3RVRA

Structure of the cheyn59d/e89r molybdate complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
130
structure length
130
Chain Sequence
b'HMADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
molecule tags Signaling protein
source organism Escherichia coli
publication title Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.
pubmed doi rcsb
total genus 47
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rvrA00
1F4VA 3C3MA 8ABPA 3CHYA 2QU7A 4XASA 3JVIA 4MPTA 1ABFA 4S04A 5JS2A 4YWHA 1S8NA 1RZRD 1Z13A 1Z2DA 2HPHA 3DZDA 4N47A 2PL1A 4XARA 1DBQA 4UHJA 1QMPA 3RVQA 2CWDA 2JBAA 4IILA 3H1FA 3H6GA 1L5ZA 4MS3A 4RSMA 3C97A 4Z4FA 3O74A 1EWTA 1D1PA 2M1ZA 3OO1A 5EWMA 5FWXA 1DC8A 4JAVC 3I5AA 1SXGA 5IEBA 5JNUA 3QX8A 2E4YA 1EWVA 2FQXA 3GWGA 4LE1A 5FBHA 5TPWB 3QLTA 2QZJA 1RNLA 4TMYA 4YCSA 4KK4A 5FWXB 3HK2A 2IDMA 2RDMA 3K4HA 2FVYA 2RGYA 3BRQA 4OG2A 5ABPA 1YS7A 1BDJA 4IGAA 3HJFA 5JNWA 3E3MA 3QEMA 1LJLA 2NZVG 2L19A 3D02A 3TO5A 1U2PA 3P9YA 2E4XA 3H5VA 5KC9A 4LDAA 3TMYA 1YVUA 2CHEA 5KQPA 4TLMB 4HYEA 5ED4A 1ZGGA 3IPAA 3KYIB 2L2QA 1JL3A 4E7OA 1PNTA 2FKAA 3M9WA 4KK3A 3JVDA 2FEWB 1JF8A 5EWLB 4ETNA 2MYNA 5KQMA 3T38A 4P1ZA 4EVRA 2YHAA 3M9XA 1PEYA 4WXEA 5DCLA 1NXSA 1P6UA 3CTPA 1OXBB 2LUOA 2P4UA 3OQNA 2BGGA 3OQMA 3FMVA 1M5UA 3H5OA 2MYTA 4G97A 1JHZA 3CG4A 1MB3A 4LDZA 2VUIB 3JS5A 3OM1A 3RVJA 4EYKA 2HQBA 4RKRA 1F51E 4RK5A 3G85A 2WJWA 4KQ9A 1TLFA 4HNQA 2LIVA 3OMXA 2OQRA 5DLEA 5IEJA 5T7BA 3H75A 5IC5A 1QP0A 2WMYA 1ISRA 5CNJA 4KVFA 3MQ4A 1E6MA 1NXXA 4E7PA 4MGEA 1ZH4A 4EVQA 2PMCA 4OBBA 3EQZA 4MS3B 5D2CA 5JS1A 2Q5CA 2E4ZA 3L6UA 1J56A 3KYJB 1B00A 5BQ3A 4RZSA 4WUTA 4D6YA 2MSWA 4YS6A 4L85A 2NZUG 1JDNA 4RY0A 5T3YA 4RDCA 3HO1A 3CZ5A 4PE5B 4NCAA 3QLVC 3CFYA 1BDIA 1E2BA 3T6KA 3L49A 1AB6A 5KC8A 1JX6A 3A10A 2L18A 5HSGA 3RQIA 3QEMB 3IP5A 3EQ2A 3HDVA 5DKFA 4RY9A 1E6LA 4G0QA 2JVJA 1USKA 1LBHA 4L4UA 3KHTA 3SM9A 3BILA 4PYRA 3ROFA 3FDFA 2P9HA 4MS4A 3HV2A 5FWYB 3RVKA 1EHCA 1K66A 2ID7A 3C6QA 1ISSA 3LFTA 4MRMB 4XFKA 3EDCA 3N0XA 3OQOA 4N41A 3URMA 4F06A 2WRZA 5HQJA 1ZVVA 1GCGA 1XHFA 4IMIB 3LUJA 3RVLA 1JLKA 4KFCA 2FEPA 3MF4A 3ILYA 1U0SY 3QLUC 4JOQA 2H0AA 4YO7A 1Z16A 3Q9SA 4NICA 2E4WA 5EWLA 2CHFA 4LX8A 1SXIA 3SAJA 1RXEA 3HUUA 1HEYA 1DRKA 2FSPA 4F3TA 3DLBA 3I09A 4MR7B 2PE5A 1MIHA 1XHEA 4EGSA 2FMHA 3KS9A 2FMIA 3IP7A 4XLTA 3RVOA 1DBPA 2MYPA 4Z4EA 1Z26A 2JRLA 1ZY2A 4H60A 1UDRA 5JNSA 4ZJPA 1C4WA 2LP4Y 2JCGA 1D5WA 3EJWA 1CEYA 1TJYA 3JPYA 1JYFA 2B4AA 3CG0A 3HEBA 4QYMA 4QICA 1JFSA 1VKRA 2PLNA 2IPLA 2E4VA 1JFVA 1ZITA 1TVMA 4YRZA 1DJMA 4RWEA 2WY2D 3BRSA 3I42A 2MSKA 3HZHA 1FFSA 5KI6A 1ZGZA 4RK6A 4GNRA 4RS3A 1QP7A 2E4UA 2J48A 4QPJC 2GWRA 1JDPA 3OLYA 2ID9A 4MR8A 5B3JA 1NXPA 1NXTA 3NHZA 4FE7A 4G0YA 4JB0A 1PEAA 1GUBA 3EGCA 1GLGA 1QQBA 1DCMA 2A9PA 3Q7TA 1K68A 4KQCA 2R4QA 3N6VA 5TQ2A 2R48A 1L5YA 1FFGA 2M98A 3QLUA 3F73A 2TMYA 5GQSA 5PNTA 4MS1B 2QSJA 5IUNC 2YHBA 1CYEA 4M88A 3D8UA 2JK1A 1DP4A 3B2NA 1T34A 2GX6A 2GKGA 4PZ0A 2NT3A 4MS1A 4RXUA 4ZPJA 2JVIA 2I6FA 1NXWA 4D74A 2OENG 3F6CA 2PUDA 4FB4A 1C0EA 3LUAA 4KREA 5JNTA 4O1IA 4S05A 1QNLA 4EYGA 4Z4CA 2L17A 2QV0A 4MYRA 4Z9BA 5I4CA 3KJXA 1Z18A 3EULA 3LUKA 3DGFC 3MM4A 3O1IC 2AYXA 3OLWA 1FQWA 3NBMA 4RY8A 5BRAA 2JVKA 3H5TA 4DQDA 3UUGA 3T95A 4MR8B 1JBEA 1DBWA 4G0MA 1YMVA 4DN6A 5JNRA 1D4ZA 2FTKE 4O5AA 4ZMSA 4Z0NA 4JP1A 3Q7SA 3MA0A 2FQYA 2IYNA 2A9QA 2JB9A 4OTZA 4Z4HA 5HKOA 1QP4A 1Z15A 2WJAA 2KYRA 3RVPA 3NNNA 1P8AA 1NTRA 4Q6BA 3H5LA 3Q41A 3LKBA 3NHMA 3ROTA 1Z17A 1D1QA 3T8YA 3Q15C 1A2OA 2IOYA 2JBAB 4WXMA 5TPZA 3KCNA 3HXMA 1ZDMA 1BDHA 4NQRA 1PUXA 1BAPA 4TN5A 4F8JA 3QELB 4QYWA 4Z99A 5DTEA 5FBKA 5KQGA 3NNSA 1EAYA 3N0WA 2ZAYA 2HJ9A 1RXIA 1RZRA 1YK1A 3QELA 4W5NA 3CRNA 4RK1A 4ETIA 4LE0A 4YP9A 4KZKA 3OLXA 5TPZD 5F64A 3A0UA 2PUEA 3A0RB 3DBIA 5GOTA 3KLOA 3KG2A 4RKQA 1QPZA 5IX8A 1A04A 3LUCA 4YR7A 1QKKA 1SRRA 3CKMA 4H3KB 2R25B 4EYQA 5IUKC 3OLVA 3O21A 9ABPA 4EYOA 1VPWA 2FXIA 4MS4B 3JY6A 4KRFA 1E6KA 3Q7RA 1U04A 1DRJA 2R47A 3OM0A 1QO0D 5BRJA 3GRCA 1WETA 3DLHA 1P6QA 4ZYLA 3GT7A 3HDGA 5KQLA 4MRMA 4MR7A 3NNDA 1LK0A 3GV0A 5E3JA 1FSPA 2V0NA 5C5CA 4IMJB 5HM6A 4TLLB 4Z9AA 1SD5A 2MSLA 5TQ0A 4G0XA 1DZ3A 4W5RA 3C3KA 3E61A 3SG0A 1NXVA 2F8SA 3KKEA 4MAAA 1P2FA 3RVMA 4HNSA 4MLCA 3UK0A 3M6MD 4NV3A 1ZHHA 3N53A 1I3CA 4YGXB 2VK2A 6ABPA 1APBA 4OLAA 5CHYA 1JH9A 4MQEA 3SY8A 2HQRA 4RK0A 3TB6A 3VNAA 3CU5A 1KRWA 1W25A 3MYYA 5TPWA 5C5EA 1A0OA 3CLKA 5JNVA 3H1EA 3KTOA 1YTUA 3H5WA 1NATA 1ABEA 3O75A 3O2JA 2PUCA 2IPAB 1Z25A 1YIOA 1KRXA 3FFXA 4LE2A 4KPYA 1JWLA 1Z12A 2PUAA 3LUHA 1SXHA 3OLZA 3RH0A 3O2SB 4OLBA 4P98A 1VLZA 2PAFA 2IPNA 3RVRA 1JFTA 4Z4IA 2IPMA 3QLVA 1ZESA 2DRIA 2RJOA 4MR9B 3HVRA 3EODA 1XWWA 3O1JC 2WWVD 4D6XA 3CNBA 3O1HB 4Z4GA 2GI4A 3N75A 4OATA 4YV7A 3H6HA 5IULC 1IIBA 2H3HA 5TE9A 3F6PA 4EVSA 3LMKA 4XXHA 3HUTA 2HSGA 3HSYA 3LUFA 2PUGA 3GYBA 3SNKA 1URPA 1PHRA 2NUBA 2WB4A 4LRQA 1RPJA 2O20A 4JA2A 1GUDA 4RK7A 4RV5A 2VUHB 3K9CA 3R0JA 1PNRA 3H1GA 4KV7A 3GA5A 5CNMA 3IPCA 3MIZA 4PICA 1TM2A 1NY5A 4W5OA 3N0RA 1BVHA 7ABPA 1NXOA 2QVGA 1USGA 3TX6A 3LKVA 3DGEC 1YS6A 4N0QA 3RVSA 4W5TA 3LTEA 1U2QA 4G0OA 3C3WA 4Y9TA 5EWJA 1OXKB 1W9HA 4F11A 4JB2A 3EAFA 2FMKA 3S99A 2FLKA 2PKXA 3GL9A 1AB5A 1VRVA 1YK0A 2B1JA 4RXMA 3IP9A 2PJUA 1ZN2A 5CNIA 1DCKA 2RJNA 4YLEA 4CBVA 2FN9A 1MB0A 2GBPA 3F7NA 1MVOA 3HS3A 1TMYA 3I45A 2LBPA 3G1WA 4UHKA 5IUJC 4B09A 4Q6WA 4N76A 5EWMB 1QO0A 4NCBA 2MYUA 2FN8A 4IRXA 3OMWA 3ILHA 1EFAA 4Q7EA 2FLWA 1Y1LA 5TQJA 4DADA 1KMIY 3RVNA 2FQWA 3UKJA 4G0PA 1U8TA 4FE4A 2W42A 3GBPA 1KGSA 3HCWA 3FGZA 4LZLA 4RXTA 1JYEA 2XDYA 3O2QB 4KNYA 1BA2A 2QVCA 3LUGA 2PUBA 5KWSA 5CNKA 2CD7A 1EWKA 4JASB 4G0ZA 3FFTA 5B3JC 3HM9A 3FFWA 1M5TA 4G86A 1YMUA 4MLDA 2FW0A 5EWJB 4F12A 3GBVA 4ZMRA 2HQOA 2X7XA 4HNRA 4KMRA 3LUDA 3QX9A 3OO0A 4N03A 3VNBA 6CHYA 2PUFA 3KSMA 3CS3A 2A9OA 4WWHA 1Z2EA 4RK4A 2F8TA 2LPMA 3LOPA 5TQ0B 3BREA 3N8IA 4O1HA 1R8JA 1D2AA 1LJUA 4W5QA 1DG9A 1M2EA 2IKSA 1DC7A 4WZZA 1ZAYA 2FEKA 1CHNA 3W9SA 1DCFA 4PEVA 2ZWMA 3CZCA 4MR9A 4MQEB 4MQFA 4EY3A 1M2FA 2AYZA 5FWYA 3KLNA 4N0PA 3SQNA 3JTEA 2N9UA 1FFWA 3MMNA 4GPAA 4MQFB 1MAVA 2QR3A 3IP6A 3BBLA 2VYCA 2NT4A 1H9CA 4H3HB 2A9RA 2PL9A 1USIA 3H5IA 2FMFA 5TQ2B 4ML3A 5BR1A 3IDOA 4IF4A 1LBIA 5IBQA 3JPWA 4WT7A 3TD9A 4EUKA 3QEKA 1ZH2A 3A3KA 4RU1A 4XAQA 5DGCA 4ETMA 2QXYA 1GCAA 3QK7A 1QQAA 2QW1A
chains in the Genus database with same CATH superfamily
2W48A 1Z0IA 3A6FA 2H8KA 4JLOA 3L7KA 3NWEA 4V0MA 4XYMA 4Q37A 1ZK4A 2HUNA 1ZJ6A 1G2QA 1L3IA 2VIIA 1NIPA 2DWCA 3E3AA 3OZWA 4MKGA 5TNXA 1RAHA 2PGDA 3ZEAA 3VNRA 3RV3A 2VPYA 4ZVVA 1OZFA 3HDTA 4A8HA 3WO1A 3PKZA 2F43B 4PGGA 1O94A 1KY3A 3H5AA 4X9XA 3TOVA 1NPDA 1DC8A 3WFJA 1CF2O 3ZXYA 3BQNB 1O8CA 2VHCA 3GFRA 3K9LA 4LGMA 5C7IO 2REOA 4C7OB 2Q29A 4HPJB 3FZQA 1V11A 5BYBA 4V1CI 1B14A 4UCWA 2PGJA 3EGXB 2UKDA 3KKNA 2TMGA 1ZIXA 4JIMA 1R0RE 3O73A 5THKA 1C8LA 2Y1CA 4B76A 2I7VA 3E3LA 3HN6A 3AVXA 1DLJA 1NNSA 5GTDA 2L19A 2OR3A 3DHVA 3ZGOA 2ZYHA 1CP3A 1UXIA 1VJ5A 1XT6A 2XKJE 1HYHA 3RREA 2WOOA 2ZRIA 4MV0A 3SYNA 4DG9A 1XRLA 1V1MA 2XUZA 3UJHA 4CMHA 1SUBA 3TW8A 5HIKA 3LWDA 5K5EA 3FYTA 5E7MA 4LFCB 3CR7A 2BFMA 3H9GA 2AMLA 3M3PA 4MVXA 2FPPB 5AD1A 4Z5XA 2E18A 4GP9A 4HRVA 4E7OA 2FZEA 4MWEA 4BEJA 1XMJA 5E1OA 1NOKA 1YA6A 2CL5A 2GMWA 2GRJA 1JDBB 3LBFA 2Q28A 2FP4A 2ZROA 4LXTA 2ZT8A 3ISJA 1OKKD 4YAJA 4GI1A 1DBSA 2FFJA 5DBIA 3WSWA 2W0SA 2WQ6A 3NBQA 4DF3A 1VSVA 3OX4A 1N5LA 5ICMA 5KS2A 1GAQA 3MT9A 1VRCA 1GAXA 1Z29A 4KR9A 3KUXA 3SLKA 1RM4A 4JVMA 2VJYA 1V7QA 3OSUA 4YRBA 4KIJA 1G16A 3DVLA 2GNAA 2WD9A 4E5SA 5KCZA 1DIBA 1NKVA 3O26A 4JA0A 3TPZA 1Z88A 1PQWA 4HZUA 2PTGA 1M34A 3H0CA 2WPNA 1ORVA 1Z33A 3DKKA 1U0BB 3V3KA 2D4HA 3SHVA 4BO4A 2ZAMA 5CPFA 2B7LA 1YRBA 2WTAA 3DT9A 1IXKA 1H2EA 5JRJA 3OWHA 4TMFA 2Q21A 3SDZA 1NBWB 3W7VA 4C0LA 5JQGA 1PZNA 3NM6B 2YXDA 3RCBA 5K8TA 4AMVA 5DXJA 4BDTA 4QYIA 3VPAA 2EX1A 2FH5B 5WRFA 4Y2QA 1BRTA 2NAPA 3O47A 1ULBA 4KVFA 1H6AA 3V9AA 4B43A 1E6MA 1N75A 3CVOA 5JRDS 1KKUA 4PLPA 4BJ1A 4BMZA 1JPVA 2QGZA 2FMUA 1JHUA 4AP6A 1P2DA 3ICEA 1SIBE 1E98A 1HT3A 2C03A 2JBHA 2PGIA 4Q3BA 4RL6A 5FOQA 3TLBA 2VAPA 5DM60 3LLCA 1T0UA 3IT0A 5CBPB 3GT0A 3NT5A 3FBWA 1GFZA 1USVA 1DAEA 3U26A 4H7PA 1UBUS 2PBRA 3MWKA 4R8SA 1R6XA 1RAFA 1CQIA 2C9ZA 4K6KA 3PD7A 1FFHA 3HKDB 1UMCA 4J0DA 4F4CA 4C43A 1M6WA 2G0TA 3ND5A 5DKFA 1VFNA 4Q4CA 2KQUA 1ZIYA 4N0MA 1TEXA 4PRZA 5J4KA 4MVCA 3TE7A 1V9SA 1Q1NA 2O2JA 3BILA 3AIIA 3REQA 2QV7A 2FOIA 2PX6A 2ZOSA 2ZRQA 4CEJB 2HJVA 2AA3A 1RXYA 2KHZA 4HWSA 4E33A 1JXQA 5G2OA 1AQIA 1C0IA 1GHTA 1H6CA 2WE7A 3ORSA 4X6XA 4HDQB 3C3DA 4M7OA 4WINA 1LK7A 1U0LA 4YJGA 5CA0A 3QEBZ 5LZ2A 1DKQA 4DV2B 4LOJA 1UWVA 2CVQA 3EEFA 3P20A 4EAAA 4ERNA 1XKQA 3K1AA 3QWBA 3VJLA 3BCRA 5LVAA 5ALXA 3L40A 2ZJ7A 2JFUA 4RIIA 2EFYA 2CUTA 3HNPA 4MOWA 4YO7A 1ODCA 3Q9SA 2ANBA 4G25A 2E4WA 5F1OA 5ISMA 4DANA 1RXEA 2YV3A 4YP1A 2PSEA 2XADA 2ZPUA 4ANFA 3GRRA 1ZGAA 3KEOA 4EO4A 1UK8A 3HCEA 4EGSA 5G4KA 2NGRA 4RPGA 3KS9A 3R9XB 4NZZA 3ZHRA 3EQ7A 2Y0DA 1TEVA 4RQAA 3N2YA 1C30B 2RGAA 1KFEB 1P1HA 3VDXA 1B2LA 3LPDA 2INGX 3EVFA 5KJ1A 2XCUA 3BVPA 1RRFA 1D5WA 1FUEA 5AH0A 1L5SA 3DXXA 1OFUA 3QF7A 1IRIA 1V8PA 2HSEA 2QYSA 1IZZA 1NE2A 3HEBA 3SK0A 3OESA 1X8JA 3RWOA 4LRWA 2QUHA 4GRAA 1GAEO 2QQFA 4FP9A 1Y7TA 3ZH2A 3HCOA 3JQBA 1XXLA 2CXQA 4S24A 2CF6A 1AUXA 2DPHA 1MJFA 1O6BA 2WFMA 2JGLA 3NBFA 1BMTA 3HLTA 5B1SA 1KO4A 4COOA 2D7DA 1M7BA 4YJKA 2BTOA 1A95A 1BS2A 2I99A 2I5PO 2IE0A 2JCXA 3NAQA 1GZ6A 1ESMA 2IKQA 2AQ8A 1AQ6A 3BHIA 3CF4G 1CIVA 1HRKA 5FRDA 5PGMA 1HKHA 3ZY4A 3EXG2 1NXPA 4CHTA 1FP6A 4KVZA 4JB0A 1Z39A 2EQBA 2VSOA 4ZALA 4XEHA 1X3LA 2QD4A 4PLGA 3EXG1 5BN1A 2OBYA 3R77A 4UNPA 4OPMA 5J47A 3ZJTA 2GXUA 3RS3A 1CJVC 3WYNA 3R7WB 5H0IA 5C51B 1FFAA 4CT5A 1QHFA 4M8KA 3FUVA 3X1DA 4EF6A 1G8HA 1NY6A 2BGKA 1F4PA 1FSFA 2QR5A 3OUTA 4KV9A 3AERB 4KJZA 1AN9A 2AFVA 4LCEA 4MQMA 3B3AA 3CZAA 4CM4B 4RSGA 1L7DA 1S0UA 1ANKA 4MGZR 3UBTA 1OBHA 2BGTA 1INLA 1S2MA 1CWUA 2JLRA 2IXBA 3G9TA 4FQ8A 2J46A 2F3SA 3PQDA 4N5NA 2IY7A 1G9TA 1PFGA 3Q9NA 3LQ4A 1PG2A 2BFAA 2YIVX 3JRXA 1P5FA 3LOQA 3KX2A 4GH5A 5AJXA 3D6UA 1SOMA 2IYLD 3M1YA 4XIJA 1MTZA 3O1IC 2GILA 4LQLA 2I6UA 4K9RA 1U80A 1TYCA 2ZYRA 3AUJB 5JAPA 1P4GA 2H06A 3ZVMA 4YAOA 3BD9A 1CT9A 3S2ZA 4BNYA 1DBWA 1NQXA 4EABA 5FA8A 4P4GA 1G4AE 3ON5A 3FUCA 4DW8A 5JNRA 1ZM4A 2YJZA 3ANTA 4RABA 3CSDA 1X1SA 2UXBB 4Z0NA 1M5RA 2ACWA 1R10A 3RUIA 3AMVA 4YPVA 4EG6A 1MAHA 4WD3A 1OAOA 1LX6A 3CCCA 1YRAA 4OQEA 1UBFA 4II2A 3D6NB 3C5EA 1PSZA 2QDXA 1FJ2A 2R1UA 4JL8A 3W6OA 4FKMA 3I5UA 4RC9A 4CU2A 4TLDA 4UXIA 1QE5A 2DSTA 1QTNA 1XL0A 1U3FA 1PX2A 1RLUA 1NJSA 3FWKA 3LNCA 4G63A 4KKVA 4UD2A 2PX0A 4C08A 1JH8A 3KCNA 1CPYA 2VHYA 3FSEA 1RRKA 1RKVA 1YJBA 2O48X 1YI8A 1T2UA 1KY2A 2JLCA 3H4IA 2FHSA 4KUHA 2PX5A 2Q9CA 3LSTA 1TEHA 4TN5A 3SHFA 3W8DA 4LW8A 1C0PA 3QELB 1L5FA 3NNSA 3N74A 4YRKA 3L4EA 3D54D 1N2EA 4RJLA 1HPLA 2BJHA 1LSSA 4OF4A 3WA6A 1T5LA 1JA0A 1ZD3A 2BFFB 3QXSA 2D5AA 1Z6YA 2HMWA 2NZXA 4MUGA 4UM5A 5E38A 3RTGA 5CXUA 1R00A 5B58C 2P9YA 2HJRA 2MT9A 2Y67A 3LWNA 2BGMA 2LR0A 2Q8PA 3OAAD 2HBQA 3PUYA 4NBSA 4D1YA 5CH8A 4H6XA 4KKXB 4OMDA 1SPBS 2ZITA 1SRRA 1NVGA 2R11A 4N0EA 2R25B 4UCXA 3OLVA 2XYVA 1O97C 2Q5IA 3QPBA 4LJYA 2GCOB 2XLBA 4MS4B 4C2AA 3RSZA 2VI5A 1Z75A 2NQ2C 1AKEA 3M8KA 3CZMA 3HGTA 1E2MA 3K2EA 1DJPA 4J29A 1Z3CA 2XQFA 4QGAA 3AR2A 3PXAA 4UE6A 2C92A 2ERYA 3M49A 1K7YA 3JQ9A 2QM3A 5FNVB 1AKQA 2JAUA 1UZNA 3UKOA 1Z0SA 4TLLB 3OCJA 2RMKA 4XCXA 3ESQA 3FYDA 1SO8A 3AH8A 4LXUA 4PS1A 4QOEA 4B7CA 1Q12A 4N6OA 4QFBA 3E61A 5GY7A 1CF4A 5T4HA 5I3ZA 1GZ5A 1P2FA 3OY7A 4D56A 3D8BA 1E7SA 3R6GA 4JBIA 4P32A 2PSHA 4WY2A 4MRPA 1D2GA 1T25A 2CJPA 5CDTA 4YAIA 2QTFA 5JZOA 3C8MA 4P38A 1KJIA 2XOXA 1KRWA 3VGPA 4B4WA 3AR4A 3V4LA 3VDMA 1NONA 1A0OA 5C5EA 1ZHFA 4TRNA 3CRVA 2ODQA 4WCFC 3E9DA 2PK3A 1RVV1 3HVKA 4KEAA 4CLHA 1NM5C 3AERA 3NWOA 4CM4A 1Z22A 3GFBA 1AHPA 3PC8A 3ZGXA 1HV8A 1X15A 3IRVA 3N2IA 4IZHA 4ZODA 2WDZA 3IOBA 5FHQA 4B6FA 5E0OA 3PHHA 2PZFA 3OLZA 4TLBA 4YMLA 3LGAA 5KTNA 4J7CA 1DCTA 3ROMA 3RJMA 4ZKDA 3TLJA 4JCOA 1G1AA 2IXAA 4HGQA 5B1IA 3OZSA 3QLVA 1D8TA 1G18A 3TLCA 4L6CA 1VG9B 4G0VA 1TVKB 3O1HB 1F60A 5FFMA 1GUZA 3BSWA 3KKQA 4GC9A 2J5QA 2ATXA 3B3GA 3LC0A 4PG4A 1ZD8A 2CEAA 2PVSA 3K1JA 3PPWA 2G4VA 1C1DB 2ZYSA 3NTUA 1RWXA 4O2AA 3GYBA 3I01M 5T4FA 1CR6A 3V1TC 3VAZA 5ENDA 3HXQA 4CCYB 4UTVA 1CDDA 4P92A 1JFFB 4NK4A 1SC6A 2V97A 1J09A 2XUAA 3EAGA 2X1MA 4H08A 4HWKA 4N6GA 3BZWA 3UY4A 4ZQBA 5KNDA 1PNRA 4I9UA 2FG5A 3B2QA 1U9CA 3ZCUA 2UZIR 1XGKA 2O7NA 4UE2A 2H54A 3DAHA 1YONA 2R7KA 4U6SA 4AX8A 2GAOA 3JRWA 1C3XA 1Z6XA 4KQEA 3DAOA 1W9HA 2C96A 1R8XA 2WPDD 3BOSA 4C76A 1WZIA 2XGOA 3ABRB 2B21A 2WM9B 4AJNA 5BWMA 1JQDA 1U0JA 4UDYX 3OCCA 1X9IA 2GM9A 1RYMA 1RQ7A 1UDBA 5EIFA 4D9NA 2G3YA 3TLGA 2JLXA 4HYTA 1DJNA 1ZN2A 3AX6A 3HBJA 3UXEA 1E3DA 4YLEA 4YTEA 3FJOA 3UH0A 3M5DA 1ZUWA 3IV6A 2R1TA 3FLAA 1UBCA 1NI3A 2JGIA 3DAYA 3DVQX 1XFDA 2ZM5A 1IY2A 2HV8A 1XZFA 5JSQA 2VRNA 2FW6A 4LYAA 3JYHA 5FXMA 1YT5A 3U7HB 1FYVA 1O1YA 1Y1KE 5J58A 3ZZ0A 3UW1A 3HU2A 4KGXA 1KC1A 2PFGA 2X40A 4UUMA 3I8SA 3RYIB 2FFBA 4JNCA 2XITA 1FTWA 2R6DA 3KDSE 3I1IA 2XQGA 4H1WA 2RGRA 2Y1OA 1E1DA 2IK8A 1H3FA 4TMKA 1ISPA 2FDXA 4JASB 4OJNA 1JKJA 2IA5A 4BYMA 4BEWA 1IUOA 1TCUA 1T5DX 1JDUA 2ECPA 1QRDA 4YUYA 1J22A 1A97A 5J43A 4EPYA 3JALB 1UMBB 1DEOA 1DPFA 3NETA 2X1VA 2HMUA 3OTHA 4G86A 5IVHA 2AZMA 3CUEF 3ZDBA 2O7RA 3OIUA 4Z3DA 2G36A 2ZS7A 2XMBA 3BWBA 3LM8A 1ADJA 2WWWA 2DTDA 3CS3A 3PEEA 1OGIA 2WTEA 2WTBA 3FYCA 3P0EA 4NYIQ 2YY7A 2IV7A 3TBFA 2LXNA 4EKYA 4YVFA 2PWAA 2VUSA 3TWOA 1WBBA 4NDAA 1M2EA 1UP4A 2ZRAA 2YX1A 2YN2A 3FOWA 2NAFA 3B1FA 2HF9A 1EUQA 2E4AA 3SXPA 2IH2A 3HVJA 2VHQA 4D9CA 1B23P 4EPXA 3K05A 3QWHA 1GT6A 3R8XA 1LLDA 3VBEA 3GAFA 1B7GO 4Q0MA 4BV8A 1VHDA 1RLTA 1OI4A 4JB8A 2EF1A 2N9UA 3L8DA 3DONA 4UEQA 3M6WA 4JLVA 3IP6A 2JGRA 3BBLA 4KLAA 3LT1A 1ODIA 3ISVA 2WINI 1NW6A 3KLMX 2RAPA 3D8RA 4OUDB 1J5XA 1A71A 2WIBA 1EGMB 2AGVA 4YI3A 1R0XA 3EH2A 1PTJA 3Q0IA 4KQIA 4M36A 3Q11A 3BJEA 1RQRA 4MQ5A 1U2GA 4NPHA 4E15A 3AL2A 4YCLA 1GCAA 5ICCA 4Z7JA 1FPQA 1GITA 5INTA 4XYEA 4UVEA 1VL1A 2GN2A 3GHYA 2N42A 2NYVA 2QU7A 1OB5A 2H4YA 1UBHS 2XHZA 3BD6A 4O08A 4W5HA 2Y1DA 2Z9DA 4UEWA 3C6KA 1S2LA 1A2KC 1AXGA 1O08A 2AC7A 4WKGA 1EDEA 2H92A 3IOEA 1BX3A 4QVKA 2BCEA 1R37A 2ISCA 1O3YA 4FT2A 3FWZA 4RH0A 1DBQA 1QMPA 1SXQA 4MS3A 4E3WA 1H4QA 2F55A 1BHSA 1OXVA 2AT1A 4OBWA 4CV0A 2W2LD 3E1GA 1QB7A 2D1YA 3WE7A 3U3XA 4XDYA 4Y6SA 3EXIB 1VI6A 1TE2A 2WSMA 4RZIA 2XQJA 3ZV4A 1O9HA 2FQXA 1T10A 2FJPA 4PPFA 4TTIA 5A0TA 1UBSB 3SSNA 4QGFA 2HHCA 2IUEA 2RI1A 4MIYA 3S7ZA 4YRAA 2D0PB 2GEVA 1EPUA 1G60A 4JBYA 5TJHA 3A28A 2NV6A 3BA1A 3I28A 5EIOA 4I6EA 4PZCA 2R86A 2F3UA 1E1QA 1XQWA 3WYBA 3PPVA 2HYDA 2WG1A 2Z4SA 3EEBA 1XD2B 4AX4A 1OTHA 3KQWA 3GLSA 3ZE2B 1YVUA 3EWNA 3QYPA 4ZOBA 3KQQA 4L72A 3ER6A 1A96A 1DAIA 5BR7A 4ENWA 4FYIA 1GPYA 2ZSFA 4OSPA 2C77A 4CM9D 4CXMA 1Z5UA 4GSKA 1M2VA 5LUBA 1BXRB 1MC4A 1NBAA 4WACA 3ROPA 4AZ3A 1KI6A 1W88B 4LX0A 2BZ0A 1KZ7B 3QKIA 4JBWA 1SR8A 3M9WA 1XVVA 4DM7A 4HAIA 4UFOA 1MX5A 1OILA 1IJEA 2VT7A 3DMFA 3UF0A 4IJWA 4TV9F 3A9SA 1F0KA 4KNVA 3R41A 4ETNA 5KQMA 3O4GA 1VM6A 4WCFB 3G8AA 3KZNA 1TJPB 3M9XA 4RQBA 4XDZA 1FU8A 4ZVLA 3X1MA 2BGWA 4RANA 1Z5WA 4JLPA 2JJ1D 3L41A 1TXGA 4X1YA 3MIIA 1X7WA 4Q3EA 2KB0A 4ZT2A 1I9GA 5I5GA 4KMSA 4CJXA 3EG9B 3TSYA 2E37A 3DOOA 4ARZB 3ZU6A 1A50B 4BBPA 1UT5A 3OEWA 1TLFA 5ANRB 1ZI9A 3DEIA 2PYZA 1U0EA 4DLYA 1TF5A 3P97A 5K0LA 5BSUA 4N8EA 5IABA 4I1VA 5DGXA 3G0HA 1YRYE 2I66A 1R5JA 2ZXFA 3QOXA 4DPLA 4DDTA 4Z7OB 2HW8A 5CFRA 1ZSNA 4ZVOA 3TR6A 4C7BA 4PLCA 2G83A 3EGIA 4URYR 1DIOB 4UHEA 4DRXA 2O0KA 1MOPA 5SY6A 3QNMA 2AQIA 4ZIRB 4MVJA 3VKHA 3E03A 3I2KA 3LPNA 3AHFA 2BKVA 4MS3B 1GWNA 3RE1A 5IDYA 5LNK1 4NZYA 3KYJB 3QBEA 1THMA 2CFRA 4GI2A 1Q74A 4CMKA 4YS6A 2COUA 5IKXA 1K5PA 3QVSA 1XRRA 2C9CA 5ENZA 5GONA 2ONYA 2XY4A 2NZUG 4L9SA 3KLBA 3UMJA 4AJ2A 4MK4A 2VLBA 5IF3A 1GCIA 1IHXA 2OHFA 3DKIA 1IUNA 3WA7A 2XCRB 3IC5A 5CA1A 1CUXA 4P4UA 3UANA 3CH5A 1JBKA 2I67A 2WJ3A 3IP5A 2EWVA 2QUJA 3FGOA 1JTFA 2NU8B 4QTYA 1EFUA 3EIHA 4D8UA 4R1LA 3CVVA 1T1RA 1W1IA 3RF6A 3N2GB 2VAMA 5DNCA 5EJ5A 1SQ5A 2PX2A 4JROA 1KBOA 1T9GR 3IIIA 3L8GA 4MPJA 2BGRA 3OI7A 2QD1A 5FLYA 3RGWS 3V1KA 3DE2X 1QC5A 3GVXA 4KX5A 4GWKA 5D3MB 4B3IA 4TL8A 6NULA 2DPXA 3GLKA 2HA6A 2X2PA 5KDOA 2X3YA 1LDBA 5LOVF 1P2UA 2GUWA 3CQ9A 2C29D 5BNZA 3HNOA 1V41E 3HYSA 4MUFA 1F6WA 2F2TA 4G84A 3IKMB 2Q2WA 2FEPA 3BGSA 1CY0A 5DNEA 4BKMA 1Q19A 3UXMA 2V7EA 1QQ6A 1Q3HA 3NHKA 4KX3A 3NVDA 1ZFNA 3DMNA 1UJCA 4DY6A 2XF2A 3C6XA 1T1SA 1OYYA 1MMFB 2MIIA 3Q1KA 1RLJA 3LCRA 4ZTUB 4UU0A 2FMHA 4E1AA 2H85A 4C0XA 4F6RB 1PL7A 1RPZA 4Z9XA 2WW8A 4XGRA 1NZDA 4JGIA 2JFNA 3B5IA 4NMHA 3RABA 3RR2A 1K7SN 3B52X 5E3IA 4UDNA 5AVJA 4ZJPA 5IYZB 1DAMA 2FZ4A 1WU7A 2HA7A 2RCNA 1VSUA 4UXHA 3HHPA 2C59A 3PGJA 1RZ3A 1TVCA 1N8SA 1D6MA 4ZU3A 5KWVA 4EL0A 3P2OA 2ODNA 4FMBB 3VO1A 1NX6A 3E23A 4IQGA 4DL9A 2VG8A 1CD5A 3DZHA 2QAIA 4NF2A 2R8XA 1OPRA 3G8BA 2H59A 3RTBA 4L4ZA 5TX7A 1NVUQ 3WMXA 4R9UC 4LNUB 1VSBA 3OZTA 3E7PA 1AXEA 4FBGA 4ZRNA 3KYCA 4CQMB 2LCIA 2JHAA 3PDWA 2XVYA 1QLWA 1JDPA 3OLYA 3VU3A 2VDQB 3D8NA 2R6HA 3RIGA 2MINA 3S1SA 5ADUS 2R1VB 1S2IA 3RC2A 4MVJI 1HSOA 1UJ5A 3GK3A 2PMBA 4KQCA 4FHDA 4PW0A 5FNVF 2HO4A 2ZSUA 3ANXA 3NYWA 2HSWA 1AY0A 3EASA 1RBMA 2Z56A 4HN9A 4BO6A 3IL2A 2C4NA 4WDQA 1W2HA 5B7NA 1F20A 1V8DA 5IUNC 4EBBA 2WM2A 1IVNA 2YHBA 4ENQA 2XZTA 4CT0A 1DTEA 4OL0A 1UFOA 3E82A 3G02A 3CW2A 3GROA 4MW2A 5EIEA 1Y48E 2UYYA 1JFFA 1UJMA 4BTEA 4Y6PA 1P75A 3T3GA 3VPGA 4TN1A 1DAFA 3CINA 2PVCA 2ZRNA 5D1HA 1FNNA 1U99A 3QENA 1IAQA 2YCLA 1U2ZA 1TMOA 2C2MA 4ITRC 4GWGA 4XIFA 3S27A 2I2BA 3VR6A 4C4PA 2X58A 2X6TA 1FJHA 3T06B 3CIFA 3NGLA 4NXMB 5I4CA 3ND6A 2B4YA 1IZ8A 3UUFA 2WVAA 4F1JA 5IP5A 2FPMA 2JGDA 4BX3A 2VBFA 1QH8A 4BIIA 1GT91 3CLHA 4KXUA 2EFHB 4AD8A 1BFKA 2IXEA 3S0JA 3GJTA 1GPKA 1EP9A 4XQCA 4O4LA 1CS0A 1YUMA 4JEUA 1B8VA 4YJFA 3TNJA 4KNWA 3ILSA 4HAOA 1M3SA 1R6TA 1DRVA 4JOSA 4CL0A 1BE1A 1NW8A 1WUYA 1E1RD 4JHXA 2UZ1A 3ADPA 3LPAA 3NJ8A 2QNRA 3TZHA 3D7RA 1JAXA 1TNDA 1Z5VA 3E84A 4BGIA 1PJ4A 1VI5A 2PD3A 2ZTLA 1ZCJA 2XUGA 2DERA 2ZIXB 2G07A 1AKVA 1NP7A 1R8YA 2YMQA 1FDTA 3THYB 2V6BA 1QSGA 2MMCA 3AWDA 3AF4A 3JQ9C 4HDAA 1PSDA 4M46A 3W78A 1WRBA 1N3YA 1WMFA 1JFRA 3OIYA 4Q15A 3T8YA 4B6QA 3EZ7A 4Z7NB 1SD1A 3DE6X 4MUHA 3UMBA 5D01A 1YTLA 3P2YA 4TVKA 1SHTX 2Q62A 5AM5A 2CXNA 4BVJA 4FD2A 4O59O 1PDWA 2XWQA 3VZDA 3TGPA 1KEWA 4O0LA 4TX1A 4U2GA 1N36B 3VYUB 1Z6ZA 2X0IA 4P93A 2BELA 1GPBA 3UICA 3C4JA 2I4OA 4EI8A 4EPWA 1QG0A 4GI7A 4DSZA 3OZFA 1T2FA 4V24A 5LZ5A 1LLQA 5L4NA 1HG0A 1MP0A 1MPXA 3A7DA 5K0JA 2ZZNA 1JSCA 3UJ8A 1R8SA 5C8YA 4TPKA 3IO3A 1TM4E 4HLUA 1II8A 2ABWA 4ZTBA 4F5ZA 5K0FA 1HYEA 3ELDA 4TMTA 1GV1A 5CX1B 3WQRA 2AF3C 1EGQA 2C5SA 2X0RA 5A3QA 3KKMA 2CKMA 3QSGA 3PEYA 1FLNA 3W8RA 4DUYB 4CL8A 1PVVA 4XUGB 2QRUA 2WPDA 3OJXA 3U81A 3R5JA 4TZTA 3QWIA 3HXLA 4KRFA 1KYZA 1CZLA 2ZGVA 4YRTA 1E9CA 3LE8A 4RMGA 1R12A 4RADA 3K0CC 3L84A 2P2YA 4MR7A 5DM70 5EPUA 2V0NA 1XAGA 3WZ2A 2ZUSA 2C7QA 2BEWA 3D8SA 1VP3A 2IZ7A 2MSLA 1E5XA 2FCRA 3DMGA 4QPZA 4M9QA 4MV7A 3T12A 2UAGA 3KT6A 4LY9A 1HTBA 4BPRA 1KKLA 2CDBA 3FPGA 3PUWA 1OREA 1XDWA 1UPTA 4QJ3A 2X42A 5LLSA 4DQLA 1YE3A 2FOLA 2Z5LA 4FMPA 5U4QA 4JI1B 1O7JA 1W5EA 4D0GA 4YRMA 1YS9A 3CU5A 3K4QA 5KPJA 3PXGA 1N33B 3DV9A 4RY2A 4FYHA 1PFKA 1XU9A 2FUEA 3KB8A 4O4JA 1ODSA 5I01A 4TGLA 3MJCA 3WIVA 4HEQA 3QU9A 2GF9A 1QQ5A 1Y33E 3DFIA 4H77A 4X8LA 4I66A 4HZUB 4MGYR 1H22A 4ZYVA 2J45A 2LKDA 2P6PA 3AF0A 2NNLD 3LG2A 4D4GA 4EJ6A 3HN2A 4FFSA 4B3FX 3L6DA 4B3DA 1K3UB 4R6XA 3PCTA 3IEIA 3SFZA 2I4IA 4M86A 3LOUA 4KLRA 4DLKA 4YWJA 1SCJA 1VJGA 1VJDA 1OYOA 1T1EA 4Q1AA 2X5JO 4RVOA 4WNIA 4DE5A 3NR2A 4W82A 2BJVA 1ZWLA 2B6NA 3O4HA 1SOWA 1DAKA 3VKWA 1PS9A 3Q9LA 2PXXA 3RG2A 3STWA 3IJPA 2HTFA 1JT2A 4KN9S 3SNKA 5TT0A 3KXDA 1OIWA 1H9AA 4J1SA 2QJOA 2XKBA 2C8KA 1T2CA 1SWVA 3GD7A 1TKCA 3JYPA 2X0FA 1FLDA 1T1GA 1TTQB 3ZHXA 5KNBA 3BT7A 2FSUA 4WE3A 4LNHA 3U49A 4M60A 3QKUA 5K4AA 3PUKA 3H1GA 4TROA 5K3DA 4ASUA 4OAQA 1U8XX 3VZCA 4KXYA 3BZBA 3HGQA 4OSOA 4PYLA 4BB6A 1HL3A 2Z30A 2C8JA 4YACA 4PWYA 1HDIA 2B6HA 5HKBA 3WLOA 2XDQA 1XQYA 4MO2A 4TZ6A 4E1BA 3B9PA 3L8CA 2VZ0A 4IH4A 3VJKA 3GL9A 4CGZA 1I0LA 1T3GA 1DQSA 2GPNA 5AKLA 1KIFA 4JYBA 2EJWA 4R1OA 3L05A 2Q5HA 3COZA 1JDZA 4W9RA 4JT4A 1E9VA 1F8XA 1P91A 2NU7B 3KT8A 2ALJA 1MB0A 1SVSA 2NUAB 1EE2A 1ZKDA 1QCZA 5A1TA 5KMGB 3MINA 5AKEA 3RKSA 4K9DA 1P72A 1M6EX 2LE0A 2Q0SA 2ROQA 3X2EA 3TL6A 3C87A 2ZETA 5E7QA 1K7EB 4FEAA 1SVLA 1HFKA 3UNXA 2Y66A 2R6R1 4EUSA 4HWRA 4AY2A 4PXSA 4LGYA 3DE1X 2EQAA 5C8YB 1SRQA 2AMJA 3CBQA 1SELA 1S89A 2JBWA 4NAHA 3GJ7A 4RIFA 4TZKA 1A9OA 1ZMOA 3GMDA 3MFYA 3OBBA 3OPVA 4UBIA 5JISA 1UBLS 4MA0A 4LHSA 4RKEA 1EZZA 1G3IA 4J03A 5LMCA 1OYVA 5LP1A 3C7DB 1FOEB 4HDCA 1EWKA 5KWEA 4PIMA 3RNOA 2Q3FA 3ZI7A 1HKUA 3NHUA 2EL9A 2JK0A 2G17A 4AP5A 3HKEA 5AI8A 4O2AB 2HRRA 4C4TA 3P94A 3FOAA 1P1JA 1HDZA 1N9GA 5A05A 2OWDA 4QDUA 1H8HA 2DBQA 3VSBA 1W48A 4IFIA 4CQLB 5IK2D 4D0RA 3QVWA 1T3ZA 1TVKA 2C3OA 2CMHA 2H1FA 3IHWA 4N3NA 1N5JA 1NBEA 5AT1A 2FSGA 1Z2EA 4RTOA 2GBGA 3EBPA 2VNSA 4XB2A 5ICSA 3ZW9A 1EK2A 3ND9A 1E3LA 2LGJA 2BE7A 2PS3A 2Q46A 1IVYA 2IZ6A 4CLRB 3TOZA 2XCSB 1ORRA 3GJXC 1X7DA 4RGVA 2PZKA 1JQJC 3AEXA 1GLVA 1X7XA 2XHEA 1K2VN 4R2XA 4PPQA 4O6VA 5DVZA 4RTQA 1EK0A 4JQSA 3U19A 3PI7A 3ZHUA 2YJ4A 4DR4B 1QAMA 2REBA 3SQNA 1AZWA 4BAUA 5IVKA 4K40A 1RXCA 5I7UA 2C3YA 1DBVO 4RV4A 4U2FA 4W7SA 2F17A 3O8CA 3ZNNA 4GX1A 2C2WA 1EAMA 4BMCA 2I7XA 1I01A 4GRDA 4DA4A 3OJLA 3C4VA 1U3DA 3RK1A 2HLNA 2RHHA 4TRMA 1X9GA 4LWQA 3T3IA 4M83A 4C29A 2CMFA 3F8SA 4QDTA 4JC8A 1DEHA 3SR3A 2EF0A 4XAQA 1N2BA 1KZ1A 3LIIA 3D7NA 3Q15C 4B47A 3R74A 2XCLA 4IW3B 4R31A 2P5UA 4M38A 3L8FA 1JPNA 1SA0B 1ZOOA 3FHJA 3TECE 3ZDYB 4AN0A 1BN7A 2B2CA 3TDKA 2PHZA 1P4JA 4OX9Y 4CL3A 1EESA 5C4MA 4UNNA 4XARA 3ORYA 4UBKA 2V59A 1NBME 4O4IF 3KJQA 3T7SA 5AM3A 2X0EA 1L7PA 3C97A 1XZIA 3AEZA 1G21E 2RIPA 1T15A 1U2TA 4JX8A 4CQMA 2VXOA 3TPFA 4Z4FA 5DOVA 4EJ2A 1KSJA 3BMOA 4JYAB 2I8CA 3MCZA 3FPKA 4YBZA 1PLJA 4X3OA 3TPCA 2DMRA 4I4TF 1BXKA 5FBHA 2AKYA 1JEAA 4DA6A 2IUYA 5I3CA 2PLWA 1JIQA 5J2UA 1RNLA 3AY3A 5KUTA 1JTEA 1O5IA 2BHLA 4JEMA 2FUNB 3D5QA 2V03A 2DFPA 3EFBA 4H7FA 1ADBA 2VSQA 4ND3A 4NP6A 3T3EA 3DW1X 4PN7A 2W5UA 3EHDA 3PF8A 4GICA 4IGAA 3GCZA 4J16C 4JS0A 4BZZA 1M2HA 2NZVG 1ISMA 2EJTA 4JUAA 4DYVA 4MWTA 4FJ1A 2CNKA 4FGWA 3BE6A 2ZWOA 3D7MA 3E8XA 2VYND 1T4CB 1LF5A 1TW3A 3RHFA 4AB1A 4KO1S 2DHCA 4AXXA 4HB4A 4U7GA 2JFOA 3R6WA 4OLHA 5EGNA 2XZLA 1DJLA 3IOMA 3OJFA 5I5EA 3C41J 1M72A 3AVPA 1YC5A 2RGXA 4EMTA 2YBDA 3ICVA 4B7UA 1OU4A 1JA9A 5FR2A 3THWB 4NBVA 4Q4HB 1PDOA 2X2EA 3KXLA 4WASA 1D1TA 1N5RA 3R5TA 4QIHA 3G0DA 2HOQA 5D1NA 1AUVA 2H8GA 3NBYC 4HAZA 2IDZA 4KN6A 1OXBB 1Z9BA 1JXAA 3IKJA 3MXTA 3C3XA 3OQIA 4KU4A 5E9JA 4ZC8A 2XUQA 3BFJA 1ENPA 1V25A 1CFJA 3I2JA 3IAXA 4HWTA 5IXSA 3MTQA 1T4BA 2WM3A 4G5XA 3ZZUA 5C1PA 1I80A 3UGJA 2HD4A 1FDUA 2C7OA 2HQBA 5KVCA 1BMFA 1F51E 4X84A 5F7ZA 1RMYA 5CTJA 3G0GA 2WA1A 3EPPA 4RGYA 3TJRA 5JCJA 3U3ZA 3CURA 1UJ6A 2YUIA 2F3RA 5G1OA 3WR5A 3JQ7B 5P8WA 2ZBVA 1NFQA 2PX3A 4FUTA 4QFMA 4GOND 1QP0A 1JBQA 2HXYA 2CL7X 2I54A 3CJTA 1SZDA 2X4LA 4QUAA 5JDCC 2O5VA 3JQ8B 3D1JA 3FX2A 4QNMA 2OV3A 1SKMA 4HH0A 2DYKA 1Z7BA 1QDUA 2XCOA 2QVXX 3MQ4A 4L22A 5DSTA 3VTZA 1C7IA 4MUNA 3TLYA 3HWSA 2PMCA 1DC4A 3WNQA 3WRXA 3VDRA 3ETDA 4MGKR 3ANSA 3SHWA 3OFND 4N40A 3TR5A 1NG1A 2HEGA 2ZVJA 5JSFA 1AHNA 5CVVA 1SC3A 5T67A 3QIVA 3OEEA 3KEGA 3D3WA 4L85A 4OYLA 5LUAA 4Y98A 1BA3A 1RM0A 3NHWA 4FCVA 4JEIA 2Q50A 5GM2A 4EB8A 1RAIA 3G6WA 2HRCA 2XCIA 3QLVC 4TTRA 4EMUA 2HCTA 2L18A 4RCVA 3ULKA 1RYYA 5HXAA 5JMWA 4PO8A 4FJ2A 4P53A 1H0HA 4RY9A 4XFJA 5EMMA 4J2HA 1OQAA 1J8FA 3KHTA 1BMDA 1GYPA 3SM9A 1FMCA 1ZS9A 1YFKA 2AJ8A 3V4VB 3H2IA 3WISA 3HUDA 4DQ0A 2X4GA 1FVHA 2QLLA 1PWEA 3MWJA 2XUJA 3HFSA 1XZAA 1G6OA 3OCUA 1WA5A 3PE6A 4LTDA 5EHZA 1EA7A 3I92A 4BUJA 1U2SA 3GNSA 3R7NA 4YMIA 4A2PA 4X1KB 3U9SA 4RKFA 4FDUA 4DGSA 3ZE0B 4F7DA 3LUJA 4KIGA 3RVLA 3QVXA 3PTZA 4MSUA 5FBVB 3I2IA 1PQYA 3DOUA 3TZEA 4G0UA 2X0KA 2QDKA 3CMMA 3RVDA 3ILYA 1YUBA 1ZRNA 3MCVA 3L0YA 1BE8A 2UVPA 4Y2TA 3ZDQA 4ZHSA 3PQEA 1HEYA 3UJ3X 4CTMA 1KI2A 4IIBA 2VOJA 3LT2A 4J76A 5B30A 1DRWA 4ZVMA 521PA 2YKGA 3GFQA 1I7LA 3PQFA 1QHHA 2QIPA 3EJ6A 1CUSA 1TK2A 4E5YA 1MLDA 1BCSA 5FTNA 5K0BA 2ES4A 2ZJ5A 4MDEA 2QN3A 3AVWA 1FRQA 2OK7A 1YV9A 2ZBFA 2PD4A 3K1AB 3Q10A 2HMAA 4N0DA 1YIDA 5A3RA 2QLNA 3N8DA 4KO8A 1NBHA 1VMDA 2E1PA 5EXSA 2J8ZA 2DM6A 3PEUA 4EA6A 1JFSA 1ONPA 3X1JA 3ZDXB 3LH5A 5E2IA 2HT1A 1L7BA 1E77A 4GX5A 4KW7A 5CK5A 4JBLA 1FRZA 3LY7A 3MT7A 1DC5A 3OJCA 1YQUA 2LNDA 4DMCA 3EOBI 5LQJA 1NYQA 3IVXA 2A35A 3QE9Y 4M0FA 3R0XA 4RK6A 1CUIA 3SOZA 5HOQA 5AI9A 3CT4A 1D6NA 2H31A 1G8AA 3NATA 1COZA 1YJ5A 2F67A 3IRUA 1IMJA 4I8XA 4JR1A 5H80A 4BVGA 1VE9A 3CR3C 4YJFB 1E6EA 1LFDB 4OGFA 4K6CA 4BFVA 2Y05A 2OO7A 4CLRA 1GUBA 1GLGA 1M6VB 4WFKA 1VJCA 2V3WA 3Q3IA 1PT5A 2Z9CA 3A6JA 3E7XA 3OZEA 4M8LA 4MZXA 3GN2A 1OXXK 5A7GA 3AI2A 1ATZA 2LKCA 4HNUA 1KYWA 2R48A 4F0JA 5KNBH 4ZCTA 3SF8B 6PFKA 1L5YA 1GGVA 3BB4A 5KX5F 2G25A 1XE3A 2PSDA 1HQKA 3Q4GA 4AS2A 2OK8A 5K8JB 3EK2A 1E3IA 2PL5A 3RYCB 3NOQA 3OZ7A 5LU8A 3GZJA 1CEQA 2D0IA 3AC0A 4X97A 1RJ9B 1DC6A 1M8GA 2YMPA 3OUUA 2OENG 3V2HA 1H1LA 1G7RA 3M70A 1J33A 3FUTA 1C0EA 3H16A 3PENA 3EX7C 1N2XA 2BW0A 3CN7A 4KREA 2GDJA 9LDTA 2AOWA 2QV0A 1K5HA 4N82A 4X7BA 1U2EA 3VTAA 3WKDA 4A2WA 2QLBA 4DR1B 4Z9BA 4H4DA 2LW7A 5DBEX 5FNVA 3SQDA 3T0GA 3ZIAD 2ZRHA 1V5EA 1L3BA 2NP7A 4AUMA 1UZAA 3TM4A 5A3SA 1MAAA 2QX9A 1UWKA 5C9ZA 5AKXA 1JI0A 2CHVA 4MUKA 5FJJA 1O6GA 3H83A 5JARA 3BBPA 3SC3A 1S6YA 4MVJE 3SQMA 4MI6A 1YMVA 4DSTA 5I8WA 1JNXX 1WHSB 4NFHA 2C4MA 2X6QA 1YFZA 4ZP1A 2WZDA 2WWYA 4FM9A 4UVHA 2HLDA 2YZ2A 4D98A 2R97A 1VMKA 3GA7A 4MUYA 4KXQA 3ZZNA 2JEOA 3AU9A 4NOJA 3RVPA 2R65A 1W2GA 3QW4B 4XDHA 1FVFA 3S5UA 2IITA 4CMJA 5BV7A 1QBKC 2P3OA 4O2BB 1AOXA 5FLEX 1L4BA 4WXMA 5TPZA 4I6JA 2OSVA 1O57A 4UM9B 5IJ0B 1B1AA 5E7IA 5TLSA 1G8PA 1HL7A 4RVNA 5F7JA 1FW8A 2C42A 2V9CA 3R3YA 3TTTA 1Y1RA 5DIZA 4BN5A 3L2OB 4BNGA 1FNCA 2WU0A 3HB7A 5LB2A 3RT7A 1MH1A 5H8WA 3B9QA 2XTAA 3ASYA 1P60A 2BC9A 2ESRA 1WLYA 1Y8QB 2IVFA 4QQNA 5ALKA 1B6RA 1XCPA 2OD7A 3R5SA 4L78A 3WMWA 1PYOA 1EXNA 1JIUA 3IVGA 4M99A 5G53C 3I61A 4PV7A 1TF2A 5KYYA 1GV0A 2EDCA 2JDID 3ZXSA 5ITWA 4YP9A 3ZIDA 4D4MA 5HJ7A 4HNAA 1HK7A 1UJBA 2IZ1A 3H87A 3LRPA 3LLUA 3L7AA 1AKNA 4J0CA 1Y37A 3TLGB 1QPZA 4RD4A 4D6PA 2CB0A 1KDPA 1Z6AA 2ORIA 4EX7A 1BW9A 1WKCA 3AONB 3ZJ5A 4H3KB 5ELMA 2O5RA 1XMOB 2ZAIA 9ABPA 4BNUA 3HB5X 3ZHBA 2YVAA 5H82A 3HA2A 1G21A 1FVOA 4RYLA 3VVLA 1KK1A 1UBOS 3F8TA 4B2IA 3VISA 3OM0A 5ITZB 4C5CA 4OFBA 3WY9A 2D5LA 1RYBA 4QUEA 1CUVA 3DEFA 4D92A 1AV7A 1WOMA 3HP1A 3DMTC 4GP7A 4JDUA 2AJDA 3KTAA 4FNOA 2IFTA 2AQKA 2GT1A 2I7TA 1NRXA 3HV0A 3LQFA 4FFOA 4PYQA 1REQA 4HKTA 3S3TA 1RWPA 2CSUA 4BFLA 1KPHA 2AJCA 3FLBA 4HRXA 4YRLA 4MAAA 4XE5A 3ZD8A 1FSSA 4HNSA 4IJKA 1DQPA 1A77A 1P8JA 1UZUA 1X9HA 3EXIA 3EXFB 3M6MD 4NV3A 1X94A 3ZWNA 2YOHA 3R76A 4N12A 1JH9A 1KORA 3G49A 4P5PA 4X60A 3T1VA 3TB6A 4J7XA 2FPIA 3ZY3A 3AIKA 3AU8A 3O7MA 1PR3A 3DFZA 4EHIA 5IT4A 1QR6A 1V35A 1NJ2A 1N7JA 4Q1FA 1Q0TA 4M54A 1A2BA 3ZDRA 2W6NA 3I4CA 4WK2B 5ESDA 1C9EA 2OWEA 3BMQB 4LDQA 3CKLA 4DLRA 1FU7A 1O96B 1DRUA 1PEKE 5EQFA 4HFNA 3LXXA 3SZOA 2HCBA 4MO9A 1JLSA 3SMQA 3CLVA 4C0HA 4CLDA 1I4TD 2J3HA 3QXGA 5JAOA 4OLFA 3CNBA 1WEKA 2YVUA 4JXJA 2OAP1 4QNRA 2YXLA 2GI4A 4MYSA 2W0MA 5DXFA 1MRNA 4ZK2A 2NXEA 3VAYA 2RHJA 5CEFA 1BX0A 1J6UA 4V02A 2ZSAA 1XVAA 2NTNA 3B20A 4JVOA 1L8LA 1EM8B 2XPCA 1TUEA 4D99A 4F04A 4YXWD 4R68A 3AP2A 3BZUA 2A2ZA 2FUG6 4JI4B 3UHJA 3HDHA 3ZNQA 2BGLA 3WYCA 1DHTA 4DREA 4EW3A 2HMTA 5K6TA 1VYTA 3H9CA 3ESYA 1P9OA 5CNMA 4Z7QB 1CZKA 1YQXA 1IE3A 2X5NA 2X76A 3E9RA 3N0TA 3TTXA 3CB4A 4JUBA 4C1BA 1ZNWA 2PJDA 3W7BA 4D45A 4I9GA 2NU6B 2PCLA 3B12A 3IE2A 4GOKA 4G0OA 5CDHA 2E55A 2XT0A 2ZB4A 2GZ2A 2V7GA 1FFYA 4C7MA 3EIWA 1WUJS 3KQLA 4WA7A 3P5SA 1C5KA 2G77B 3DULA 1UP6A 4DMRA 5LZ4A 4BGUA 3W9BA 5GIOE 2OD2A 4FYKA 5B7GA 5HDQA 2X3FA 2RHBA 4ACBA 4N7MA 1MZVA 3QVMA 2P9QA 5BW6B 4COKA 1AS2A 1NW3A 1CS0B 1SHKA 2JJ2A 3NU1A 4PZYA 3VR3D 5IUJC 1SQSA 1SUDA 1RWWA 1WW3A 2DAPA 4MHSA 4Q1VA 4BLRA 3D2BA 2ZG6A 3X44A 4HEA1 3UV6A 2A5LA 2BI7A 2PKQO 3FUUA 1P61B 2VHEA 4KYTA 1T9HA 4MVWA 5TQJA 2HRDA 1E7WA 2Z2IA 2FQWA 3JQ6A 3MD0A 4JC0A 4JLKA 5DHAA 3WWDA 2XKKA 4DIBA 3CUTA 2ZT6A 5KYUB 4ILKA 2OE2A 4L3VA 3KAPA 3BXPA 1E2KA 4JBHA 1TPYA 3QE3A 3DT8A 2ZUBA 4TWBA 2BTQB 4EZBA 3CF6R 3TM5A 4NBTA 1NXQA 3MS7A 3AUYA 3R23A 1ZIDA 5LQUA 5L6LB 4BGVA 3SYTA 4E6EA 4MRAA 1Z74A 1GG9A 2UU9B 5IMSA 1W75A 4RETA 1SKYB 4I4IA 4G09A 1EQAA 3KWJA 1N3LA 4ZI7A 4LSGA 3ZHCA 5LPNA 3COVA 2JAWA 5BR8B 2QENA 5KO2A 2X2FA 4G5FA 5TMDA 1QYDA 2VP3A 5TV2A 5CLJA 3F4KA 1J2JA 4R81A 3I32A 1H4VB 1EVEA 1DKOA 3ZTYA 1IY0A 1OWLA 3LOPA 3RODA 3TCNA 2VYNA 1JAYA 2VTEA 3KKLA 4LVCA 1QIDA 1EVLA 4K2AA 3X1WA 1EU1A 4E09A 5C8ZA 3O4FA 1XMPA 2R7MA 3PFWO 5EJGA 4PG6A 1B41A 2WJZB 4PTYA 5GPBA 5B1DA 5E2AA 3WIOA 4ZCSA 1CJTC 2C7RA 4GZ6A 3RC1A 4HZGA 1EVYA 2AK3A 1WIWA 4JYZA 3T3DA 4Q39A 1XZCA 3FVWA 1DUIA 3EUWA 5KYGA 4LYDA 2VK1A 3FVTA 2SKEA 3O1LA 5DGTA 1DG3A 1Z5GA 3LX6A 3VO9A 2V7QD 5CJJA 1T0BA 2PKEA 2SICE 4P2BA 4PTLA 2J1LA 4Q9LA 1IXRC 2QB5A 1N4AA 3RV4A 5AVTA 3AVUA 4C6RA 7MHTA 3D1LA 3DZKA 1J2UA 2YMLA 4OUKX 1CULC 4TSKA 4F3NA 4GMDA 2B4QA 4MVJP 3RRFA 5JH7B 2HJSA 3H5IA 1GTZA 2ZVDA 3BF8A 3NZEA 4PAQA 1YZKA 1MJHA 3A3KA 3DMYA 5JWRA 5KU1A 4PM4A 2QUIA 3SQWA 1LQ2A 4AG6A 2X77A 3RJ5A 3QTTA 5HF6A 2GH1A 4R3NA 3CNEA 1E9SA 3JVIA 4GWLA 5IN4A 1E4OA 4M2LA 2Z2JA 5KDLA 2CFIA 3WTBA 1TRKA 3GGJA 1PTKA 1OR8A 3BXGA 3TNLA 2J3KA 4N1AA 1GGHA 3KXKA 2UDPA 4N47A 6Q21A 2NUPA 3BCHA 4TT8A 3B1YA 2VZ8A 1LC3A 3OE1A 4UHFA 4BQPA 3KZMA 3QSYA 4LF4B 4FN4A 3TVDA 2WKPA 5JAZA 1O58A 2MHCA 3FCEA 4FYMA 4L8GA 3WSTA 1ZJ5A 4NH4A 3KB6A 3NUGA 3OEED 1NW4A 3HUEA 3G2MA 5EXXA 1JQKA 3AZQA 4HQ0A 1IB0A 3C48A 4L3WA 5K3FA 4ACAA 3P2EA 3IKTA 1A9QA 4Q3NA 1K6IA 2QSYA 1IZYA 3U7GA 1P62B 2NTVA 2RGYA 4MCJA 4LG1A 4JLWA 4QDXA 3LRXA 4LJRA 1MB9A 4L1KA 1E59A 4IHJA 2DC1A 3WXMA 4BS9A 2WLSA 2XUHA 5KTSA 4M21A 4H2DA 1LJLA 3TSWA 5KAPA 4UW9A 1XU7A 4AAYA 1OTYA 1ZD5A 1MPTA 1HYQA 3AKDA 2VF2A 1YZFA 3QWAA 1ZU4A 2HBYA 5COQA 2AG5A 3G59A 5KQPA 1YRLA 3CZPA 2O1WA 4HLNA 4TTJA 4B3GA 1Q7GA 4PSUA 3VX3A 5DYNA 1IOLA 1XL1A 2C8LA 3FZEA 4TKUB 4XGNA 3OCVA 3VU0A 1JL3A 4EB0A 5CYGA 2CT8A 2CNBA 1GQ2A 2KSQA 3HJHA 4II3A 4JMLA 4ADSG 1PNTA 3PPIA 1YDEA 4HMOA 4U7WA 1UL1X 2JI4A 1XVIA 2YR0A 4IDQA 3INYA 3LYLA 1QRRA 2DQYA 3KJZA 5AVUA 2D0OB 4DMUB 1RJ9A 1Q50A 3BB1A 4N3AA 3VH2A 1G3MA 3M6XA 3GIDA 2ZUTA 4EVRA 2BHNA 2YHAA 2XE8A 1CVRA 3E5MA 3PRKE 4ID9A 4UEKA 1E0AA 3MQFA 4M3NA 1QGUB 3RIHA 1T3LA 1RKUA 3DPSA 4GZ5A 1CUFA 1MG5A 3LA8A 2JFXA 1X6VA 4UTXA 3LVRE 1Q91A 3LPLA 2F64A 4LV6A 1PD1A 4F3CA 1HQDA 1PQUA 3G85A 1T6XA 1YB5A 3GEDA 4UBOA 2NYRA 3C6ZA 4IJVA 3WXBA 4FFLA 4HNQA 2DZDA 3BE4A 1A76A 4QE3A 1E2NA 1GL7A 4LJ7A 2VXBA 3RLIA 3L7MA 4NS1A 5LFAA 2BMAA 2CXOA 4KQHA 3DVAB 4J9UE 3KQPA 4WCFA 4P0TA 1LGYA 3OQBA 1MRZA 3IMFA 3O90A 4REQA 1KDZA 4U02A 4AJLA 4RHTA 1Z0UA 4YJ2F 3N5CA 4EFNA 2EYQA 8MHTA 3USES 1EH5A 3JD0A 2WICA 2WTNA 3TD2A 4C6TB 2JIOA 4WN9B 4C4XA 1UAAA 2QX8A 4OB6A 3ICOA 3B6KA 3WLAA 5JS1A 1XEAA 5CX4A 2WSBA 3I30X 4RZSA 1K1EA 3MUFA 4DNQA 1FMLA 1LPMA 2DUJA 2C9YA 3Q87B 5LQKA 2MSNA 2C20A 4H4EA 3X43A 4UEJA 3SHTA 1H2HA 1XAHA 4RDCA 5AVZA 4PRYA 4LWPA 5EUMA 3E35A 3GQBA 1FYFA 5LM3A 2PANA 5KC8A 2O2XA 1X7YA 3BC1A 4FPXA 3A10A 1KYIA 2GCPA 4WOKA 3TQCA 4H3VA 1JIKA 4Y9UA 4UC0A 3RWBA 4ZDJA 5ALOA 4OM8A 3GQBB 1HDEA 3F9RA 3CSUA 1Z8FA 4Y2UA 3CUSA 1HA3A 3O4JA 2VOEA 3CONA 3EVEA 2HFJA 2ID8A 1TYAE 2JFGA 4OHYA 4MPPA 4DILA 1E7RA 4MEBA 1EHCA 5JAMA 1N0IA 4KO4S 2PUJA 4MJLA 1KTVA 2WT8A 5T5QA 5SZHB 1OFIA 2PQ6A 3BSYA 3PQ3A 2HC9A 5JPCA 4XM0A 3BD8A 2C7VA 2PT7A 4U9UA 5K2MA 1LNQA 4F4DA 5SYMA 3L04A 1XB2A 2QN2A 4J90A 3H04A 5GM1A 3M7IA 4KXNA 2XYGA 5P21A 3ZIAA 4ARSA 1AKYA 1S3SA 1Q84A 1XTPA 1XP5A 3IUSA 3L46A 1E18A 2C2YA 2WVJA 3QVVA 4EG1A 2IPXA 1IHOA 3DEYX 3WGOA 3DZGA 1PJZA 4Y7DA 4BUZA 5EA2A 1XHEA 4KH1A 4MJ3A 1BXGB 1TZKA 3UZUA 5KHOC 1A8QA 1B42A 3C5HA 1NWCA 1XF9A 3OUZA 4BQNA 4BZXA 3DEKA 3W9SA 3L8MA 4AJEA 1UP7A 3AF2A 1JHOA 3KELA 4CMAA 2Q0XA 1KH3A 5K6AC 1YBVA 1MQSA 3I8OA 4A91A 1U4SA 3DTVD 1ZD4A 2WA2A 3DMPA 3PQCA 4KQKA 1U98A 1HLGA 2OTCA 2P5YA 1MKYA 5DGDA 5B64A 2ODPA 2OORC 1JFVA 3I6QA 1JHDA 3KQKA 4QGBA 1GUAA 4OQNA 1QV7A 1NVMB 3LDFA 4YJ2A 4ME6A 4E2XA 4NABA 3LO8A 1RHKA 3MPOA 4TSFD 1WXWA 1JV2B 2I4TA 2KJQA 5IDVA 3M6UA 3GFVA 2X0DA 4LA4A 3WGGA 4YIKA 1N34B 4Q4AB 4NYJQ 3SVZA 5LLTA 3TSCA 2A9PA 1YZUA 2JA1A 4BMOB 1D7AA 2VTBA 3GCDA 2ETVA 5CDFE 3X2SA 1C0LA 4Q16A 1XJQA 1RYFA 4A5OA 3WZLA 3EVNA 4XJVA 1E6WA 3LWBA 3W9YA 2VR1A 3QLUA 3FF1A 1UPUA 3P9XA 4KODA 5J5VA 5M3BA 2OGTA 4JR2A 1R2QA 2GK7A 4B85A 1DAPA 3DQPA 2JZNA 3LW7A 3O7WA 1VCHA 1QFZA 2NT3A 3CKKA 1W2WB 1RS0A 4MX8A 2JVIA 1U7TA 3DKRA 3SE0A 2JJQA 3HKBA 4W9NC 1AN0A 1KMNA 4XSVA 3NKFA 1FNMA 1PUIA 3FTFA 2C9MA 3LCUA 3BHJA 3UBMA 4EYGA 1MAUA 4V0RA 4Z4CA 2Z09A 3M4NA 3WB2A 4ZO8A 5CBKA 3GWZA 3Q8LA 4Z9YA 3RIXA 1I0IA 3DBRA 3K5PA 2XE6A 3TI7A 3PHLA 2V7WA 3ACCA 4RA9A 2AG1A 4HL6A 2NO0A 1HQYE 1Z6TA 4NU8X 5BVHB 2VQFB 4UMVA 1NSYA 1J0CA 3RIEA 4S12A 5IAEA 3ZWPA 2ZAGA 4P7FA 3NTVA 4LHZA 4CF3A 3A6ZA 1BE0A 2WHRA 1E5QA 4M0DA 1P0MA 4UNQA 4X5OA 4B7AA 3PQ7A 4QPNA 2H7VA 3U7JA 2AN9A 2A7XA 2CBZA 1WW8A 3K0CA 3PB3A 4BLWA 3QOYA 3MWGA 2GTIA 2FPXA 4QPDA 1WCYA 3O38A 4NZPA 1HNWB 1NTRA 5AUQA 4LF5B 3E8MA 4N8SA 1Y3HA 4ZYXA 3S1AA 3ROTA 5TSDA 1AS3A 4UUPA 3ZYCA 5J4HA 1M34E 2O9JA 4H0NA 4AMZA 3EZXA 2P27A 3HMQA 1GXSB 5IT0A 3A4VA 3F96A 4TKVA 3WGNA 3VU1A 5JO9A 1TQ8A 4EG7A 4IO0A 1GIAA 3ICCA 1X2EA 4CKCA 4ARUA 4GXRA 2ZRCA 4LK3A 1L5OA 2YNMA 3PV0A 4QYWA 1YHZA 3UOWA 4B7XA 4BVAA 3C74A 1THTA 5AVSA 3DM5A 4MWBA 3NH6A 2ZAYA 2H7CA 4P3XA 4P81A 5K3AA 1KIAA 1DTWB 3BXXA 4NHEA 1QZTA 3G5MA 3O9MA 3PXUA 5I8ZA 5DK4A 4OI2A 2OESA 2CN1A 1Y42X 1YBAA 2NZ2A 2W37A 3B1JA 3N8NA 2YS6A 1IDOA 4MV4A 3T4PA 4A23A 5L3SA 2F1IA 3I05A 1X3SA 3ITEA 1BXZA 4HVLA 3RTAA 1L5HB 5DYWA 5I4IA 3FVRA 4WECA 4DZZA 1JMYA 2A0YA 3RU7A 2J3DA 4HGZA 4L5BA 5KTMA 4A36A 2JF0A 4DPKA 4EYQA 1ZJYA 4P08A 1C1HA 1ZVKA 3O21A 4B17A 4CKWB 2VYVA 4Z86A 1MF7A 4ZVPA 5C34B 2F1HA 3M2TA 4EHDA 1K89A 1JILA 1TJ3A 3FIJA 5BRJA 1XTIA 1NHGA 4DZTA 2AVNA 4H27A 3IHKA 2QTBA 2XYQA 1DTSA 3PCXA 3VMMA 1XPOA 5DULA 1FFBA 4EWLA 3S5JA 2PU7A 3FTPA 2WP8J 4H0CA 2O5CA 1ZMRA 2JHGA 3LW8A 1LPSA 2PIAA 1ND6A 1U02A 1DZ3A 5DB4A 4ESEA 3EPRA 1MGPA 1W4ZA 3EISA 4DEVA 4INPA 2BF7A 4WOPA 6ABPA 3OM8A 1NVTA 2R4TA 2D2EA 1YACA 4LYYA 5ALIA 1QS0A 4BU0A 3MGKA 2E85A 1C3LA 4AKIA 1R4NA 4KQXA 1I7DA 3I6BA 1QFYA 1IWBB 4LE2A 2J6IA 3M0EA 4MV5A 4NS4A 5LQMA 4BJ3A 1Z12A 5FL7D 3OE4A 4P3NA 2WHPB 3UXYA 3HL0A 4OI1A 2QUKA 3UGQA 2ZE8A 1XRMA 1ZISA 1GL9B 2XTNA 3FY4A 1OH6A 2IPMA 2UZAA 4EKEA 3V46A 3HY6A 3O1JC 4JI3B 1HSZA 3QVGB 3LL7A 4AZWA 3ORQA 3HEMA 1U65A 1XZGA 3E0XA 1B15A 2OQIA 3FETA 3OZUA 4UD6A 3KVNA 4O3MA 5EZ6B 1LBTA 5K1ZA 1ICIA 3KPUA 2QD2A 4XXHA 1IDN1 3RTCA 3I12A 3MD9A 2VH1A 3H2GA 1PZMA 1P1CA 1E1KA 2V4MA 3KR9A 1RZVA 3JARB 1JQEA 4YRPA 4BNKA 1TYBE 2EFDB 4QG7A 3RT1A 3ST7A 1EWQA 3ZGLA 2W6MA 3Q3VA 3SC4A 1DOAA 1Z62A 2BBSA 1G8SA 1C3OA 3R0JA 4MDHA 4R2HA 4WADA 3PXDA 1YKSA 5JD5A 1LDYA 4Q9HA 2V7QA 3EVGA 3GEEA 3JATA 4PICA 3ABZA 3N0RA 1ATIA 3R1IA 4N5IX 4L9AA 1QIHA 1VYVA 2JIQA 4QREA 4HDMA 3TX6A 4OREX 3GLFB 4FYXA 3C3WA 2VAVA 2NVOA 4F11A 1YR3A 1FTYA 3MBIA 4LSZA 3H0KA 3T9FA 1ESEA 5KNCH 1RHRA 2K87A 3W5HA 4Z54A 5F1KA 1H8ED 3GH3A 3W8FA 1RQNA 3COPA 4DV3B 2G71A 4RTNA 2H08A 1T9CA 1LFAA 3ET4A 1JAIA 1ULSA 1H05A 1EYZA 2OSBA 2PGXA 2TSYB 1NMZA 3MLEA 1CY1A 4RHEA 4X95A 4Q6WA 5FULA 1MX3A 2POQX 4HD8A 3KO8A 3VBCA 2QMOA 1Q92A 1P3DA 2A92A 4BNDA 3VFDA 2QOEA 4DJJA 4TVOA 5A7HA 1V3TA 1VBKA 5KSYA 4F1KA 4CEHA 3CRRA 3P26A 2Q8QA 3FGZA 1AZLA 1AV6A 2PZMA 2ZYTX 3TTUA 3UWSA 2IYOA 5FUVA 2JEYA 2BM9A 5LKRA 1AHIA 3JTMA 1CERA 3SNHA 1C8VB 1E1QD 3OKCA 3W5VA 3W5IA 5JOQA 1KI7A 3GQVA 3LVFO 4NBNA 2QF7A 5HWSA 1L1EA 2QWXA 4IQ4A 1US8B 3PXEA 1Z68A 1JQ5A 3B9BA 2QTLA 1EB9A 4MLDA 4L5JA 1QORA 1OE0A 3KJHA 1AK2A 5KTOA 2OP1A 4NY1A 1XN4A 1W85A 4U1RA 3H19A 4M55A 2A3NA 3V4RA 2JKZA 4OQMA 4OVKA 2LPMA 2BOVA 2HPAA 2WU4A 4BQFA 2DLCX 3RSQA 2O2DA 4B45A 3FCCA 4A6XA 1DU4A 4ZCPA 3PGXA 4TWIA 3T5BA 2NADA 2KE5A 2G72A 4R2WA 5JVDF 2X9NA 5J2TB 5B55A 4QG3A 1CQXA 1R6BX 5FAXA 3KQOA 3IUQA 5JW6A 2HYIC 2ZJ4A 2H4ZA 4HXEB 2GN0A 3O91A 3QJYA 3A3NA 3JTEA 4F8EA 4L73A 1M1NB 1YZGA 1D4OA 5ICGA 1JHPA 2DFLA 2J9FB 3MMZA 2I76A 3DDCA 2AEEA 5AI5A 1GPJA 3M4JA 4B4OA 5C1OA 5CUQA 3HYNA 2YOFA 1H9CA 3UGTA 1JIJA 1MCZA 1EFLA 1RIIA 3NS7A 1XWIA 1KVRA 2I4NA 1OXSC 4RV9A 1SIWA 2DVMA 3H6KA 4XW2A 3TD9A 3JPWA 3WGQA 4CCWA 4ZICA 5CB0A 4KJXA 4RU1A 3A4YA 4LZOA 3QK7A 1U8CB 3I9NA 1EB8A 3A37A 4O63O 4RELA 4EK9A 2ECFA 4INJA 1PNQA 1S1MA 1SCNE 5KOHA 1D9ZA 1HDGO 5HJ5A 5M04A 3ONFA 2GM3A 4ODIA 3WLTA 4Q9KA 1SUCA 3H2ZA 3JQ7A 3QRWA 1GEGA 1KZYC 4NNPA 1BZYA 4ZOAA 3H17A 3WFIA 4F86A 3A9VA 4N3CA 3P0HA 3D8HA 1ZK0A 2HPHA 1XZJA 2PH1A 5EJ7A 4FDMA 5CW2A 4RSMA 1E8DA 1E9FA 2F3TA 1C8KA 3DBHA 5AUPB 2RFLA 3A4MA 4AG5A 5FV4A 3ZI4A 3VR4D 1EKXA 2XYHA 2YV2A 1RP7A 3KQVA 3A1EA 4K03A 1WJGA 4R9VA 5F98A 1ONBA 1Y0BA 3G2QA 4QOHA 3I73A 2HXSA 2Y4NA 4EECA 2W2XA 2UXCB 4DLWA 4HUJA 3QLTA 4WJKB 1DUVG 4JODA 4YCSA 3VDQA 3L7CA 4EB6B 2DBYA 4HSGA 4I5EA 5D87A 4DR7B 1TJ5A 1L8XA 3NAMA 1C3VA 1I2AA 1N2CE 5K8IA 1OV6A 2CBGA 3RK0A 1N2CB 1QRUA 2GN8A 2X9VA 2GEKA 3KSUA 1UFVA 4TS4A 4ZVRA 1T1JA 4L8VA 1J7KA 1KOLA 3VOAA 3W2IA 1V47A 4BTLA 1EFVB 1WY5A 3DW3X 1NR7A 1Z4IA 3KZKA 4W8HA 2VWQA 4HLUC 3E4CA 3OZVA 5AHXA 5FTJA 4I7EA 1PTJC 2CHEA 5DISB 8GPBA 2XKAA 5IKOA 2XJ9A 1D4AA 1VA4A 3MGBA 3EZLA 1AC5A 4LXGA 5DFAA 1L1FA 2E6KA 1YDGA 4EG3A 4F60A 1YVPA 4PGFA 3UT5A 1S5PA 4FFDA 5FFNA 1QTIA 1VG0B 2R44A 1HDOA 1XEWY 3GVIA 3L0IB 3QXXA 4IR7A 4QJ5A 3PD1A 5IJ0A 3THXA 4PS0A 1DXHA 3BIFA 3EZGA 3MNFA 2JG3A 2QI9F 3QEJA 2I3GA 2QZPA 2WMNB 3QQ5A 4ZWNA 2B8JA 2R7AA 1F8YA 1H6DA 2CNLA 4EJSC 2HHAA 5E9AA 5KINB 4FOSA 4BCBA 3K5HA 4RFSA 4IDNA 4P7GA 5EWLB 3PNOA 1T0JB 3WDSA 4B0PA 1LRLA 1D6SA 1PF7E 1W36C 5K0TA 1PEYA 1JEDA 1P6UA 3IUBA 2RGNC 4XQ9A 5KNCD 5G02A 2P4UA 1N3IA 1QYIA 4L9RA 3OQNA 5REQB 3ASZA 2SHKA 1NKSA 2MYTA 3AKCA 3HB0A 3IPYA 3L02A 2M2IA 3TEMA 3H3FA 2P1RA 2FJUA 4LWOA 4CF6A 1GSOA 2VKTA 3PITA 4J43A 4XFDA 5EP2A 3U4GA 4BRSA 1G5PA 5KTPA 1C9MA 1H5QA 5EZYF 2ORYA 4EYKA 5FO0A 1YZYA 2BYTA 4Q5IA 1VLQA 5DW0A 1FLAA 1ZUD1 3OOSA 2IT1A 3DBVO 5ESWA 3V7NA 3B3JA 4TV8F 4DR6B 1QK5A 5K8VA 1UPCA 5BW5A 3F47A 1CY8A 5BSGA 4FFBA 4KQFA 2PIDA 2BZ1A 3M83A 1T0HB 3G2HA 3OEYA 3PPXA 3HP7A 5ITZA 3ZQ4A 1XCJA 4BRZA 2O19A 1L5LA 2AKAB 5FADA 1CC1S 2JJYA 4EGCB 4PYJA 3QVTA 4K81B 1OH7A 1GDDA 4Q18A 1SPXA 2A67A 4JJIA 4JQYA 4EUEA 4LJSA 2E9SA 3LQ2A 2R85A 3R3JA 1ZUHA 2IYPA 3HDYA 5KVQA 5T8KA 3GUHA 3K96A 2XGSA 4M9SA 1Z0FA 2A5DA 4R9NA 1XMVA 2FUKA 3GNQA 3CKYA 3GRYA 5AK5A 2JPDA 3H9UA 2CSXA 3SHQA 2FN3A 3NT2A 5H02A 3IULA 1FFCA 5FUBA 3THSA 4E5MA 2I1VB 2H1OA 3PEVA 4ZAZA 4DR2B 1VCMA 5K6AA 5JS8A 1XALA 2OC4A 3M6VA 2XZDA 3DS8A 1FX1A 4YALA 3RQIA 5LQCA 1NF2A 1V37A 4OFXA 4CKYA 2FSFA 2GA8A 2J7PA 5HRCA 3SN6A 1VHWA 1CLUA 3FNRA 2BISA 2OO5A 3MB5A 3GLGA 1M8PA 1L4NA 2P2SA 3FJ1A 1AA6A 5HNKA 2ZDHA 5FOSA 5JRZA 1V4VA 4OYRA 3AP3A 3G7SA 3WL7A 2VPTA 4PLVA 4A6DA 4E3ZA 5HQ3B 2YQ4A 1PX0A 1T5TA 2K6GA 3E5HA 3ODGA 3OTGA 3OX2A 1MDBA 4UJ3A 1QH1A 3GDFA 4MLZA 2WF7A 5DLQC 3QPVA 4F93B 1IATA 2HHLA 1CR2A 4L2IB 3WKCA 3I9V6 4FQ7A 4ZV9A 1TF7A 2ZXEA 3UJDA 3PK0A 2OVFA 3WLQA 1JZQA 1Q7EA 3DMRA 5MN4A 1X0VA 2H0AA 1U0FA 4P33A 3KZCA 3CZ9A 3G9QA 4PANA 1TA0A 4DCMA 5AW2A 1T3SA 3G79A 1GZHB 5JG7A 2VHXA 5CITA 1KK3A 4B3TB 3ZGYA 2FMIA 4BMVA 2WYHA 1AG9A 1O6FA 1XNHA 3OPQA 1JZTA 4LXYA 3RS2A 3GBSA 3LNTA 1BEZA 4DARA 2JS7A 2GZSA 2I7CA 3UUWA 2N75A 1UIMA 4DV1B 3L6CA 4QICA 4DLNA 1W8IA 4KDCA 2QRPA 3D2AA 5TB5A 1SY7A 2XOKD 1IEVA 2CE2X 3UB3A 3ZGNA 4HQNA 2ZRGA 1KY4A 2J3LA 2P6NA 3BM5A 4R16A 1TTTA 3U4HA 3K8QA 3VSDA 2HKIA 3OIWA 5FYQA 3BYZA 5FA5A 2P2CA 1L4YA 3EIUA 2QN6A 2E5FA 2JFZA 1CTQA 1KVUA 3CO5A 1EM8A 3OD5A 3IIEA 4FXPA 2Q7OE 3ZJYA 2QORA 4MDYA 1GL6A 3KSZO 4B2PA 4UULA 1J24A 3N39C 2WIFA 4CM3A 3UHPA 1LPAB 1PK9A 1ZL2A 3JD2A 2GPSA 3IR7A 3ZCSA 5JZMA 4FR5A 4DYHA 4FZJA 4KQ1A 3V1LA 1ZC3A 4DIFA 3TCKA 3GCWA 2IIBA 2QAJA 3QHPA 1NVFA 2HMSA 4TLCA 2PRYA 1G291 3VNVA 4LJ5A 3OZIA 3MBKA 1BMQA 2Z8XA 3IESA 2O0HA 3AOGA 4RKYA 1AM4D 2I2XB 4TTAA 1JQLB 1QHGA 2OILA 2R96A 2QRJA 5TGDA 4ZN6A 5K20A 1L9XA 3E7FA 4NCHA 5TY0A 3FKQA 1G63A 1E5LA 2ILTA 1KYYA 2GX6A 2VJMB 3RD5A 4BFZA 3P9ZA 5GVSA 3WGVA 3NC4A 4QULA 2VYVD 2F00A 1N0UA 4DM4A 2GYUA 2VRCD 2OM2A 3JCZA 1BJKA 2C7GA 5ECGC 3WDKA 4LF9B 3GD5A 1WO8A 2GETA 3BE5A 4LUCA 1YBFA 2BMVA 4H9GA 4WTOA 3U3JA 4AC9A 2CV2A 1QLJA 3DG9A 4PSVA 4UM8B 2WMOB 3N2LA 2RI0A 2HZ7A 3KTAB 3REFA 1W7AA 1CE8A 3A25A 3LUKA 2RCYA 4ZHQF 4QUIA 1ECJA 4XGKA 5LP6B 3GAMA 3OLWA 1EVZA 2Q45A 1RWOA 2QW8A 2EWMA 3EVBA 3KJIA 3MYRA 4JVSB 4BFCA 4EG5A 5BRAA 3UAZA 5HOEA 2DUWA 1QPGA 3NIWA 4P4TA 4E2WA 1FVXA 1FRFS 1Z0JA 1Z7GA 4J4BA 2AJTA 5L7TA 1JDVA 3EFEA 2X9LA 3I64A 2FKNA 2WZBA 2CNNA 1PLLA 2XW6A 3TQOA 4D8TA 1YFJA 4YRFA 1E0KA 3MWFA 1GTL1 2GGSA 2HADA 2CVZA 2JB9A 1QP4A 2V5UA </