43A 2R7KA 1BROA 1LNSA 1KP2A 1UP6A 1L9KA 3HCOA 4IGKA 4JX8A 1V7PC 4LYEA 2MDTA 4PGHA 4TKUB 4UATA 5EJAA 3WI7A 3IOMA 4XVUA 4GXRA 1GNPA 4XDYA 2Z98A 3U3DA 1JXOA 4WT7A 3L05A 3H11B 4BO8A 2YHIB 3ZTTA 1IJEA 1SKUA 3IIJA 5J3JA 1N2CB 3FTNA 4B3DA 3NKFA 3OU2A 1BO6A 4AZTA 7AT1A 2J1LA 3WK7A 2NW6A 2PU5A 2RE8A 1E9CA 3EC1A 3OO1A 2IFTA 3USCS 4BNMA 2H1RA 3UTDA 1Y4UA 1EE2A 2Z8ZA 2ZR0A 2WKWA 4RF2A 5EWMA 2QNRA 3H2ZA 4YGXB 5B36A 4UPVA 1WUJS 2ZPUA 3AHCA 4A5OA 5LMCA 2XKBA 4DV5B 3AOGA 3R4CA 5FPQA 2JW5A 1MB2A 3X2EA 5EJ4A 1WXFA 3I6ZA 4JJ6A 1M6VB 4PZLA 3L5KA 4RQAA 3H13A 4TSKA 5D2CA 4CYMA 3RD5A 3VVCA 4A8PA 1ZMBA 1PSWA 4AG3A 2WT8A 4TT3A 1X1AA 2QVGA 2BFMA 5ELLA 1RPAA 4O02B 4ZT2A 3HJRA 1NDQA 1I94B 4QDXA 2OGUA 1OJLA 3UKJA 2QW8A 1JR3D 3HNRA 1P0MA 3BWCA 3LUHA 4FFMA 4NENB 5BV7A 3K8QA 4JUBA 1ECJA 3A3OA 3JV7A 5K4GA 1D7OA 1GEGA 2PXHA 3PXCX 4MYSA 4KWIA 5HBRA 4R01A 2C54A 4KIJA 4KFSA 1M7HA 1YSCA 3JQFA 1T3GA 4M53A 1SHUX 2PNFA 4KAXA 1J7KA 2WAOA 3HMQA 5K01A 1R88A 4QHTA 4ZVLA 3REFA 1GNRA 1I8TA 4Q1AA 4UVHA 3QOWA 3CZCA 3MUEA 3N0XA 1GUYA 4RUKA 2P79A 3OPMA 1IATA 3BCRA 1NATA 3ZCUA 1CB7A 5IASA 1RPNA 4HWKA 4X92A 1GZSA 4MGKR 2BKEA 3WLMA 1DCTA 1FFGA 1SQGA 2BFEB 2G36A 5EKSA 3ZU6A 4LBWA 3W2IA 2K7FA 1RYHA 1IDOA 4RBNA 3DKRA 2AH5A 2DPYA 1WAMA 2VOJA 2RGUA 4MRMB 1W4BA 2AFVA 5AOCA 1Y48E 3O2QB 3AF0A 2WZDA 2QMQA 5HFAA 4CN9A 4Y3UA 3UYLA 2OBFA 2OC9A 1N4AA 2G9VA 3T3IA 1OGYA 4CM9A 1LBHA 1EWYA 5AI6A 2FWIA 4FNGA 4OFXA 4PHFA 1FUKA 3GA0A 2KWIA 1PIWA 4YMHA 4ALLA 4H15A 3D3QA 3FSRA 2CV2A 2BM8A 1VLZA 1Z6ZA 2POQX 3EW7A 2PIDA 4LHWA 4KR2A 4YP5A 3O8BA 2L18A 2V3WA 5I7RA 2JNWA 4IIYA 3GLVA 1ZOSA 4EG0A 3QVXA 4EG8A 4BX2A 1WVMA 3N1UA 3MPUA 4IRMA 1CR2A 1AO3A 3OQPA 5CFMA 4Z4GA 2YVAA 2C2GA 3ESAA 4B3HA 5BVGB 4HB2A 5BUZA 3VSAA 5KNDH 4G5GA 2AFHB 3U5ZB 6LDHA 1TK2A 5AKZA 4WJLA 3MTIA 1IY8A 4ZALA 4I4IA 2H57A 1Y5NA 1U1FA 2FKNA 5BP7A 5EUBA 1J23A 2EFCB 3IAXA 3V1MA 3P9SA 3T35A 3PQFA 1YGPA 1NUHA 3WKAA 2AR7A 1U0FA 1FSZA 2NPOA 2OZVA 4C4YA 4DDVA 2CLHB 3ACDA 1OH6A 4RTQA 2WT9A 4B7AA 4L5AA 4JT8A 2CFSA 3CRVA 3D6HA 4IYJA 3ITNA 2H7XA 1ZW1A 1HFJA 3HJBA 3MLAA 3O4HA 4UM5A 4IS2A 4K3VA 1YGYA 3VTFA 3COJA 4BMPB 1JAXA 4HN2A 5CRIA 3B89A 2WBLC 3PGLA 3QJGA 3LBHA 1XAJA 4MIOA 1WMAA 3AU9A 5EIFA 3QFSA 5A0FA 4XYBA 1W2WB 4KACA 2L42A 4S1OA 1KYXA 3UH0A 4H0FA 2C5GA 3S6JA 1C8KA 3GNQA 2EVWX 3NHRA 2X0DA 1SBNE 3IJPA 6ABPA 2KBFA 3GX1A 3WNCA 4RSMA 4XJXA 2QD2A 1E5QA 2GUGA 4KE9A 5CX4A 4CM4A 1Y98A 4HYQA 5A3SA 2DLCX 4FI3F 2H00A 5BSRA 3T5BA 1YULA 2HCBA 4MO2A 4CTMA 4C87A 5EERA 4AMUA 1L1FA 1P5RA 2Y4OA 3MM4A 3SF8A 1N7HA 2ZYUX 4IHJF 4PZAA 2D13A 3N8NA 2H65A 1RIFA 2DKOA 1U7XA 2NSDA 1JFLA 2V6BA 1L0BA 1EM8B 2J3EA 2Q4TA 3DT6A 3IKMB 3M0EA 3QY0A 4ID9A 3SFVA 4PLCA 5AMXA 1KO1A 1EXVA 2OBBA 2RGYA 5FV4A 3UCEA 3AP3A 2GCIA 4FMBB 4GZ5A 3I45A 4PHCA 3EFOA 4MRRA 3QUQA 2IRWA 3PRYA 4R2MA 3PKZA 4B3GA 2WJGA 1WQ4A 5DSTA 5BWOA 3KOUA 1ACLA 1Z5VA 3F4LA 4PS0A 4Y1RA 5KYNA 1D2RA 1RKUA 4KLAA 1T1JA 1T5IA 1P0IA 1ZCZA 2EP5A 3ELWA 4Q3DA 4TMTA 3WRVA 4WXPA 1I0ZA 3X2FA 4EYEA 2Z6AA 4PLFA 2DPMA 2XVAA 1W94A 4A8JA 2FN4A 2HSGA 3D8NA 1KI6B 2JAXA 1UP4A 3QFCA 1CJCA 3I9FA 4FT2A 4JL5A 1SXQA 2E1RA 3HJTA 4U7DA 3PNMA 4S1WA 3LM8A 3MJRA 1CS0B 2WSSA 4BUZA 1MIOA 1ZSVA 1E99A 1TFUA 3OLWA 4DYHA 2DETA 5A6SB 5FLXA 1IWBB 1X7YA 1ZQ9A 3TMAA 2JGKA 4BJ1A 4H1UA 4LJ5A 4EDHA 3L4SO 2VAMA 4BV2A 3SBDA 3KQQA 4RDIA 4TUYA 1V11B 4RAOA 3E3LA 3QHAA 1ECBA 3AUXA 1I24A 4YPVA 4YDQA 4NX2A 2P6PA 2W7TA 3KHTA 3KR0A 5HJ7A 2ACKA 1L4HA 3HKCA 5IHPA 2WD7B 1JB9A 3KV1A 3SBOA 1CRLA 1LBSA 5CDFE 2HRRA 3M70A 4BCDA 3AF1A 4QDUA 1ZK0A 1N6NA 3JD1A 4X97A 3UFXA 5IT9A 2IE0A 5EJFA 5G4KA 3JAKA 4B40A 3AZOA 4U8HA 3PQEA 4P7KA 1QF6A 2JFXA 1N3YA 1RYYA 4NH0A 2PTGA 4HEHA 2NNWB 2VOEA 4A0SA 4KWHA 4XPIB 5ENVA 4B87A 2OGWA 3H7AA 2K87A 3UKOA 3T4PA 1PWHA 1E7YA 2VYQA 4CV3A 1MT0A 3QPCA 4RY8A 4G1CA 2E5WA 1VMKA 4B9AA 2B1QA 5IDYA 2W2PA 2YASA 4PXYA 4IHJA 1HOXA 1XXHA 5H70A 3SR4A 3WSTA 3ZNOA 4DANA 5CDSA 1E9AA 5KJ6A 3N6VA 4X7PA 2Y1LA 1N9KA 4K6KA 3FUUA 5IAJA 1KFBB 3I2IA 5JCZA 2RDMA 2V3CC 1NMQA 2FAXA 2W2MA 3ORFA 3RJTA 2E1PA 4FJ2A 4WZBA 4PC2A 5E0KB 5EN4A 5TQ2A 3RTBA 2AJCA 3QEBZ 4I4TA 4HDMB 3TPFA 4K6HA 5LOVB 3ML1A 2WVJA 1DKQA 4LZLA 1JPUA 3GRYA 4LMBA 4NJMB 4CMJA 2XMCA 1R74A 4EUHA 1G8YA 3IMGA 4B7ZA 5DH9A 1CZLA 1L7XA 1X9HA 3IKLA 1PV1A 1S2DA 1WXQA 4TTAA 3P9NA 2UYGA 3PC6A 3PSHA 1XBTA 1HDIA 2BGTA 5AKXA 1TZMA 2WLTA 3QKRA 1OAOA 2GBGA 1Z35A 4XGKA 2X4LA 1CF2O 3AUSA 3L06A 4IUCS 1L2TA 1RQNA 2EWWA 4K6OA 4LOJA 1J24A 4S12A 1U2DC 1MEEA 1KSFX 2GCOA 2QW1A 3OEYA 4QHSA 1RPZA 2QLBA 4OI0A 2IWRA 4D8UA 1QQTA 3QXCA 2VRCD 4MDHA 3KZOA 2IV7A 1DBRA 4C3ZA 1QC5B 3MT7A 4REOA 4RXMA 3GMSA 4C0KA 4FKMA 1VKOA 3PGVA 3OZVA 1YFZA 5DHPA 3ANTA 3ZHQA 3EVAA 4S3MA 3WLLA 3X44A 3H84A 3KAKA 2GHRA 4DXDA 2DBYA 2FP4B 1KFEB 4JLVA 5C51B 1UZUA 2JLUA 1ZFNA 2QF7A 3TW0A 2ZUEA 1PUIA 5EIBC 3LLCA 1MKYA 1DTWB 2PO5A 4QYWA 4DLUA 4AG5A 1KAEA 1IN8A 3G23A 3SZGA 2VHYA 4P3YA 4BZPA 4ZMSA 4K9SA 2N47A 2HKIA 1OX5A 4BQNA 1NXQA 4CGYA 3CVXA 4PG8A 3WAJA 2R11A 1MX1A 1PF7E 1KOGA 3ROMA 1M2OB 1SEVA 1CUCA 3ZLJA 1NYRA 1IPEA 1SBIA 1ZWLA 2JLAA 3TL6A 1DWPA 2VTDA 3RS2A 4W5QA 5ALQA 4NI5A 2C9BA 3K09A 5G3YA 3ZX4A 5K2OA 2WYWA 1P5HA 3FY4A 4M98A 4PLHA 3HXKA 2H06A 4OKIA 4BB5A 1U31A 1SGWA 2OCAA 2ZEJA 2JL1A 1KERA 2HNKA 3AV3A 1FW8A 4JAVC 3RANA 2PKQO 1QPGA 4RD4A 3C1TA 1BXGA 1KJYA 4M88A 5K3FB 2HPZA 2JGEA 5SYAA 3LF2A 1E1CB 3PJDA 4FFBB 4Q4HB 2QD5A 2ZB4A 1IXSB 3LBNA 2D1YA 1ZVKA 2XRFA 4XB2A 1UJNA 2AE1A 1TMOA 2YIJA 3B9BA 5E9WA 5IXSA 2ZZMA 2YJTD 1P7YA 2GLXA 1MT3A 5CXSA 5FPHA 4EZIA 3A6ZA 1TD1A 4LFBB 5C1OA 5DBHX 1TDJA 1MX9A 4C0JA 4PCAA 1BMTA 1YJXA 3FMFA 3AFNA 2KHZA 3FROA 3WIUA 2GRJA 4V03A 1U2RA 4JWTA 4D0GA 4LC9A 3HI6A 2Z1NA 2G06A 2WI8A 4DREA 2DYKA 3CN7A 1HPLA 1ZD4A 2RFLA 4UM9B 3WK9A 1R0CA 2V59A 4U02A 1C30B 4F97A 3V1KA 4LMPA 5B6PA 1MC8A 1OI4A 3J7TA 3RGWS 1KP3A 2CGEA 1K4YA 1K7CA 4D43A 4HO1X 2A0WA 3C7AA 1OKKD 4C9BA 1FFCA 1UXJA 4PO8A 3GA5A 3HTXA 1U7HA 1MOPA 1R0ZA 3C97A 4I2NA 4XYEA 2DERA 5CUQA 4CIWA 3G7NA 4MB6A 3TW4A 4AKGA 5T64A 3GDGA 4WXYB 3QKUA 1EP3B 2I67A 3COYA 1DHRA 4MULA 4OLHA 2W2KA 4QYMA 4E32A 3WGJA 5CJ2A 2O3JA 3AJ9A 1PW7A 1UPCA 2VTEA 2BFDB 2YRXA 4KEAA 1IBMB 2ZKLA 4LDQA 4YJ2B 2DUUA 2QTVA 3EVZA 2OGTA 1TUBB 2VSFA 3CRMA 1TCBA 3K9GA 5FNVA 1UWVA 1OTHA 1XZIA 4Y8VA 3UC9A 5JS2A 1QJ4A 1KBOA 2CBGA 4S1TA 5E7QA 5EJMA 3UOWA 4ARBA 1JA9A 5KVQA 2BGGA 3ID6C 3DPIA 3K73O 2M98A 1WWKA 2V45A 1TCUA 4NYMR 5HSGA 5J58A 1XNQB 4L51A 1N1DA 3X1ZA 2OAEA 2NQ2C 4R2KA 3MD0A 5DB4A 3WBFA 1OMOA 1K6XA 4YUXA 3D6MA 3OTIA 1JR3A 3OE5A 1ISPA 1N8NA 5CVEA 5AOBA 3VPBA 3VYWA 3ZWMA 3TQSA 2PUVA 2W4QA 1SB8A 3DTTA 1B26A 2VDUE 5JS1A 1H2RS 1NNI1 2HA0A 3EYWA 2WJZB 2Z57A 3DL4A 3LX5A 1WXIA 1TFRA 3H2BA 3I04M 1I4OA 4OJMX 4TWRA 1A7AA 5IBQA 3WGOA 3C98A 1Z17A 3AR3A 1EFHA 1A9OA 3Q7PA 4QUHA 4BEJA 2VWPA 2W6CX 3ZZ1A 2FMIA 3T5CA 1C0IA 3HB0A 4HEQA 3OEWA 1A71A 3IELA 2X8WA 1EM6A 3QG1A 2JVIA 1JBQA 1BYUA 1EKXA 1KO5A 2O2HA 3SJCA 2NXJA 3G5MA 1E5XA 4FGSA 4KTTE 4DIMA 4FU0A 1MZPA 1NL3A 4H3HB 3HGMA 2R47A 2VS1A 4A26A 2DPLA 1JSLA 1QH8B 3LPDA 4JGGA 3AEYA 3FMGA 2QL9A 2F4NA 5G40A 5IVIA 3Q9SA 3T3EA 3MT8A 1K8RA 1RWWA 2ONZA 2KJQA 1Z8HA 4R71A 1JWLA 3SX0A 4QYIB 4Z4EA 1SUEA 2VHUA 3IC5A 2WHPA 2AS0A 4OXYA 2QI9F 1U7UA 2R96A 2DFLA 3VOTA 2CLSA 3B6MA 2NVOA 5HE8A 4LE0A 4MKRA 3KOXA 1KZ1A 3A25A 1XTBA 3T9DA 3GOQA 4ZOBA 5TGTA 3AW8A 4DR7B 1VG0B 3PUIA 3E53A 3FAKA 4YREA 4JJKA 3RYFB 5GJVC 4OI1A 2QD1A 4TTJA 5JZOA 1L4LA 2QQEA 1VL2A 5EQJB 1Z8NA 1V4BA 2C4VA 4JR1A 4N0DA 3TFQA 2E0IA 3B82A 3QEJA 2HY7A 3VV2A 3GN2A 4MUMA 3DUFA 3IUPA 4V2IA 1F7VA 1Q15A 4LF7B 4U3JA 1YVDA 2Q3LA 3WMRA 1S8OA 1NN0A 1XF9A 1MXFA 4UNNA 1NZFA 2OD7A 4GVLA 5JI3E 2FG6C 3INRA 2Q9CA 4GI3A 4WXRA 3Q5GA 1QHIA 4DV2B 4GXQA 4M1YA 4M7PA 3P2MA 3UXMA 3AEQA 5J2TF 5CLGA 2ZWVA 2XZOA 5I6DA 3K0AB 3LUDA 1D2EA 4MI9A 3MMZA 1C1YA 3BGIA 1O6ZA 1Y3AA 5HQTA 2HT1A 2ISCA 3RHFA 1U4OA 4IZHA 3RROA 3OFKA 4BASA 3NUQA 1EEXB 1DKOA 3EA0A 1NASA 3O82A 2ZYVX 4ABTA 1Y7HA 3K1AB 3HBJA 2QE6A 4G01B 1C9NA 4INZA 5AJZA 1CR1A 3KM0A 1VCNA 3G89A 4D3ZA 1L7NA 2Q0HA 3BEOA 1FNSA 2F2TA 3C5HA 2VK1A 3Q8WA 2XYQA 3RC9A 2IWHA 3ELDA 1U1DA 5F5NA 3WL5A 1ID8A 1J9ZA 4P2BA 3UGTA 5B6JA 2ZXEA 2B3TA 4J9UE 1XXLA 4ZCLA 2XQJA 1G8GA 2VXBA 5BR1A 2F4VB 1V5GA 4QARA 3VH2A 2QZ4A 2R65A 2UUPA 3HCDA 1CHNA 2XF2A 2Y0EA 3G2HA 3HNPA 4EW6A 1ZHOA 4GL2A 1VLQA 3BL8A 3PFIA 3UJ6A 3ETHA 4RVDA 2EQ5A 2B6HA 3C24A 1DELA 1AURA 3OEHD 3OSZA 4L2IA 4LJ9A 3DC2A 2AMVA 4Q37A 3C45A 3TZCA 4RGVA 4E46A 1HDYA 2WKRA 3E7PA 1HT0A 1PX2A 2OHOA 3RU2A 4GVPA 4IG4A 4H7HA 4J2OA 2PY6A 4X62B 1S1MA 1M33A 2MT9A 1XTVA 1AK1A 1NP6A 3GVXA 4HFMA 4PC6A 2A1UA 3HB1A 2CLOB 2GNAA 1Z2PX 5I9MA 3RRZA 3D5QA 1PK8A 4PVDA 3THWA 1NJSA 4YUVA 4EDFA 5JDIA 1Q5PA 4LOHA 2V4ZA 5IPFA 3WYDA 2GKOA 2HIMA 4RH0A 3DV2A 1CJTC 1KVTA 1KEEA 1SUWA 4D6XA 1COWD 4RDXA 4QM6A 2HTEA 1UOQA 3ZHXA 1B2RA 1N5LA 5BMOA 1F5NA 3SHWA 3S1LA 3K70C 4ON9A 4ILEA 4QTTB 2OESA 3LUCA 3SE0A 1VKNA 4NABA 3SS9X 4KPGA 2MMCA 3C7DB 3CZMA 2FPIB 2QJWA 3INYA 5AT1A 2GEVA 5KAPA 3KETA 2X0NA 1VLJA 1JKIA 2D5IA 3TLEA 4K1LA 2QXTA 4CM6A 4MINA 3BJRA 3NANA 2Z9CA 4YP7A 4PY2A 3FNBA 3KTAA 4YWJA 1XF1A 2OXFA 3MQ2A 4P86A 5BOSA 3NATA 4KR3A 1YIOA 5HDQA 1IEVA 2WTEA 4KL8S 1NC1A 1NN1A 1V4VA 3AM3A 4RVGA 4ITUA 3FXAA 3B3AA 1V3VA 5AICA 3UB4A 5LDDC 1L7VC 4UM9D 5EJEA 5TNXA 1U99A 1GG9A 5GV8A 4IIJB 4URFA 1BXRA 3GLUA 3QX3A 1NOKA 4MIKA 2A0UA 3PEWA 2YZNA 2Z9BA 4TKUA 1ZMRA 4N3BA 5LP1A 3CF4A 3H11A 3EEIA 4ZC1A 4HCJA 5HKOA 2QUIA 2P2NA 2HI0A 3CWCA 3B1YA 3KB2A 3MN1A 4FQ5A 4B33A 2AFRA 1N2CA 4RJIA 4E1BA 3AJRA 4GBJA 1ZISA 2GZ3A 4GP6A 2ZJZA 5BW6B 4EEXA 1FU4A 2VPWA 1FQJA 2G08A 2IEZA 1RR6A 4WXHA 2BCJQ 5E3HA 3ROQA 3RVPA 5A2GA 3AR9A 2BONA 1T36B 4AAYA 3RAPR 3RHZA 5ADVA 4GLBA 2GAOA 1KK1A 1T43A 3Q3EA 4QRIA 5F2EA 3ASZA 4G1MB 3EXHB 3GJ5A 4FXPA 4GU5A 4EI8A 2CVFA 3PL1A 3QU2A 1M6VA 2PLAA 3OQ6A 3O8DA 3KKMA 4WBNB 2O50A 1LW6E 2NZXA 3CLHA 5EJ5A 5LKAA 2PYDA 3A9RA 5EJ6A 5KHOC 5CBKA 2YWCA 3BMNB 3Q2KA 2HRCA 1KS9A 2D8AA 3C48A 1OUMA 3BQ9A 1JQ5A 3JQPA 1P2FA 1XAGA 4KXNA 4NENA 3WRWA 1R4NB 4X1OA 4BJ3A 3AIMA 3QBTA 4G4GA 4OO3A 2XSZD 2RD2A 2UYCA 4BC1A 3OQVA 1I7LA 1L4GA 1GITA 1RXUA 3NDIA 4YRJA 2GVNA 4C08A 2GLTA 2Q4OA 1TAUA 1YZNA 2QA5A 1EDBA 2ERXA 3DE0X 3G0BA 4AKEA 4G1VA 5FI1B 1JL3A 3OFSA 5CPBA 4I6JA 1V45E 4U00A 4OHZA 3GP8A 3JSAA 2PPLA 3SZMA 5GOZA 1N9GB 4C5AA 2VRCA 2ATCA 4EB3A 3T1YB 1JZTA 1KAHA 2XE6A 5KJEA 3EASA 1ZH8A 1US8B 2CLDX 1A50B 1QIKA 3LW7A 2HJSA 1ZI9A 2FSGA 1V48A 3BTOA 3U39A 1GAWA 2BFEA 2GZSA 2HU8A 2XUQA 1B8UA 3OD1A 1O54A 4L5IA 4ZT3A 3TTTA 3WLAA 3SLKA 5C4IA 3DTVB 4RGYA 3RKRA 4LY9A 4V0KA 1DC4A 2IXTA 3DD1A 3WYAA 3VZPA 1W75A 3FHCB 4MRMA 3AW9A 1U9JA 1Z37A 1XD8A 1EQUA 3MEQA 4BX3A 1GZDA 2DSTA 2XWBF 3WE7A 1Y7TA 5JMOA 4DPLA 2ZAOA 4RMNA 2ZW9A 2GASA 1FZQA 5B3AA 3PFWO 1OVMA 1U0BB 4C05A 3NWEA 1UINA 4FFOA 4AX8A 1CFJA 4LMAA 4PPFA 5EUQB 9GPBA 3B3FA 2J5QA 4B2PA 3SLRA 2WTAA 3OF5A 4RJTA 4C0HA 3D8BA 1A5SB 2AD5A 2YINC 3JD2A 5EZ6B 4C14A 1P6XA 5E9AA 1AKEA 1SUIA 3G88A 1SMKA 2JBHA 1V8ZA 2FN3A 4FS8A 1TB4A 5BOVA 1G4HA 1R3UA 4AVYA 1BHO1 3PTZA 1DB3A 3DEAA 3GYGA 1YOVB 2FFBA 2YFYA 3WWYA 4ZJPA 5BVGA 4NPHA 1K8QA 3CWQA 3OX1A 3PX3A 5CH8A 3P9CA 2AFHA 2FQYA 2OV4A 4LY0A 3FHTA 3ED5A 4HGNA 4NJOA 3R6TA 2DY0A 1O7JA 1VBFA 1ZVJA 2QYSA 4J4TA 3BERA 4Y2QA 1N92A 1KIAA 4OQXA 3BIOA 3C3PA 1Q16A 3CGWA 3UOGA 4LJYA 1R6VA 2IQ5A 5LBTA 4Z53A 1Q0QA 1VKJA 2P1RA 4L9WA 3L9WA 3L0BA 2A1TS 3BD9A 4EW1A 3PNBA 1WNTA 3EZGA 4NCXA 4REQB 4Q9JA 1VG9B 4XLLA 3FSGD 4CUZA 5KB3A 4Y2RA 1YQ9A 1B0UA 1YU9A 1ZL0A 4DILA 1JIQA 1XK6A 2C8JA 4C5BA 4FLMA 4LVOA 3G6KA 4QQ8A 1J6UA 3HXLA 4KVFA 1RAGA 5SY6A 5ICCA 3OC0A 1BHSA 3RUEA 5B2EA 5ES3A 4LJLA 1QYDA 5K8CA 2NO7A 2I4LA 3ED1A 1VB5A 1L5OA 2QT0A 2RG1A 4N5NA 4INPA 3VR6D 3W5HA 4BX9A 5TS3A 4JC0A 2VJAA 4HWTA 3IURA 3NH9A 3NNNA 4UU0A 4MQ4A 4D8TA 4R3UC 3GEDA 3FVQA 4DBZA 1DQYA 1OKKA 2WYHA 3QFFA 4LPKA 4M1TA 5CTAA 4JI6B 3WLOA 3ZWXA 1QQ5A 1L7OA 1B93A 4GXTA 1YACA 1C9JA 4AN4A 4V1CA 3QIAA 4R9UC 1EM8A 5AJUA 4FYXA 3MS4A 1QQBA 1FS5A 3BUSA 2G0NA 1THMA 4C3OB 2R8PA 3IHTA 1BKDR 1N32B 2I2AA 3C7KA 2QG6A 3KT6A 1TO1E 3R41A 4PX9A 2ZBDA 3KBBA 1DAHA 1KKUA 2FEAA 4FHFA 4LK2A 1FX0B 2DKNA 4D4MA 3FW1A 1CRPA 3KVNA 2OM6A 4MQFB 1ADGA 1L7PA 4IM7A 3ZCTA 2J67A 1AUXA 5BW5A 5I7OA 1JWAB 1QX4A 3NVDA 4TRMA 4U8GA 3H42B 4AY4A 1RC8A 4LC1A 2HU7A 3GPBA 3V7WA 3ZCPA 1PQWA 4MQLA 2IW1A 2ZSDA 3CXUA 5IKOA 1T13A 2QJFA 4Q1CA 2UU9B 1L8QA 3O21A 2QS9A 4DCNA 1CY7A 3ZLVA 5TSDA 2JANA 1KI6A 3BFKA 2OK8A 4MTLA 4TM8A 4TOIA 2BDEA 3X1XA 1ND6A 2YZ7A 5DNYB 3R6DA 4MKFA 4P4UA 4AQ7A 1CS0A 4F5ZA 5IKMA 3OZEA 1JG7A 1T8UA 3FWNA 1K4KA 3L6EA 1ULTA 4CG1A 1E2FA 3IAFA 5ALJA 1QV6A 2A9KA 2H85A 3A2LA 1N3IA 3KLBA 2E85A 1SXJE 2A35A 4E2WA 1UANA 3Q88A 3I30X 1V11A 1FMCA 4QYSA 3N86A 5K3EA 4AYXA 3PYLA 4RIGA 2JLVA 1N57A 1QUEA 1L7DA 1P19A 3DCIA 3QELB 1C7ZA 3QKWA 4RESA 4B76A 2WD7A 4PYJA 5IYZB 2QZZA 5GMOA 2CVZA 4NMHA 2H0AA 3RQSA 2GBLC 3JYNA 1DOAA 2VQ3A 4QUDA 4A36A 4GHWA 5EWLA 5CAEB 3MAGA 3SCZA 3ZIDA 4AJPA 3KPVA 4A23A 4S0ZA 5NLLA 3UQZA 4PLGA 1K3UB 4KDRA 1TQ8A 5DYTA 4XPIA 3RTAA 4F3RA 1E4YA 2AN3A 2PQ6A 3FRHA 3IUQA 2XXAB 2BM9A 4JQYA 4JUIA 5I4BA 4GGPA 4AMZA 2XRZA 1SXPA 1X0XA 1ZIPA 2P3OA 4FK8A 1N3BA 3GXOA 3R8XA 4H16A 5DF1A 5BMVB 3A9VA 4CMIB 3W5JA 1C9MA 5CG2A 1PK7A 1QV9A 5F5LA 3CNHA 5JISA 3SHVA 4DYDA 1DDGA 4FTWA 5D87A 4C89A 1HX7A 2BKLA 2H18A 2IXBA 3EBOA 4HDMA 2UZ0A 3MWLA 4WIAA 1I0IA 3GFTA 5LOVA 1X94A 5JSFA 1AHPA 1E3SA 3KLOA 4Q7JB 1XCOA 1NDHA 4LISA 2GWRA 2OENG 4JP8A 4LZNA 4KXMA 1EFKA 3GRVA 5E4TA 1FS6A 4ZVVA 3S40A 3GZ4A 5FUXA 4Z0TA 1DKRA 5KSZA 2FW7A 2UZAA 3RWOA 1R6TA 4H7EA 1GGVA 3MINB 3UB3A 3F6SA 2PMDA 2RGDA 3BZUA 5GQSA 3WSWA 1KKMA 2E82A 2WIBA 3EXG1 4R05A 4WZAA 2GEUA 1T9CA 3VO9A 4AW9A 4B44A 2RIPA 4F4IA 1D0IA 1GL7A 1E3WB 1GFSA 1KY5A 1QC5A 3MGKA 3PPIA 5I4KA 1MNAA 2ZDGA 3UHJA 3PD1A 2RIRA 3CW8X 4RA9B 5G2OA 2F1JA 1P31A 1YOBA 2RI1A 2DE0X 3KHSA 3D0KA 3IR7A 4CL0A 5JS8A 3DTVD 5KBYA 3EW9A 4JBLA 1MHPA 1HNXB 2GA8A 4KUEA 2FP4A 3A05A 3OPXA 2GM3A 1GKYA 2ZTLA 1RAHA 3U80A 3ZCRA 5EMKA 2ADOA 4WCFC 1WUIS 1NI5A 1DGQA 2J87A 2D2XA 2ZTUA 3EFBA 1FUYB 2B5OA 2P6OA 3RUCA 1N77A 3RUDA 4R69A 1H2HA 5COAA 1AXRA 3WTBA 1A2BA 4DVJA 5L3VA 1MA0A 2CBZA 1M2OA 1WRBA 4QQRA 2IDMA 3KHUA 4Z4HA 3VJLA 4LE2A 2CXOA 4YLEA 2R1TB 3NT4A 4L6IA 3TZKA 3WP0A 4A16A 3CVYA 3OEHA 4JQZA 3D43A 4YJ2F 4KKXB 5FUVA 3W77A 4Q7MB 4NE7A 1PFGA 5LB2A 3ZTYA 1NMXA 2RAUA 3SXUB 1O0BA 3OJOA 4TMFA 2MR5A 4P0QB 1G7SA 1CRQA 1EGQA 5FPYA 2SNIE 4CR7A 1UBTS 1KO4A 1G42A 2QTFA 4D8XA 2P27A 3BB4A 3AY7A 1FP6A 3VAAA 4GYJA 2I5PO 3RT9A 4QPZA 1COWA 5K3FA 2JCVA 2QVYX 4O29A 3EVGA 2RJ3A 3DBLB 4FFBA 2REOA 4Q4HA 4QGGA 5I8ZA 3TSWA 5JEEA 3FDJA 2ZRGA 1D4OA 4NG4A 1K0UA 4RK5A 2PZBA 4R9NA 1WVIA 3FNHA 2GCNA 5I4IA 3FYCA 2DPHA 3QFRA 3QBVA 1IXRC 1V16A 3AL3A 1AK2A 1HH4A 3QVVA 1RADA 3R6LA 1N4DA 4RD6A 4F9EA 5HZHA 4LNUA 3EHDA 2X1MA 4BU0A 4DIOA 2G1KA 3FRJA 2ODAA 3DE5X 4JX9A 3C4JA 2XKAA 5IAGA 2XVZA 2YV2A 3ADKA 5IDWA 5K20A 1ZD8A 2GPBA 2YYSA 3VAZA 1NZDA 1XZHA 4OHCA 2DTDA 3EEYA 5ERGB 3ZNPA 4ANFA 1C30A 4ZC8A 3M6VA 1GPKA 4HRVA 4R2HA 1NHWA 2Y1FA 4XVHA 3QX7A 1ZEMA 2JJ1D 2SCUB 3VR5D 1YFJA 3FDFA 1NFRA 1JYSA 1WKBA 2PM8A 3QBJA 3R0ZA 5LP6B 2PX2A 4IF4A 4Q19A 4WKOA 3W4JA 4E2ZA 4JYPA 1BWQA 4Q15A 2OLKA 3T0GA 3GLIB 4ITRC 1UMBB 4TYMA 4U6QA 3R5TA 5L4LA 2LCFA 3IIEA 4DGQA 3MBKA 4F4JA 4ZZ1A 1VRWA 1TO6A 4G9GA 4LKRA 2O3QA 2YKGA 2YJ5A 3F3YA 4KSYA 5KVAA 3OQMA 2BFDA 4LCBA 1GYRA 1HLDA 1UJ2A 1UPBA 3F4BA 3JQ9C 1TUBA 3RS7A 4ZJUA 1NWHA 2AEFA 3O83A 2IEYA 4JI8B 1O2DA 2CNDA 1NBMA 3BQNB 3FOCA 2R0QC 2CFCA 1I7QB 2P6RA 2FLVA 3SP1A 1YRAA 3MAAC 3ONVA 4D4JA 2WWXA 2VN8A 1OZAA 4BVBA 1HDGO 1X15A 3G9QA 1NYTA 2CVQA 2RBKA 4JJ8A 1E1QD 3V8NA 3WXBA 4CIVA 2OWDA 4G5SA 3M7IA 4IIGA 2IEDA 3GB9A 4H27A 3L0ZA 1K75A 4CR6A 4FUTA 4WCDA 2QW0X 4M60A 3T3DA 1Y34E 3BL5A 1VHDA 3OE4A 1FLVA 3EDQA 4KJZA 2R68A 4Y2SA 1P75A 1Z0DA 4FONA 3GNSA 2LDXA 2AOVA 4ZYXA 1NV8A 2B4RO 1GCAA 2IHTA 3HU5A 1YUMA 2C59A 3I6QA 4ND1A 4PZYA 5DP2A 2HK6A 2G17A 2OV6A 3PUKA 4OOFA 5COQA 5EXPA 4YJ3B 3DH0A 3U5TA 3EQZA 2YVUA 2G7MC 4M8KA 4BO0A 4FJ1A 4U39A 4U6SA 1BC5A 3K92A 3N8HA 3SDBA 2BN4A 3IEPA 4OHKA 4G8BA 2C57A 2FPWA 3J80A 1QH8A 3GEIA 2WYUA 3NAZA 4RD2A 1K89A 5JNWA 1W52X 1NVGA 2W0MA 2GPYA 3THXA 4LRSB 1NT2A 3DR3A 5IJXA 1QTQA 2P75A 1PHRA 1QE0A 1X1DA 3PF8A 4L07A 3O0TA 2P7HA 5AW4A 2QVXX 2Y68A 1AMUA 1CB0A 1R0KA 4M9RA 2X1HA 4YP6A 4EGAA 3PLAE 2IYPA 3KKEA 3U17A 1NE2A 3P0EA 1V9SA 2FFJA 1HFKA 3MWDB 2DUWA 4LZPA 3EXEB 5JE8A 4IIFA 1K3FA 3BRQA 4UXJA 2V74B 1EFRD 2WZBA 4K6GA 2HCTA 2C9ZA 1Q50A 4HSEA 2ATIA 1KFKB 3OTQA 2A9JA 4NATA 4OHOA 2EL9A 5HGJA 3VOSA 3HUUA 2WE7A 1DQPA 4QFCA 2KE5A 2OZLB 2DFTA 1TU3A 3FVRA 2IZ0A 2IPNA 3N0RA 1OI3A 4EY8A 4DAEA 4M22A 4YX9A 1P1BA 1QX3A 5H9VA 3NJ8A 1AMNA 4OJNA 1J8YF 1KZ6A 3DUWA 5IUKC 4CKWB 1YS9A 3UT5B 1W9MA 4Y1FA 3U3MA 4DQXA 4EX6A 4DR3B 5A6VA 3MOGA 4OVKA 1X1TA 2G9NA 2EEPA 4AT1A 3GYBA 3E9MA 5CYPA 3RCBA 2RJNA 1A5AB 1IOVA 2ZDHA 3ECCA 5JIBA 2X14A 2WHEA 1GFZA 1NN5A 4O4JB 3J81k 2D1SA 2WHRA 1MPTA 2JDID 5TV2A 3KCQA 4P7BA 3U4QB 2XI4A 4FB4A 2YN4A 2NTEA 4LGMA 2VJMB 1H0SA 5BWBA 2GYWA 4HVTA 3GZJA 3SS8A 4Q16A 4IL5A 1PJBA 4EFKA 4CF3A 1ZNWA 3K1AA 2AOUB 3E7XA 4FHDA 4OMFG 3WV5A 1XK7A 2C4UA 2E4XA 2GUWA 2NZUG 1MJFA 1NTOA 4IIJF 3GPCA 4L02A 4N8EA 2QGZA 1WBDA 2XCRB 1BHQ1 3IPCA 1QP4A 3NHYA 2GTHA 2EC5A 3GDFA 1RTKA 3JR7A 2OV1A 3VU0A 2ZWOA 4TTTS 4G81A 3GRPA 1BU8A 4OXRA 4RKQA 3EZ9A 1GPWB 2TMYA 2AQHA 3TR6A 3L6CA 3ADCA 1G3MA 2ZZNA 2CXTA 2AOXA 3FH0A 4MI3A 1GZUA 4OREX 5E95A 4AF6A 4F8YA 3AVUA 2IX9A 3S29A 3KU4A 1KSHA 4ZJYA 5JXGA 2Z1MA 1TLFA 4I55A 5MFPA 4MHSA 1R3DA 2RH5A 5E1DA 2VF2A 3HZHA 4IXDA 1FDTA 3BDAA 1Z0ZA 5K8UA 3I5MA 4C2AA 4CT0A 1U5AA 4Y2TA 3RRFA 2WHYA 5EY5B 4WBNF 4M21A 1CP3A 2P9CA 4RS3A 4WFIA 3SYNA 3QKIA 2OPHA 4ZO4A 4ZDKA 1T8YA 4AUEA 2NM0A 4GMFA 3SDSA 3SF0A 3WKDA 1XVLA 3PXEA 1S3GA 4K6MA 3ESCA 5BT9A 1H9CA 2XMGA 1IC6A 1UDXA 3TM4A 1CIJA 3VZRA 1CNFA 2ISSD 4L57A 3SVLA 1J4AA 1SOUA 5KVCA 2F8MA 3PTLA 2ZE6A 4ZAGA 1J2TA 1WUKS 1C3OB 2PL3A 1E9EA 2GETA 2Z4RA 2EJUA 3I3SR 5H8WA 4CLDA 2B9VA 2WKQA 1Q0HA 5GWXA 4ZEMA 2QX7A 2G9UA 2FPIA 2WIKA 2WJ6A 1QG0A 3EDRA 3KZKA 3L1IA 1M1UA 3FYHA 4ZFNA 2HW8A 3W2HA 4ZOEA 4AJIA 2ZJ0A 4WE3A 5F3WB 1Q17A 1FEZA 4JJZA 1A96A 5H68A 1GTRA 1DT5A 2VDQB 4EGFA 1CZHA 1S3IA 4KWTA 2I3ZA 2AG1A 2X5KO 4HFJA 2PMFA 4RE6A 4RZ2A 2G4CA 4X64B 3ZZUA 2CHVA 2CZCA 2PS0A 3HUFA 1QRSA 1I14A 4AJ2A 1M54A 3TX2A 3ND6A 2WB4A 1RJWA 4IIJA 4JVMA 1R8XA 2CUKA 3QUCA 4IDBA 1TUEA 2CL0X 3OIYA 3ZIAD 3KELA 1UXGA 1JTVA 2G25A 4EY5A 1OWNA 4L3VA 3FPHA 1LI7A 1TT7A 2NQ8A 5AM3A 1PT5A 1JI3A 1XDSA 2COUA 2QM8A 4H4EA 4C01A 3RB8A 2WTUA 1ADCA 3WBBA 1WR8A 3N2KB 1CR4A 1T8PA 2W6NA 4OL0A 4YRBA 4P82A 3ONEA 1Z74A 3N58A 1U0SY 4JC5A 3P20A 2D7DA 3L1HA 1RMTA 4GSLA 2JIQA 4XWTA 5DHUA 3LIIA 4L75A 5AW9A 2YWEA 1RDFA 1T36A 3CB4A 3E22B 3DZ8A 1U8ZA 5IW8A 3OZBA 2IY9A 3OQHA 3QMWA 4YCLA 3OFVA 3IUEA 3U4MA 1AV7A 4FOTA 3HJNA 3JSXA 3R44A 3ROGA 1FYVA 1P73A 5FORA 4N40A 1F6DA 2PZLA 3HSSA 4AMGA 1RLMA 4MS4B 1SC9A 2QJTA 1B3RA 1IN6A 1KDTA 4MWOA 4WK4B 1E0DA 4WBNA 1OH7A 2HQRA 1JAYA 1G6Q1 4RLFA 3IHLA 1SU7A 1XTJA 3GMIA 3ILSA 4CTKA 4L0QA 4DDMA 1LCIA 1VL8A 2UYOA 1R4NA 2HXGA 2Y0DA 1BS2A 2PZKA 3Q5DA 4X3PA 3ZU3A 3WGIA 3DBOB 3ZW7A 4EW3A 4XIYA 4U6NA 4WOJA 1CVLA 1LC3A 4TKVB 2W98A 3KXDA 1DJMA 3GEMA 1F0KA 2DHCA 4A8JC 5C5CA 5F9FA 3AJDA 3EOAI 2OAGA 1U9IC 3Q4GA 4H6WA 4QWMA 1UUFA 3A28A 4FSXA 3DEHA 1E96A 1N9GA 1OFUX 3KJGA 3TI9A 5LL6P 1XRSB 4MCJA 1S2OA 1US8A 3K0CA 4W5TA 5DWDA 3ECAA 2XPCA 4RHUA 3NAGA 4YV1A 5JWOA 4FZJA 4FC7A 2Q2VA 2GJKA 3DTVA 4G86A 3UFBA 3W79A 2EJWA 3HPQA 3VR3D 2WJAA 1J8QA 4IWNA 5H02A 3L84A 5C1BA 3HCPA 3DCYA 4HDNB 3E23A 3SY8A 3RVJA 2PUWA 5CLLA 4AWXA 4UD6A 5EYPB 1KE2A 5YASA 4X3CA 2B6NA 1A2QA 2PYIA 4XFKA 4YA6A 4G0YA 4MVJH 2H5EA 4QXMA 3GLGB 4URZR 1Z0FA 4HFRA 4I5DA 4I9GA 3DFUA 2VAVA 3OURA 3HDHA 2GERA 4FI3C 1LEHA 2C82A 2FZWA 4MGYR 2JASA 1NVVR 1Y9DA 1IEQA 4UTPA 4MLCA 5IC4A 2J5RA 1EDOA 1JA0A 4KI0A 1EJBA 1FU7A 4OJKA 1E2UA 1T6NA 2EZTA 4MYUA 3VSDA 1UDCA 3N2GB 5LR6A 1GA4A 1NI3A 1P9RA 1T9GS 2Q1UA 1E2KA 3FNGA 1DIGA 1VYUA 3NWJA 1C0LA 2CFRA 3DHWC 1V3UA 3TUIC 3K0HA 4JS0A 4YO8A 5B1IA 3UJHA 4CMKA 6Q21A 1CJVC 4LF5B 1KEVA 5LXTA 4EVRA 1D04A 2VJBA 3VTAA 1CEEA 4FXOA 3BJZA 4E1VA 3I4FA 1HL3A 2YC4C 5JO9A 4ENWA 1M6HA 3AM4A 3NGLA 3NGXA 2HXYA 2YBDA 1WB5A 2UAGA 3TDNA 3R7SA 2G8LA 4RV4A 5DLQC 5EHNA 4G1UC 1C8BA 2J3DA 4DW8A 3FOWA 3G5TA 3W9SA 4BFTA 1WPXA 3MTAA 1MQSA 1EWKA 4DG9A 3OMXA 2C3UA 4TQGA 1C8VB 3B2QA 2ZBQA 4RTMA 1TTTA 2ERCA 1XZDA 3C4QA 1KPGA 3RIGA 4C0XA 1EP9A 4D9JA 2P6MA 4MVJM 2DR2A 4I36A 3NBMA 3WDKA 4HV4A 2DG2A 4W5WA 1S8NA 5IYZF 4Z0HO 2PGIA 4ZCRA 5AJVB 2A9QA 4F5YA 2X2OA 2HRZA 1Y8ZA 1S1CA 3MFYA 3MTJA 3AZQA 3O47A 3K2BA 2O8CB 1GKIA 5LZ5A 2BFNA 3VR5A 3K9WA 2X76A 1XEWY 5JSKA 5KDLA 1GA6A 3AC0A 1VL6A 4DUYB 4KHPB 1KSJA 4QFMA 4B3TB 3NTUA 4M89A 3BRCA 1B42A 3S2GA 1H6AA 2JFPA 1WY7A 2GXUA 1Z18A 4U4AA 4FHEA 1JT9A 3KUCA 1JG4A 4R8VA 1FDSA 4B7XA 1UJCA 4M7WA 1DJNA 4K6FA 5IRCD 2NYUA 3AQIA 1JPJA 4ND4A 1O4VA 3L7DA 4MKXA 4LHSA 1FX0A 1JN0A 1V8OA 3FGOA 1S0UA 4YRCA 1N75A 4X1KB 3W90A 2QUKA 3BGWA 4CL8A 3K9FC 1K4MA 2BW0A 4XGIA 1MB9A 1UBRS 2FPLA 2HSDA 4GECA 1FPQA 4U2GA 4URWR 5FFNA 1YHNA 4C0WA 1ISMA 2OHHA 3CG0A 4LNHA 1WDTA 4R4JA 4D4IA 5I7VA 5EZYB 3WISA 1UWCA 4OQFA 1XC7A 3AFMA 1XZPA 1WMFA 3D3WB 4OXXA 4O2AB 4HLCA 2XW6A 4WDQA 1EJ6A 3QI7A 1EESA 3D5TA 2PMKA 1ZN8A 2JLZA 3DAPA 3EBPA 4LPSA 3VI4B 3EB9A 1X9IA 3B9RA 3KVOA 4AWAA 2B98A 2ECOA 3FNQA 3HA2A 3SJBA 1XPOA 1NV9A 4FHGA 5CDUA 2BEUA 1DZ3A 3O8OB 3C3BA 1U28A 1FRQA 3P96A 3P2OA 4J2HA 3HN7A 2FWPA 2OA0A 3TWOA 3UICA 4YMVA 1TAQA 1IQUA 3UGKA 2Z2XA 4E5UA 3QELA 4ZAFA 3ZD8A 1L6IA 4EARA 1DIAA 1LB1B 2GJAA 5A03A 1H4TA 5CFOA 4UUBA 1D1QA 3U3KA 3AK4A 1WBBA 3I9JA 5CAEA 1GCOA 3MIZA 5FL3A 1M10A 2VT7A 5KOJB 3LLMA 4MS1B 4OHFA 4ZCSA 2GXAA 1RQRA 2JLBA 3AY6A 4J7CA 4R7ZA 4Y7DA 1NXOA 1KK2A 3PQ8A 4ZVKA 1XX6A 4Q48A 4BO3A 2F3SA 3AWDA 3KFXA 4BAZA 5JLJA 5CDYA 3LX4A 3IAUA 4LQ4A 1VKRA 2J9RA 4X6LA 1EFRA 5ELMA 5BMVA 1PD1A 2MOKA 5BNTA 1FTWA 3L7OA 4TL8A 4WK2B 2HV8A 3QYJA 4XCXA 5A9RA 4XOIA 2I54A 3L8YA 4J1TA 4M0UA 5AXAA 4G4SO 5EE0A 2QL7A 2WJJA 1DFIA 1NQTA 2LZ0A 2C0QA 1KDYA 3UWOA 1V96A 3Q7QA 4OGGA 1I4TD 3GGJA 5FV7A 2GPNA 4CGZA 1BOOA 4IDNA 4YDRA 3WMEA 4D9GA 2Y27A 1B43A 4FWTA 1U02A 4HNAB 1KQNA 1TJ5A 3DMDA 1R0WA 1YCGA 1IQRA 3W1EA 1Z6AA 3NH6A 3IJRA 3A31A 3QXSA 3NRCA 2VDOB 1Q44A 3P2JA 2CHEA 2CD7A 1OYOA 4J3NA 3E1SA 2BGNA 3L8MA 5EHGA 1K08A 3CZAA 4AZVA 1ESDA 1EU1A 3MINA 1O5IA 4B4OA 1XU7A 3VUEA 2GILA 2O9JA 3WLTA 2IUUA 1RJEA 2OP1A 3RBXA 1L5SA 1Z3CA 2JDIA 2LVBA 4ER7A 3W1VA 1EVJA 4HAUA 5ALYA 2IOYA 1HRKA 1XIVA 2BR4A 5ICFA 2P0AA 4RA9A 2HBZA 4NEQA 1CV2A 3G2PA 3NRJA 4YB8A 1C9YA 2AV6A 1DIHA 2NUTB 3HNOA 5KINB 1CIVA 4L73A 2R4UA 2R84A 1LPAB 3MJDA 5LPNA 1P5JA 1P3DA 1Z62A 4AICA 3UAYA 1JDJA 2NXNA 1U3CA 2M6RA 5DGXA 3VPGA 1E3MA 3MNFA 1K3TA 4YAWA 5C81A 5JAOA 1AH2A 3FCXA 4NPAA 5IVPA 2O2YA 3DEKA 1JS1X 1MNQA 1VHJA 3L7LA 5CB0A 821PA 4YRDA 5D6OA 2HDHA 4XQ0A 2OG2A 1GRCA 2QZJA 2V0NA 4RMIA 1HRDA 1VIMA 1WV0A 2XIQA 3PFGA 2R6FA 1PWYE 2BEKA 1SXJC 2QTLA 3MA0A 1L7BA 1SVWA 4RFVA 1JQ3A 1KAQA 3VPHA 4MW1A 4R8SA 5J5AA 5AD1A 5KQMA 3CEHA 3B1XA 1AS0A 3U9SA 4XZ3A 1B8VA 3CPSA 1RYDA 3GT7A 5DM0A 1EUYA 1PG0A 2BM1A 2JBAB 3I5UA 3SXUA 3WZMA 4RTJA 4CR8A 3JPYA 5D84A 4HMQA 5K9ZA 2BFAA 5DU2A 5HWSA 5KVVA 2H2DA 1GADO 3IOYA 3Q7IA 3NM5A 1E8DA 2W6IA 2F3UA 5AIBA 1FYDA 2R00A 2EW1A 1L5VA 5KYVA 1HK7A 4KQFA 1TTHA 5D1NA 3PDCA 4FOSA 3W2EA 1FRZA 1M72A 4KMSA 1ZYUA 1N5MA 1NMSA 2ZAGA 2RGNA 3DBLA 4Y2HA 5AOAA 1I2AA 4HHEA 4MROA 1L9XA 5KTKA 3H17A 1S3FA 3QQ5A 4LCJA 1Y8QB 3FCSB 4E5DA 4J6EA 1E98A 4ZCQA 2ZITA 1NR5A 3BHMA 2IZ6A 4HUTA 4GPIB 4JNCA 2WZCA 3HDVA 4X0EA 3TGLA 3VKWA 3N9IA 5A3QA 1Z83A 2Q5OA 4QDKA 1CEXA 3DL7A 4YJ3F 3I1JA 3M9WA 3GP5A 3EVEA 1UK7A 3A6DA 1EXDA 5EHIA 4B4WA 3PRJA 1LJUA 2BAGA 1QIIA 3I9MA 4JASB 4LX8A 4CODB 2FMTA 3UJBA 4LJKA 5DHSA 3ZV4A 3WLJA 3UJAA 1HQYE 3WLRA 2RSLA 4EP1A 5C18A 5HK9A 4YV0A 2AXQA 3JX9A 3ZIAA 1CERA 3C6YA 2QGFA 4DLVA 1ZBQA 4MQ6A 5FOSA 2SCUA 4MDFA 1F12A 4D98A 5LP6A 1IK6A 3ZQ4A 1F0YA 3RAEC 4DEVA 4CV0A 3GLIA 1UMBA 1R0SA 2W11A 2XGGA 3UK7A 4A4DA 4WNYA 1HYGA 3ZWYA 4DLZA 5I7SA 4MRPA 1QFMA 3TIGA 2QI9C 1DTEA 1IHDA 1RAAA 1V9LA 1QIJA 3PX7A 1K7EB 4N7BA 1YB5A 1HXHA 1Z33A 5CH3A 5IUJC 4MOWA 3QLUA 1ULUA 1ZHFA 1PR1A 3CKYA 5JANA 4R2XA 4WH0A 2WV9A 2ZRQA 3ND5A 5B1EA 3S28A 3RUAA 1ESNA 2Z2KA 1TVEA 3BE8A 2JIBA 1Z6GA 3LXMA 1QTNA 3A10A 1SAYA 2JZOA 2XUZA 4YBRA 1SWWA 3QA3E 2EX4A 4QGBA 5JXWA 1SHKA 3E5HA 3R0IA 5ENZA 4J2TA 4P8RA 5C8XA 4MJLA 1NXXA 4YFVA 2Z08A 1VYTA 1WHSB 2L19A 3I53A 4V0QA 4XYLA 2P5TB 3ZXIA 1JLMA 2RHBA 4HGYA 1AVTA 4M37A 4BNDB 2O48X 4GZ3A 2HEGA 2VNHA 5KS2A 3K6JA 3ZE9A 4XYGA 1YS4A 1LVGA 3DMTA 4Q34A 3GZTB 4AUKA 3ENVA 4G5RA 4ZO8A 1E3TA 4NCBA 1FUIA 1W48A 3KFVA 4X1IB 4KRXA 3KBOA 3KJZA 4YJ3A 4FMDF 3TUJC 1AQIA 5FUYA 5L8VA 1QGUA 4L6CA 3GJ7A 3TTWA 4Z0PA 5FTKA 4NSNA 4CKEA 2WWHA 3DFKA 2BFOA 3USES 1JFVA 2H1VA 2JJQA 2DCMA 3BXZA 2ZTSA 2DBZA 1PDWA 1E6UA 2VBGA 3EVCA 3LXRA 1E2MA 1VA5A 2GARA 5IBRA 2RHOA 3M6AA 5I7HA 1TZ2A 4R7TA 3TNYA 3GD5A 4RTPA 1VPTA 3B8EA 3OHPA 1SVIA 3VU3A 3HUTA 4LV6A 2JJMA 4YMUA 2Q0QA 3M1IA 3SNKA 1PGJA 4NONA 2EP7A 4KQCA 3PUZA 3MWDA 1NUAA 3EXEA 1ESCA 4ZEOA 4Q3BA 3E03A 2Z2IA 3EEFA 1C3XA 1M8KA 4QOHA 4ZYVA 3IQZA 4KFCA 1BRMA 3BPSA 3DDNA 4M1ZA 3WKCA 3WSVA 2GT1A 4IQ0A 4OYLA 5LA6A 2NMVA 3DO5A 5EQDA 1L5YA 4IUBS 2OZLA 2FN9A 2Z2YA 1GWNA 2VHVA 4MA0A 3IP5A 4Q4DA 5F51A 4F21A 2XITA 3Q1LA 3OFND 4XGRA 3VPFA 4YONB 1O87A 4I50B 2OZEA 1HT1E 1M2FA 3KJHA 4FX5A 3T9CA 1B6RA 4CQLB 4ZVQA 3U6BA 4CKWA 3UT5A 3H04A 3UMJA 1UP7A 2JA1A 3LPLA 3C8UA 5TVKA 4W5HA 3RTDA 2BTOA 5A3VA 1NBOA 2LCQA 3JWEA 2X7XA 3OJCA 4OF4A 5LQDA 1KXJA 1XKTA 3E5MA 1RC1A 3KEQA 1GXSB 1H23A 1ZRNA 1IUNA 1R15A 2YNMD 3DKVA 4ZTBA 4BQOA 4WADA 2I62A 4O4JA 3VR4A 3HA7A 4H0NA 3MCTA 5JXHA 2FZ4A 3DEYX 5IAKA 3U1VA 4RXUA 3V4PB 3U4QA 2FPOA 3O7MA 4KXVA 4PPYA 4QIHA 5ALXA 2RONA 4C4PA 3D3JA 2VJMA 2X8JA 4BVKA 4O3MA 4P93A 1MJ5A 2GAAA 2VDKB 4ZKDA 4C7OB 1JAIA 3AYZB 3DV0B 2AOUA 2RJOA 1OB5A 1GU1A 1XO1A 1N6RA 2ZS8A 4JUCA 5EZSA 1T2EA 3UGJA 2ZBGA 1WG8A 2XF8A 4NYJR 5C1IA 4Z4FA 2AX4A 1WNFA 2CDBA 4LWOA 3E58A 4NPCA 2VHXA 4HBZA 4JXJA 5GGXA 1Y3IA 3AL0C 5CM2Z 4D1YA 2BHNA 4IINA 2Z8YA 1TJ4A 2EW2A 3DXFA 3GARA 3LYUA 3D8RA 4MXDA 5KVSA 1MV5A 2DXIA 2PUBA 4Q3KA 4XI9A 5HHTA 1CDDA 1J07A 1N1GA 2AHRA 5IUNC 3D2CA 2JGFA 2QSYA 3TKAA 3B9QA 3JALB 4RZ3A 1JIIA 5JSQA 4JD5A 1DFHA 1KYYA 1MTOA 3EYAA 3G02A 1P0CA 3LWZA 1I1OA 1ZCBA 3F6PA 2O19A 3JQEA 2DR0A 2XIJA 1X2BA 3FPAA 1VP9A 3JAWA 3K9HA 3OZXA 4ZTZB 1R0RE 5C46F 3MJEA 3O1HB 1USWA 1QO7A 3ISVA 2FN8A 4XVQA 4AJNA 4C78A 1L7EA 3LUKA 1Z5UA 4YXFA 1SCUA 1JFTA 1JHQA 1FYEA 1GU7A 4F4HA 1G3RA 1M8FA 2BISA 4XWWA 1ZCFA 2P5YA 4L1KA 5EXDA 3FN4A 4YUAA 2X77A 2H07A 4IIBA 3ME5A 1RC0A 2JD1A 4GLOA 1UXHA 2P90A 1LTKA 4Q82A 3SG0A 4AJJA 4CWAA 1A27A 3DLPX 1C3OA 1Q7EA 4GW3A 5KWEA 1PTKA 4F86A 3JWGA 5BSGA 1NSYA 2A5DA 4UKDA 4DWWA 1ZC3A 4GO1A 4QLBA 5AM2A 1Z63A 3HV2A 4PLPA 3WIVA 1JHZA 2G40A 3BYZA 1WETA 2CW5A 1HSZA 4N6NA 1CUAA 2OFXA 3ZV6A 3FDIA 3DFFA 5JH7B 1CETA 2ZLBA 3M33A 5ECGC 4LDJA 4S05A 1GT91 1ZLYA 4CQNA 4QYTA 2Q9BA 3OOYA 2E89A 2CHUA 2AUTA 1PJLA 4IY1A 1UFKA 3QVOA 4GOJA 4V0LA 1VI5A 1SBHA 5D3QA 5SZHB 3PXGA 2BDUA 4OHWA 4UNSA 3WVNA 1P8AA 5FX2A 2BMVA 4H6XA 4QGFA 4JEUA 1S3SA 1JWBB 3S8YA 1WF6A 3E82A 3UW3A 2PRZA 1DG9A 5ADWA 3ZH9B 1UKBA 3L07A 5KSWB 1RXSA 1AB5A 4B6FA 5TLSA 1I33A 2LGJA 5K1ZA 5BSUA 2DBRA 1F0PA 4QPDA 5I45A 4J0KA 3A4VA 2JBWA 2MSCB 2ECKA 4N39A 3VGJA 3GR6A 2YYAA 3QFHA 1ELOA 5JOQA 3T4EA 2Q5IA 3TZ6A 4EA6A 2BGKA 5EAIA 3KQNA 1B6SA 2TSYB 2UYHA 1KZYC 4KUHA 1J8FA 2B21A 1GTG1 1IBCA 1AKUA 3GJ6A 2PRIA 2VWQA 5CA0A 3WLSA 3LT5A 5T4HA 3OF2A 1M66A 3HFSA 4ND3A 2A92A 2P4HX 1UFVA 3TNJA 4PHGA 1DLIA 4X93A 2HPVA 3E22A 4K81B 4OQEA 4MCHA 4AF7A 4WK6A 1LXCA 3JY6A 3I64A 4BGVA 4XIFA 2AWNA 4TLDA 2VHEA 5LM3A 3EZ2A 1CNEA 2QROA 1ZOIA 2PSDA 3EEQA 4MS4A 5JCOC 1R9GA 4L4RA 3DCJA 4M49A 3JYQA 5CLQA 1IG0A 3KTOA 1HL7A 2VSNA 1Z07A 4HX2A 2F8TA 1X86B 1M2VB 1W7AA 2DM6A 3LVFO 3GG2A 3TR0A 3THOA 4G0UA 1Z39A 3KWLA 1ZMTA 4PNHA 1APBA 4HMOA 3A06A 3TLKA 3N74A 3SQLA 2FKAA 1VIVA 2FMHA 1TEZA 2XUDA 4TKVA 3RGGA 3LIPA 4IJUA 1Y6RA 1H69A 2O0JA 1IM2A 4HDQB 5JR3A 1XZFA 2CNLA 4YYEA 3DGEC 3SJAA 2VH1A 3TQHA 4GQIA 4JLNA 5JBQA 5HFJA 4TLAA 2VJQA 1TAGA 2AMYA 3EY9A 4JXKA 1WXEA 2H5LA 4TN5A 4XQ9A 2JEOA 4RQUA 2FJUA 2ZVPX 4JL8A 3UG7A 3K5HA 4MYRA 2V5UA 4RIHA 3L6DA 1N6HA 4HXEB 2VHJA 3FAZA 4MW5A 3RHTA 5AVTA 2HMVA 5L51A 5AR1A 4HDNA 1CUXA 2YDYA 4JYBA 1OU0A 3MCVA 5ALVA 4EYOA 4ABYA 5EYPA 1EX9A 2FRDA 2JFVA 4LAFA 5BSHA 2QTCA 5E4FA 1PYDA 1FTGA 2QLLA 4JQCA 3A4YA 5TVGA 1QO9A 3GEHA 3IOEA 3KPUA 4M46A 4WY5A 3OP4A 1AC5A 5LD2C 3LAWA 3EJWA 3TJMA 3ZS8A 4BPRA 3JQ6A 4GRDA 1JFRA 2YV5A 2ZS7A 3EA4A 3RYCB 1Z2OX 3OETA 2WIAA 1SKBA 1RPJA 3ISJA 1SQ6A 1IWOA 4KQGA 4RPKA 4U0JA 5FR1A 2I7VA 3SK0A 1MDFA 2AOWA 1UFQA 2QY6A 2RHCA 3RKSA 1RS0A 4PO9A 3RADC 5HUJA 2PUJA 2Q7DA 3FCCA 5JCXA 1GAJA 3D4NA 4GI5A 1CJMA 5AKIA 4B43A 2BYTA 2RH4A 1W85A 2B69A 2OO7A 3OM8A 3N2GA 4O4IB 5EINA 4D8WA 1JHDA 2EX1A 3SD7A 3CIOA 2ZIXB 1CQPA 2XOEA 5SYNA 1HDZA 1EBFA 3FFWA 4IEIA 2J3HA 4F7WA 3BM5A 4MI6A 3H99A 1JIKA 4DMLA 1BCSB 1G4AE 2MWMA 1LPPA 1SCNE 2QR5A 4GPZA 1XXHE 3ZYZA 1FFYA 1UBSB 2XUFA 2QZPA 3HY6A 4IXTA 2Z3VA 1XD2B 4O2AF 1SRQA 1OWMA 3CX3A 3LKZA 3MERA 4KRGA 5E3IA 1QXSA 4ISBA 4BP9A 5B1YA 1IRXA 1R8YA 3O9VA 3CVVA 2HUPA 1LNQA 1A4UA 1OHHD 1NM5C 1Y9EA 2YZKA 3JVUA 2TMKA 3LPCA 3QV1A 4KGZA 3V42A 4W9NC 2BEVB 3A6JA 3PA6A 1CZUA 4MJ3A 1X39A 3TRKA 1VLMA 3AH8A 1L3IA 3B60A 3GG9A 1ZGGA 2WFLB 4G0QA 3Q15C 5DXJA 4WNAB 2V7BA 4N8DA 4UVEA 1NVVQ 2ZR8A 1Q7CA 3MOIA 5IN4A 4I46A 3PRKE 4TYPA 5DO9A 2PX4A 4AP5A 2C2WA 4HAZA 4W5NA 3ZNQA 1U7TA 4ALIA 2FPUA 5F33A 5IBCA 1RRMA 4YP0A 3H6KA 4GGOA 4QNRA 2Z1DA 4CDNA 4RKYA 1I3NA 1VCIA 4FFDA 1VJCA 2V7QD 2WQ7A 5JNVA 1ZN9A 4Q0MA 2O8CA 4BIMA 3DC7A 4OGKA 3VJRA 2RHWA 4PEVA 4EB8A 2WWIA 1A77A 2XX3A 2CEAA 3I6IA 3PICA 5DHRA 5BXQC 4KCGA 2NYVA 3MK31 5KNBD 5A2QA 3O26A 5AKKA 4OKSA 2WIDA 4M8IA 1IY1A 3GAFA 3V1UA 4ITVA 4P3OA 1A7UA 1GGKA 1QGOA 1NLZA 1A1SA 2P67A 2X9VA 4BNLA 3C41J 1EVKA 2XCSB 3UAZA 3L1KA 3LNCA 3AZPA 4AJHA 3GGCA 4EATA 3LA8A 4X1KA 3NORA 3E9YA 4OGWA 1PE0A 4R1TA 1RXYA 2ZSFA 3DOJA 5CB8A 3ZEAA 1KETA 3AF5A 1KIMA 1NT4A 3OPNA 5F77A 4N1AA 3T1VA 2ZIEA 4I1OA 4JT4A 1SH7A 2FH5B 3E4DA 2CV1A 2V9ZA 5HKKD 1VRCA 5EZYA 2XNKA 2J0QA 3EGCA 3RK0A 5KUTA 3D3WA 3R9XB 3PV0A 5CYOA 1JEDA 3E8SA 1JQLB 3GRFA 3DEIA 2VH5R 3QPAA 4GG1A 3KEFA 2PGXA 3HR7A 3GHYA 3X1MA 1P2GA 5FF9A 2AC7A 2EFGA 3EAGA 4JSYA 3SE7A 3DKPA 3M2PA 1B76A 2IYLD 1L5GB 1L5NA 1GKUB 1HDOA 4C6HA 3H4TA 3OE7D 5E6RB 3O8OA 2Q50A 5CVDA 1O95C 2H1LA 3FWYA 2PG3A 5AQEA 1SCBA 4LF8B 7GPBA 1FK8A 3PCRB 1D6JA 3BC1A 3CZRA 3NBQA 1IU9A 2J33A 3T95A 1XYGA 4DC9A 4PGMA 4XX1A 1E1KA 4OBBA 4RENA 3MGAA 1DBVO 4Q4LA 4EABA 3WQQA 1HMPA 4EL5A 3HMKA 3T8YA 1NXVA 4NS1A 4OHPA 3HVIA 3SEQA 5KOJA 3A2KA 4IH9A 4MS1A 3N8KA 4A6XA 3OUUA 5K0EA 1KVQA 1EVYA 2EP8A 2EWVA 1RLTA 4MK4A 3NXSA 3W8DA 3N3AC 5IT4A 4A1OA 2C5BA 1E3JA 4TLCA 4Y2XA 3U4HA 2H7VA 2XRYA 4BFXA 5M04A 4DV6B 3K16A 4NF2A 1H2AS 4ZO9A 5CFZA 1ZUHA 2WVAA 3H65A 4QZVA 3KDPA 1F14A 3MXOA 5HIJA 1PBNA 1L7RA 3MCZA 5DKFA 3UK0A 2I7CA 4DJDC 4D41A 4HGPA 3GPDG 1GZ7A 2BH9A 3IP9A 3EOZA 3HXPA 1H0HA 4LV5B 3RJMA 1SY7A 5IFKA 4EBBA 3VPCA 2JFUA 3U7GA 1OX6A 3D3EA 4CCAA 3OFNA 1P2VA 3U7HB 1UPAA 1HT2E 1NX6A 1JKXA 4FDUA 4MUFA 1VYVA 2Q5HA 2V6GA 1DC6A 3BTSA 1DBQA 3PE4A 4HNAA 4D9BA 2ECQA 5B58C 1FP1D 4AQDA 5GINE 1SXHA 5DVZA 3RK1A 5F98A 1AQJA 1D2MA 2HWKA 3EUEA 3OUZA 3ZE6A 1K1EA 2EKLA 3R24A 4AS1A 1TKBA 3N2ZB 2LPMA 2P4SA 3TEFA 1J06A 5BUSA 3BMCB 1TO2E 3C6MA 2B8EA 3EULA 4MRAA 2PVSA 2FOLA 1DC5A 3HDJA 1TT5B 2BM0A 1ZNQO 3F97A 4RMGA 3WYBA 1OA1A 1Z4PX 1LTHR 1TVKA 2ZJOA 3ZGNA 2CDAA 1VMIA 4UDYX 2QD3A 5GONB 3ZOKA 3ES9A 1IHOA 1JR3E 4V2UA 2NUTA 2F9MA 4GIBA 4HAXA 4QTZA 3ANNA 1RWOA 3E9CA 5EHQA 2FCRA 4BU1A 1E1YA 1X8LA 3F4KA 3ZWCA 4DCMA 1E2BA 2CCKA 2VNJA 3F7OA 2V7GA 3OIVA 1E62A 3BA6A 2QTAA 3HWSA 1INLA 1MEJA 1NMEA 2PRKA 3IT0A 4IEEA 4Y6LA 2X7JA 4F8JA 2W48A 1F4VA 4OTZA 4BNXA 1YKFA 1O4WA 3PIDA 1H2YA 3W7AA 4UUAA 4TLBA 4B6QA 3EVBA 2WDPA 3K0FB 3RWBA 4MUJA 1W47A 4KO4S 5IHXA 2O8NA 4B2LA 2KPOA 1IZ9A 3VI3B 2AKYA 4XOUA 3TQIA 3A7DA 5F9MA 4BN4A 1UC9A 1JQJC 3MRVA 4PLWA 3OCUA 1X42A 3RT1A 3QE9Y 3QUSA 4MAAA 5GTDA 3ETLA 3DZKA 4GOKA 4R2LA 4UNIA 4HVAA 3OQBA 4MYCA 2OORA 2A8YA 1B41A 3K9NA 2JBAA 4RU1A 2V03A 5DGHA 3B2EA 5DI9A 3ZV7A 4NP6A 3D3NA 4ZK6A 5C8YB 1V71A 1FRNA 4H6VA 3VZSA 3ZXXA 2PN1A 3NHJA 5D3MA 1J33A 4DC0A 5CIQA 3T3PB 1I3MA 1MZVA 5CB6A 1G8JA 2BUCA 3GW8A 4CIAA 3HLKA 4W1SA 1BA3A 5AJXA 4ENSA 4WECA 2I4NA 1E6MA 3IMFA 1QE3A 1HKHA 3B70A 1J22A 5CM9C 3RSLA 1OPRA 1U80A 4DMCA 2OPBA 2VUTA 3KZMA 3QF4B 5T8KA 3RVLA 2OXCA 8GPBA 5LQKA 4J1QA 5IZCA 2H4JA 3RU9A 1HYQA 2OMEA 3PEUA 1NOJA 2PD3A 1F6BA 3LI2A 3LYLA 2HNAA 2VJPA 3UAGA 4JR0A 5BSEA 1GNLA 1GPMA 4IZIA 5FWDA 2EBUA 2O54A 1TM7E 2WICA 2A6PA 3NEAA 4KHZA 5KNCD 4KB5A 2X5NA 4L22A 2YZGA 1AZTA 3L0DA 5CH5A 4RVUA 4HGZA 1YRWA 2FE4A 4B81A 1FFEA 2HNBA 4OV6B 2A4KA 1KMQA 3H9BA 2EDCA 4ZPXA 4BZXA 2YQZA 3AEXA 5A4AA 1QONA 3DJYA </