3RVSA

Structure of the cheyn59d/e89r tungstate complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
130
structure length
130
Chain Sequence
HMADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing Mechanistic Similarities between Response Regulator Signaling Proteins and Haloacid Dehalogenase Phosphatases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
total genus 47
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3rvsA00
4YWHA 3HDGA 2FW0A 3FFXA 4W5TA 2KYRA 1MIHA 1DRJA 1NXTA 2E4WA 4G97A 4RXUA 3GT7A 5FWXA 1ZH4A 3OLWA 3N0XA 3SM9A 1VPWA 3KS9A 4OATA 5IC5A 3RVSA 1WETA 4EYGA 3GRCA 5B3JC 4KK4A 5JNWA 4KREA 3DLHA 2TMYA 3NNSA 4MR8B 1H9CA 1NXXA 1SRRA 3CKMA 1FFSA 1FQWA 1JL3A 1YS6A 3OLVA 1M5TA 3QELA 4IRXA 3IP7A 1USIA 3Q7TA 4RDCA 4ETIA 4RXTA 4JOQA 3QEKA 4TLMB 4ZMSA 4F11A 3QEMB 4YS6A 3KTOA 4QICA 5IX8A 3MF4A 4WUTA 3RVRA 3TMYA 3C3WA 3UKJA 3DGFC 3I5AA 3O2JA 1DC7A 3C3KA 4EVQA 1QO0D 1JBEA 3D8UA 5EWLB 3QK7A 1USGA 5HM6A 2JVKA 3H1FA 2L19A 4EGSA 4LE0A 1DCMA 1E2BA 4QYWA 5EWMB 2LP4Y 1QPZA 4MS1A 2JRLA 4ETMA 2F8TA 4Y9TA 1VKRA 1QP0A 4KRFA 2FEPA 3QLVC 2JBAB 5B3JA 4F12A 3JPYA 1QP7A 2WJWA 1YTUA 3HM9A 1GLGA 4P1ZA 4KZKA 1XWWA 3KYJB 3TD9A 1CEYA 2FN9A 5JS2A 4IGAA 2PE5A 2CWDA 3H75A 4PICA 4XLTA 2ZWMA 2PUEA 4Z4FA 4YCSA 3BREA 3CG4A 4XFKA 2CD7A 3QELB 4O1HA 1PEAA 3HCWA 5TQ2B 4OBBA 3SAJA 1F51E 3BRQA 1TJYA 2QV0A 3FDFA 3HSYA 3LFTA 4XAQA 4ZMRA 4N47A 4MS3B 4IMJB 3BBLA 4DADA 5T3YA 1DZ3A 1ZITA 2FEKA 2MSKA 2VUIB 3K9CA 3L6UA 3T8YA 4Z4GA 3DLBA 3OLZA 3H5TA 2F8SA 1ZY2A 2QXYA 4LZLA 1U0SY 5EWMA 4OG2A 5JNTA 3VNAA 1NXVA 1JF8A 2WWVD 2P4UA 5IEBA 3C6QA 4LE1A 4P98A 4D6XA 1P2FA 2FEWB 1I3CA 3ROTA 2FXIA 1NXSA 3IDOA 1VLZA 3KSMA 2NZUG 4MS4A 5E3JA 4LX8A 2QVCA 3Q41A 4G0OA 2RGYA 5TPWA 5TQ0A 3SNKA 1JFSA 1PUXA 1M5UA 2WY2D 2QR3A 3CS3A 1EWKA 3GV0A 3O1HB 1KMIY 1A04A 1M2FA 1ZN2A 1U2PA 4RY8A 2Q5CA 3KJXA 1Z25A 4YP9A 4KQ9A 5JNUA 3BILA 1ISSA 5HQJA 3HUTA 3KLNA 3CG0A 2A9RA 3CNBA 4RY0A 4O5AA 3TX6A 2FMHA 4YLEA 3N0RA 1EWTA 4MYRA 4YGXB 1ZGGA 2IPMA 3LUDA 3R0JA 5PNTA 1ABFA 3T38A 4KFCA 1NXOA 3Q9SA 2PMCA 3O2QB 5C5CA 3O75A 4TLLB 2YHAA 2P9HA 2MYNA 4JASB 5IUNC 2DRIA 3L49A 4QYMA 4F8JA 5EWLA 3A3KA 2FQYA 2B4AA 4HNQA 2VUHB 3G1WA 4G0QA 2PUCA 3MMNA 4QPJC 4G0ZA 5EWJA 5IUJC 4MS1B 5JNSA 1U2QA 4RK7A 1AB5A 2HJ9A 1ZHHA 3A0UA 4N0PA 4FB4A 2ID7A 2IOYA 3P9YA 4JAVC 4NICA 3FFTA 1QNLA 4KVFA 2HQBA 1KRXA 3W9SA 4W5RA 4XASA 2GI4A 1P6QA 1JYFA 1DBQA 2CHEA 4DQDA 3EAFA 2L17A 3KKEA 3LKBA 3IP6A 3QLUC 2PAFA 3BRSA 1LJLA 1PNTA 4MLCA 1K66A 1TM2A 4RK1A 2PUFA 3NHMA 4Q7EA 3OQNA 3EDCA 5KQLA 5BQ3A 2PJUA 3LOPA 4JB0A 4NCAA 1LBIA 1QO0A 3M6MD 1Y1LA 2FKAA 1Z17A 2X7XA 4MQEA 2PL9A 2OQRA 3F7NA 5FWYB 1B00A 5EWJB 3CRNA 3MIZA 3I42A 5DCLA 4F06A 2IDMA 5KQGA 2RJOA 1YK1A 3E3MA 4RU1A 1OXKB 1RXEA 1Z12A 1Z18A 4KV7A 1MB3A 2A9OA 1TLFA 5BR1A 3H5VA 4G0YA 2NT4A 3EQZA 1JFTA 1OXBB 2HPHA 2R4QA 3UK0A 4NQRA 3C3MA 1JH9A 3HO1A 1ABEA 1JDNA 1D5WA 1URPA 3B2NA 1RZRA 4Z9AA 4Z4IA 5TPZD 1JFVA 2HQOA 2L2QA 1A2OA 4FE4A 2FLWA 3DGEC 3EJWA 1GUBA 4OLAA 2LUOA 4RV5A 2QSJA 4HNRA 4YR7A 4KNYA 4EYKA 3F73A 4ZJPA 3H1GA 3KHTA 3N0WA 4LDZA 1BDJA 1NATA 2J48A 4MR7B 3JVIA 1ZESA 4MR8A 1EAYA 3RVJA 2WJAA 3IPCA 2JK1A 4E7PA 4XARA 3FGZA 5D2CA 5T7BA 2A9QA 3H6GA 2ZAYA 5TPWB 5BRJA 1UDRA 2JBAA 2R48A 5DLEA 4RKRA 1IIBA 5KQPA 1DG9A 3I09A 3OLXA 4RS3A 1KRWA 4HYEA 3HXMA 4RK4A 3O2SB 3N8IA 1L5YA 4CBVA 3H5OA 4ZPJA 1A0OA 1MB0A 1HEYA 3G85A 4OLBA 3NBMA 2MYTA 3KCNA 3OMXA 4Z99A 5KQMA 1Z13A 1EFAA 2PKXA 1RXIA 1Z15A 2PUAA 3GBVA 3SY8A 1QKKA 1LK0A 3N6VA 4JA2A 1C0EA 4RY9A 3C97A 4MS3A 1FSPA 3OQOA 3TB6A 3IP9A 3QEMA 5DGCA 4ML3A 4G86A 1D1PA 2GKGA 1JHZA 4RK6A 4Q6BA 5HKOA 1JWLA 4L4UA 1E6LA 3OLYA 4S05A 2JVIA 3CTPA 2ID9A 3OO1A 2E4XA 4ETNA 2FMIA 3QX9A 4MR9B 3QLTA 4G0PA 5ABPA 2LBPA 4Z0NA 1QMPA 3K4HA 3GBPA 2AYXA 3JS5A 4XXHA 1CYEA 2GBPA 1BAPA 3EODA 3HZHA 4MS4B 1NY5A 3EQ2A 4RSMA 5IBQA 1ISRA 4TN5A 1RZRD 7ABPA 4IILA 4RXMA 3HEBA 1EWVA 3H5IA 3LUAA 2E4UA 1GCAA 2W42A 4MRMB 1BDHA 3M9XA 1E6MA 2MSLA 3MA0A 4W5QA 4MGEA 3OM1A 4KQCA 1ZGZA 2IYNA 3NHZA 1LJUA 3DZDA 3O74A 4Q6WA 4EYOA 4W5NA 1ZH2A 3ILHA 5DTEA 8ABPA 5DKFA 3Q7RA 3HDVA 2NZVG 2NT3A 5F64A 1F4VA 4N03A 4KMRA 5FBKA 1Z2DA 2FVYA 2H0AA 3GYBA 4IF4A 1DCFA 1SXIA 2QZJA 2L18A 1PNRA 1SXGA 3ROFA 3UUGA 5GQSA 4PE5B 3I45A 1EHCA 2FLKA 2FN8A 3OMWA 3EGCA 3CFYA 4DN6A 4TMYA 6ABPA 2IPNA 3URMA 1K68A 1VRVA 2FMFA 2FMKA 1GCGA 3QLVA 5FWXB 3LUFA 1C4WA 1YS7A 4UHJA 4MAAA 3KYIB 2CHFA 3HVRA 4WXMA 4EVSA 2WRZA 1YIOA 4EYQA 1PHRA 4IMIB 5CNIA 3H6HA 3GA5A 1NTRA 4Z4CA 3OO0A 3JVDA 4MRMA 3TO5A 4LDAA 2E4YA 4MPTA 4PEVA 2IPAB 4F3TA 3D02A 1U04A 2RDMA 4Z4HA 3Q7SA 3OQMA 2HQRA 2PUBA 4M88A 5TQJA 3RVNA 1JX6A 3F6PA 3FMVA 1GUDA 3LUKA 1RNLA 4EUKA 4NCBA 3T6KA 1MAVA 5TPZA 1FFGA 1DRKA 1BA2A 3ILYA 1J56A 2GWRA 2MSWA 4RK5A 5CNKA 5TQ2A 1LBHA 1P6UA 5GOTA 2OENG 3CZ5A 3QX8A 3IPAA 5CNJA 4N41A 3M9WA 1D1QA 2YHBA 3CLKA 2R25B 3H5WA 1ZAYA 2M98A 3RVKA 1TVMA 4LRQA 1RPJA 2QVGA 3N75A 4JB2A 1MVOA 9ABPA 1DP4A 4YO7A 2WB4A 3H1EA 3O1JC 4MLDA 1YMUA 2NUBA 1T34A 3LKVA 3RVLA 4GNRA 3JPWA 3LTEA 4H60A 3S99A 5ED4A 2B1JA 1E6KA 2I6FA 4PZ0A 3OM0A 5KI6A 2QW1A 4N76A 2QU7A 2AYZA 4Z9BA 2VYCA 3F6CA 4B09A 2FQWA 1YK0A 3QLUA 5IULC 2JB9A 1S8NA 1DBWA 5FWYA 4UHKA 3HJFA 3VNBA 1DJMA 4G0MA 4NV3A 4JP1A 1AB6A 1CHNA 1APBA 1SD5A 1ZDMA 4MQFA 3DBIA 2R47A 1QQAA 5KWSA 3HV2A 3IP5A 5JS1A 1L5ZA 1DBPA 2FQXA 2GX6A 2IKSA 2VK2A 3MQ4A 3O1IC 1USKA 4GPAA 2N9UA 4MR9A 2HSGA 4S04A 2O20A 3E61A 1R8JA 2MYUA 3A0RB 3EULA 5KC8A 3NNNA 2PLNA 1QP4A 4G0XA 1BVHA 3LUGA 4OTZA 2PUDA 3RVQA 5JNRA 1DCKA 4ZYLA 2E4VA 4PYRA 1W25A 6CHYA 1KGSA 1QQBA 2WMYA 5KC9A 2M1ZA 4KPYA 2LIVA 3KG2A 3LUCA 4RWEA 2V0NA 1D2AA 3LUJA 4RKQA 2JVJA 3RVOA 4H3KB 5CNMA 4EY3A 4YV7A 5BRAA 5C5EA 2IPLA 3RQIA 2LPMA 1M2EA 5TE9A 3FFWA 4WT7A 3CHYA 3RH0A 2MYPA 4FE7A 2A9PA 4MR7A 1ZVVA 1Z2EA 3Q15C 4H3HB 5HSGA 3GL9A 3H5LA 1FFWA 3LUHA 1YVUA 4E7OA 3JTEA 3NNDA 3MYYA 1TMYA 5I4CA 2XDYA 1JLKA 3KLOA 3MM4A 5CHYA 2PUGA 5FBHA 4WXEA 4Z4EA 4N0QA 3N53A 5IUKC 1JDPA 3GWGA 4WWHA 4KK3A 1DC8A 4MQEB 3HUUA 4MQFB 1PEYA 3RVMA 5TQ0B 1NXPA 1P8AA 4LE2A 1NXWA 2FSPA 3O21A 5JNVA 1BDIA 4RZSA 3A10A 3RVPA 4D74A 4EVRA 3CZCA 4L85A 3HK2A 4O1IA 4D6YA 1Z16A 3SG0A 2E4ZA 5IEJA 4W5OA 2BGGA 3CU5A 1SXHA 1YMVA 4WZZA 4HNSA 3SQNA 1Z26A 1D4ZA 2JCGA 1XHEA 4YRZA 3JY6A 1XHFA 1JYEA 2H3HA 3HS3A 1U8TA 2FTKE 2PL1A 3LMKA 1W9HA 3T95A 4RK0A 2RJNA
chains in the Genus database with same CATH superfamily
3SS9X 1ZL0A 1KIMA 1KDPA 1O6GA 1B1AA 1PWYE 4MI9A 1KO4A 2A0UA 2H9AA 1FDVA 4Z8YA 2NO7A 1PNVA 1JAXA 2WIKA 2CMFA 2DH5A 4M99A 4Y9SA 3TTTA 3GFRA 6NULA 5BVGB 5HM8A 3UJHA 3GIDA 4OMFG 3U48A 1T2EA 1T3TA 4S24A 2VNJA 1RYMA 4C43A 4C6RA 4YUWA 2RE8A 1PJRA 1EDOA 4JVMA 2DG2A 3W77A 4ARVA 2QSUA 1CDZA 3IP7A 2I3BA 4BKOA 1IM2A 4F4FA 5J4LA 5LR6A 5EUMA 3A3OA 1J24A 2NACA 3D3WA 5FTKA 2OYRA 4X8MA 1UJBA 4QLOA 5ELLA 3UFBA 1Z35A 4BUZA 3TMYA 3GJ4A 4LRTB 3WGVA 3UKJA 4V0KA 1BJKA 1EVLA 3HPRA 1GEGA 4BAZA 3L79A 3BE6A 1BKDR 1KY2A 1W76A 4L1KA 1DJPA 2XSZA 1OIXA 1VI6A 1Y9JA 1ZUWA 1AUXA 2JA1A 3IEKA 3FNIA 5A4MS 8OHMA 5AKGA 2ZAIA 5EHNA 1LS6A 5KOYA 2YW2A 2PAAA 3JQAA 3PPWA 1NYLA 4OH1A 4CKEB 4AQYB 2PMWB 1DOZA 1UXGA 3K1ZA 5F2KA 4D8YA 2O1EA 3VHXB 4D56A 1CJSA 1EM8A 2NTYC 3FTDA 3JSAA 4HEJA 4U0KA 3WGQA 3L7CA 4EDHA 2GZHA 1TVKA 1ZWKA 2Q45A 5IF3A 3IHKA 1YUMA 1H5QA 1KK1A 4XPIB 1ZK3A 3HDQA 4UZFA 4X93A 5EEHA 3C16C 2QAGC 2FN9A 5JD6A 1X8LA 5JBIA 1CY2A 3FCAA 1SBNE 4US2R 2R1VA 2VRCD 4IP0A 3U44A 1J42A 3M83A 1L4MA 2WNSA 3DZFA 4KUEA 1BQEA 4WOKA 4ZOBA 3TTXA 2V8OA 3PEVA 3L84A 1NTOA 2ZYSA 4RANA 1OAKA 3ESAA 2FR8C 3NHYA 1M6HA 3C7AA 3DOFA 3TX6A 5BRNA 3SQXA 3TTSA 3MRXA 1AGNA 2MSKA 1I51A 4PTLA 4Q00A 4E08A 4J0CA 2JLZA 2P4SA 1CQPA 3Q40A 4PZ9A 5CPBA 5DTQA 5KPDA 2W90A 1AS3A 5D01A 1XU4A 2BBOA 2C2XA 4Y2RA 1W48A 1GN8A 4FDMA 1KWGA 4L8LA 4OL9A 1FFCA 1QTNA 1HDCA 2QQFA 2QXYA 1TTTA 5HG0A 4FCCA 5ECYA 4LUCA 1OTHA 1B43A 2XI4A 2PO5A 3PEFA 4PNEA 1NPTO 5K05A 1QTQA 4BFTA 4B3HA 1GILA 3HN6A 1ENYA 2BMVA 4PO1A 1O94D 3B3JA 2YZKA 1D7AA 2GLTA 1OVGA 3ZNNA 2CZCA 4MYHA 4KYTA 4LV8B 3EPKA 1BD4A 4E4YA 1E4VA 3DUFB 2Q4DA 2VWPA 3JD3A 3W90A 4GR4A 3SXUB 1EVQA 2FPUA 3BHNA 2NVOA 3H9EO 3FB1A 4WESA 1U1CA 4KFUA 1WXWA 5DCUA 3REFA 4AUNA 2BTQB 2GXSA 1O03A 1SVOA 3ANXA 4U0JA 3ZWWA 2O57A 9ATCA 1X94A 2CGEA 2QTWB 3QPAA 4ZRMA 4YQZA 1W4CA 4YI3A 4EBBA 4JL6A 1U1DA 5C8YB 1DHRA 4CEJA 2FHSA 1ECGA 1N0WA 4JQYA 4ND4A 5CX1A 1GPNA 2GGSA 2ZRHA 3AUSA 3PEEA 5B57C 1C1XB 1FVFA 1S89A 4PC2A 5FBLB 2JIOA 2H1WA 5JFGA 4HAXA 3H4MA 4RD1A 1X2EA 4KDFA 4Z0HO 4KXFB 4TLLB 3VSEA 3EEOA 2YHAA 1G5TA 3MJEA 1N6HA 1QP8A 1L8LA 1SXJC 2ODNA 2P9HA 3QPWA 5AKLA 3L49A 3RARA 4MYDA 4BNMA 1G7SA 1UBOS 1JDJA 1L7QA 1J0BA 4LF7B 1JA1A 1HMPA 1Y37A 5EGNA 4D3DA 4UVEA 5KYYA 4QPJC 3QY0A 2VXYA 2YMLA 2YVAA 1WDMA 4L16A 1SQ0A 3SSNA 3GMTA 1YGPA 2OHIA 2P9CA 1OWNA 3HUDA 3LFHA 3QTLA 4FIDA 5AJUA 4W63A 3SYNA 2E3JA 5JDIA 1AX9A 2OHHA 1U0EA 5DIFA 4OX9B 2AX4A 2FVXA 2WD8A 3B13B 3BA1A 3PGLA 4Z7QB 4KN8A 3B52X 4MUHA 2CMGA 2Z5FA 4I99A 2YXPX 3AQ4A 1TF7A 3I3OA 3P71T 5FL3A 3MINB 2VJBA 5KCZA 3VYTB 4AUKA 1J6UA 2V7PA 2CV2A 4JFRA 1LX7A 1DV2A 5EXEA 3PTAA 3CURA 1VQ1A 4RHYA 3LKBA 4JJZA 5AM3A 3VVMA 2FPSA 3EXAA 5HQ3B 2R9VA 2VEDA 1TM2A 2W2MA 5K45A 2VH5R 2FPPB 4MJ3A 2KBFA 1KI7A 2BHSA 4DW8A 5JBNA 2ZI6A 4ITUA 4QBIA 3X1XA 1KVTA 3JQ6A 1N2XA 2C7RA 3P96A 1QVRA 3F4KA 2JEZA 5D1NA 4ZAYA 4DLTA 1O54A 4HFJA 3G0CA 1Z0IA 3MWFA 1FVXA 2E21A 4J3FA 3C85A 2Q46A 3SZRA 3AR3A 1KBOA 3OE7D 5CIQA 3N39C 3WGHA 3HP1A 1E2NA 5DCLA 3S2IA 2K2QB 5KQGA 4TL7A 4AJ1A 4HXEB 4FYWA 3A6JA 2HIMA 4H4DA 4JP5A 4NATA 3SWWA 3IDAA 4DDVA 1P3JA 3DWEX 1F4LA 3SBDA 3M1LA 1SUEA 1T8PA 2H7XA 1U2ZA 3DJYA 5EXSA 4LF5B 2EFGA 5EJ5A 5L4LA 1TYZA 4RE5A 1P72A 5BR1A 2ZIXA 3HYRA 2QVLA 3UA3A 2DBQA 2R4QA 3HDHA 3FZQA 3H4VA 3M4XA 4B6SA 2AJCA 3HKEB 1DKPA 4KN9S 4QXRA 4DILA 5A0TA 3AB3A 3A2NA 3HVIA 3W3AA 4K9RA 1J06A 2QRNA 4NMXB 1TU4A 1BX3A 2XY4A 3EW9A 3F2IA 3WK5A 4EIWA 4EYKA 3GJXC 3PJDA 3DDZX 3RHTA 3UWDA 2YXEA 1LTHR 2GZAA 4I4IA 3UYLA 4CKWB 2UXCB 4P0TA 1N9GB 1ND5A 4HPWA 2YY5A 4MRVA 3RC7A 2ZZMA 3F5FA 4Y1GA 1AGRA 4EF4A 3QJ5A 4ND7A 3AI1A 3E1KA 1AUQA 2V8BA 1BZYA 3FKQA 1UFQA 5SY4A 3CNHA 4QTUB 3I9MA 4R8RA 3C5WP 1UEJA 2QI9C 2BBSA 3L1VA 4QU0A 5ALYA 2B5VA 4IKEA 3TLYA 5A5VA 2HK9A 4FYVA 4YT8A 1RWXA 2AOTA 3I09A 2CY0A 3NT5A 3I83A 4K6FA 1IY8A 3NS7A 5AOAA 5AVYA 3TGPA 1ZUD1 3ROKA 1GZVA 3V6MA 4CM9A 2ARKA 1LPMA 2OR3A 3FMFA 5B6JA 3VZCA 1NBIA 5HW0A 5A62A 2QRHA 5IH3A 4UATA 4DR3B 3U4QA 2DQYA 3JQRA 1Z15A 1IOLA 2PT7A 4H1VA 4CLOA 1Y33E 1XCLA 3NR2A 3V55A 3VOAA 3ILXA 4R81A 1VHTA 2LXNA 3P97A 1LK0A 4MITA 1KMMA 3N6VA 5D3QA 5GV8A 3BCUA 1D3AA 4MIKA 4OXIA 4DNOA 5CMLA 2IK8A 3D9QX 3FWNA 3O8QA 3IE0A 1AHHA 1AS2A 1V1RB 2AOVA 4KQ2A 2HZBA 3UOAB 1F8UA 2PSFA 2FDRA 4ASUA 4ESEA 3L1JA 2FQQA 4HB3A 1HNZB 3LHIA 4BQIA 1P2VA 1R9MA 1TZMA 5AHWA 4CETA 4IHJA 3THRA 2WI8A 4AJLA 3M81A 3I9V6 3A6GA 2QK4A 4ZAFA 3QE3A 2X9GA 4LEIA 1D04A 3EFBA 3GZTB 1KYVA 2FK7A 4DQUA 4TXNA 2WSMA 2BKVA 4Y6OA 1JPJA 3A1UA 3EODA 5G4KA 1R8SA 2H8GA 5HZMA 1LPPA 1V26A 2DLDA 1VBMA 3H87A 1P44A 4IDHA 4KSYA 4WKGA 5BNFA 2JFGA 3KT0A 5E3IA 4OYYA 3KAKA 3F9IA 3GRKA 1FTWA 3TEJA 1JG2A 2AI3A 1N2CE 2ZRQA 4ITRC 1I4OA 2DFVA 2EIHA 1OHHD 4CI0B 4OJQA 3MA0A 3BMNB 3GPDG 5C8XA 4HQLA 3RS7A 3BC1A 1YKFA 5U1PA 1P29A 4MIYA 3HFSA 5A2GA 4RA9A 3BF7A 1U2SA 2CFCA 5DKFA 3VPDA 1U90A 2NXCA 1IXSB 1NY6A 3HDVA 3OFSA 3Q6IA 3NETA 3G2QA 4OK6A 5F64A 3GFBA 4AWXA 2OLJA 2Z9BA 1V16A 4RH1A 5AVQA 2GM5A 1DEKA 4MQMA 3EC7A 3FCEA 1EMDA 2G40A 4N9WA 3WIVA 1QGED 3YASA 3AUJB 5DM70 4HD8A 4LPSA 1AGPA 3ZE7A 3LQ4A 4I55B 5GQSA 2DUUA 1EHCA 5FPQA 1YH3A 2J6BA 4RIFA 3O95A 1U28A 2W2OA 4XD7A 3A9TA 4EA7A 4ZT4A 2ODQA 2X0FA 3PDJA 3C3DA 2OLEA 1QCYA 1W4RA 1GCGA 1X7XA 2KW5A 1NT2A 2FUEA 1V11A 5AW9A 4BP9A 2YASA 5JATA 4D43A 2CLKB 1JIJA 4HPXB 4YBRA 1P1IA 1Y3HA 3ZXUB 3EXIA 1ENPA 3FHOA 4PVCA 1FE8A 1NIPA 3DE6X 4YMWA 4U6NA 2AJLI 3WZ2A 1W85B 1V71A 3H2BA 3KQQA 4RHCA 4F56A 2AG5A 3BTSA 5A6SB 3FROA 4PEVA 4QBKA 5EP4A 4ZU3A 4ZK2A 5FX2A 1PRYA 2RDMA 2AB0A 2QQEA 2WJHA 4W9RA 4Z4HA 1U8CB 2GN6A 1A96A 1PZFA 2GLUA 2ZRBA 1EXNA 3UMJA 4BJ1A 3BSWA 3OEED 5T6BA 3RFUA 4RIEA 3QX3A 1EJ0A 3FI9A 4CEIB 4DF3A 2PX3A 2Q21A 4EQZA 1RP1A 5JAPA 1E3WA 3K9BA 1EBBA 4J16A 3DOUA 2BFBB 4C20A 2P9YA 4FZRA 5AJHA 5SV2A 3HZRA 3BBPA 4G1CA 2OHJA 4RWZA 4WERA 1L7BA 1O94C 3HXQA 2G71A 2O1XA 1VCHA 1NXQA 2R25B 2F1JA 5H83A 2J09A 3KFVA 4KBYA 5FF9A 1Q6YA 3GJRA 4P33A 4JB2A 4ZP1A 2W37A 3EEFA 1P4JA 1I4WA 3MCUA 4UXIA 4BDSA 2VHYA 2YIMA 1PV1A 4YRGA 1LC0A 4RM2A 1VMIA 2GF9A 4J7AA 1W0KD 4PIVA 3SJUA 2Y4OA 2I2DA 2BONA 2EKBA 3A1NA 3MZ0A 4DLPA 4IV0A 4PF1A 5AJWA 5AOVA 3OM0A 3UBTA 3LXMA 1M74A 3BE5A 4DMLA 1RBMA 1JZQA 3DXXA 4J1SA 1M75A 1QG0A 1IAQA 2AYZA 2IY9A 2MR5A 2P62A 1ESDA 2C61A 2HHCA 2F00A 2I3DA 2UZ3A 3A6DA 3N76A 2QTTA 3IT0A 1PQUA 4HOYA 5K6TA 2JB9A 2JLRA 2YHIB 2GUWA 3MCWA 3QKSA 4ZO4A 3T54A 4LYHA 3KQUA 1NOIA 4G25A 3LH5A 4WVLA 3TZCA 3KXKA 1RI2A 2C7OA 3ZHQA 1JSLA 3BAZA 1AKTA 2ZTMA 3PQ2A 5F23A 2YV4A 4NBVA 4PZDA 2ZPUA 4P3PA 4TX1A 3F96A 2F8LA 3G17A 1MTZA 4RTPA 1JPVA 2QRVB 3HPQA 2I22A 2BMDA 1E1QD 1VJDA 2VK2A 4G1EB 4XYBA 2EG9A 4JGGA 3ZU2A 4C01A 1EXDA 2WPDA 1V5WA 3EF0A 3Q8KA 4TRJA 1QGZA 4J8PA 4BNKA 4XGNA 5TLSA 1FPMA 2XHEA 2AZTA 4M1ZA 2GF2A 4R1MA 1J20A 4WE3A 2HSZA 3X2EA 4DXDA 1IULA 2HJHA 2BZGA 2E5FA 4P35A 1IBLB 2VXOA 4LKRA 4CCSA 5E7QA 3WGLA 4E5NA 2OFOA 3AHJA 3NAQA 3MB5A 1WBJB 4K05A 3HXTA 1JFLA 1UFVA 3EXHA 1CRQA 4KSCA 1KGSA 1U3DA 4HL6A 2W83A 3WI7A 2H08A 3FFBA 2F7SA 1RFLA 4Q12A 4ZU1X 3DEFA 3IKJA 5CD1A 3K6SA 2CNWD 4LBYA 2Z4TA 5ALOA 2JD0A 3LY8A 4KO1S 2JIPA 2HMWA 4E94A 1DLIA 1G38A 2ZUUA 5ERXA 3FFWA 3VH4A 5HJEA 1F2UA 4J3NA 2ID4A 3TR5A 1ESZA 1EUDB 3FBGA 1N1EA 3AX6A 4H3HB 5F1OA 2FSGA 2I67A 3SJCA 2PZAA 1ZSVA 2GJSA 3AERB 3AYZB 1KGDA 2AI2A 3FDIA 2J31A 3GB9A 2ZAMA 3MYYA 4X6UA 3WGNA 3FBWA 5CGZA 3X1DA 4H3VA 3H05A 3H9BA 1ORVA 3I1IA 3CKKA 3KSBC 1VA5A 4J43A 3VPBA 4BU0A 1FDWA 2REBA 2IV2X 3SSMA 1JT2A 4EFNA 3GGJA 3UMCA 5K3EA 1DAPA 2R62A 3M1IA 4KK3A 1F5NA 1EVYA 4KXLA 1T4BA 1SG9A 5AI0A 1E5DA 2Z0MA 2VO1A 4YRDA 3OG9A 1G4UR 1ZGCA 3AM4A 5DB4A 5BYKA 1RABA 3ZLJA 4DRYA 3LRPA 1RAEA 1K6XA 3QWFA 4YJHA 5C32A 4XYGA 1QFYA 1UP4A 2OKCA 2C00A 1ZD2P 3CRVA 4QOHA 1NONA 3CZCA 2VF8A 2Z4RA 1IN8A 2RKWA 2MWMA 1YDFA 1SHUX 1XDUA 3GJZA 3WWOA 3KDSE 3UJ7A 4Q66C 1Z26A 4NH0A 4X92A 5CLIA 4YCJA 1O9GA 3JQAB 5FBVB 3S7ZA 3WX0A 4NZPA 1BSVA 3LM8A 4KX5A 1P1RA 3MT0A 4W1PA 1TJNA 3SF0A 3FTEA 4D9FA 1G2IA 1KH2A 1L6IA 1NM5C 2QNIA 4Q47A 2IELA 2SKDA 2VYND 3D8NA 5JARA 4CCYB 2ODBA 3LCVB 4B32A 3NVKI 2EF1A 1OLXB 2QPLA 3CEPB 5CUQA 1WB5A 3C6XA 2K7ZA 1QIMA 3TZ6A 1PCXA 4UM7A 4X44A 4RHTA 1NZDA 1KP3A 2VSXA 3GI1A 4PY2A 1M6NA 3TLGB 4B4UA 3BWBA 4MUXA 4LG1A 4DV7B 1XLWA 3R8CA 4Y6SA 2QD4A 2ZG6A 4WBNA 5BNWA 5JSQA 1NR5A 3L7YA 4B3GA 2OD7A 3GMSA 5AW3A 4M86A 5FO0A 2WT8A 4PQEA 4TLMB 2ZKLA 3EMBA 1GYQA 4ZEMA 2QF7A 4KAFA 3KTOA 5IBPA 3ZJUA 1BWQA 4IDOA 3MVEA 2DFLA 3A70A 4IDEA 4DJTA 4QBTA 5JDCC 4NENA 2MCFA 1U1EA 2ZYIA 4Q9NA 2IOFA 5AM5A 3FZGA 4DLAA 4DHEA 2AGVA 5DASA 1GGHA 2GZSA 2JGNA 4AULA 3ZNQA 1P5HA 2CFSA 3Q1KA 2ACEA 3LLMA 2C78A 3HCBA 3NBAA 5K3FB 3PFHA 1K6MA 2VJNA 3U16A 2P1DA 3FYCA 1ECLA 1MJNA 3SR0A 2LP4Y 3DCYA 4CKCB 3PDWA 1TVEA 2PS0A 3EIEA 3V4FA 1VKRA 3W1WA 1HDGO 1HLDA 1SKUA 1TYCA 2IYWA 3K72B 3WB9A 5HKAA 5JCZA 1QQTA 1RT9A 2XCRB 4JI8B 4B85A 1P1CA 2E2WA 1TCAA 2II6A 2N3ZA 1H2AS 4OB7A 3E5MA 3UH1A 1TUEA 3DM9B 4MWDA 3KVRA 3OD1A 3WE7A 4BRSA 5BXQC 4OX9Y 2J9YB 5FA6A 4B6GA 4UCFA 2OSBA 2PE5A 1XZJA 3ZH9B 4F9GA 1U9YA 3KU4A 4CZ2A 5IJWA 3BREA 4MPJA 5DBHX 3G2PA 3KTDA 2QT0A 5KTTA 1PEAA 1Z3IX 4HLDA 4PGHA 3Q8MA 2O8BB 5AYVA 4CLDA 4AURA 1SVLA 4HWKA 2PZGA 5DWVA 3EC1A 1F3OA 5BN5B 2HKIA 1DPFA 1IB6A 2RHJA 3NOQA 4TMKA 3NGLA 4W9NA 3WKEA 4DA4A 5LZ4A 1RSZA 1Y1SA 1N5RA 2QU8A 1MVNA 2FG5A 3FHTA 1P8JA 2FP3A 2R4UA 1V8ZA 2CVPA 1GSHA 2IPOA 3DHNA 1JFFB 1ITZA 3RJ9A 1OFUA 4B44A 5JXGA 1MQSA 2K6GA 3BK7A 2YV2A 1RQ7A 2PNJA 3TBFA 4ABTA 4OHPA 4LXGA 2JI9A 2GEJA 2YJ5A 3B1KA 4B3MB 2PUWA 4QSHA 2AFIB 1CUBA 3ROTA 5HVNA 5AJXA 4UUAA 1R10A 3PUKA 1H6AA 1LGYA 3EOBI 3I6QA 4GH5A 1HQDA 2G88A 1E2KA 4JN6B 4M8IA 4MV1A 4AICA 1KYTA 1JFSA 4BLOA 4N5LA 3HO8A 5JMPA 3I58A 4D0NA 1ODSA 1LF5A 1SU4A 2GUGA 4XWGA 1SQ5A 5KVAA 4J1TC 4M9RA 1EWKA 2AFHB 1CJMA 2V7BA 1ZGBA 5TNXA 3ABRB 2O0MA 1B0AA 2HWYA 2SCUB 4X85A 1RZUA 4GX5A 4C4XA 3EFOA 4I5IA 1Z8FA 2NTNA 4D4GA 2BH9A 3S27A 2ZJ5A 3OTOB 4XIYA 2AFVA 2VJMA 3FAKA 2OO3A 3WYFA 5MFPA 2VTVA 3GFGA 3V4VB 4RTNA 1Q19A 1Y5IA 2P2SA 3GELA 4JBHA 1E59A 1Y8RA 3C98A 1YZYA 1U6JA 3KDPA 4HTFB 1C3EA 3K5PA 4AX4A 1AG9A 3FD8A 1ABFA 1K2WA 3DMDA 5CA1A 1NXOA 1R18A 2PGAA 4G5SA 3O75A 4FT4A 1I6MA 2VTBB 3FJOA 3QBTA 6PFKA 3M0EA 2X1HA 3Q0TA 1SA0A 1PGJA 2D1RA 4QAJA 4LX0A 5D7NA 2OCAA 1EK2A 1A9QA 2FKNA 3MWKA 4KNWA 2BPOA 1E3SA 5C80A 3PFWO 4HZGA 1O5TA 3L0PA 2FFJA 3WL6A 2WD7A 4J0KA 1AHIA 4AIIA 4CKCA 3IPLA 1UAAA 3HB5X 4KLZA 3WGZA 3A1EA 3KUKA 3QFSA 4CMGA 4YY3B 1Q84A 2FFHA 4WMLA 4C08A 1JB9A 4I9GA 3K9NA 1FSSA 2IOYA 5DT2A 5FFFA 4GEGA 4URHA 5AW2A 5IG2A 3BKXA 2MINB 3QPDA 4P9NA 3BMQA 3O7MA 4FN5A 3MMPA 2PA3A 4H15A 4O4LF 2BGJA 4W5RA 1YDGA 1LJ8A 2GI4A 3KWFA 4DV1B 3MJTA 3V4OA 3PRJA 2P1ZA 3KV3O 1R16A 3ANLA 3BDAA 4MLCA 4V0SA 3CH7A 3OIUA 3PSAA 2Z3VA 4P32A 4XJXA 1VDZA 4IH9A 2GXUA 2ILVA 5JISA 9GPBA 4U6QA 1C4KA 3DCIA 4BV8A 4B4WA 1LPSA 3VPCA 1N3IA 2ADOA 3I32A 2B6NA 2EL7A 4HN2A 5HDBB 5EJ6A 5ITWA 1QO0A 4JR2A 4N82A 2IU0A 5LOVA 2FKAA 4PSUA 3D0RA 5EUCA 1W4BA 1G8YA 1LLCA 5IM5A 4DV2B 5ILOA 3C6ZA 3KYCA 4QDXA 2O5RA 5KNDA 1GAWA 1UJCA 3QKWA 1CE8B 3PFFA 4JCCA 4JJ7A 2R5FA 3GXBA 4B84A 1M73E 3QKRB 1SK8A 4A8JB 4CCWA 2P6MA 3DVQX 3R23A 1QAOA 4YAKA 1CD5A 1ZCFA 1O7JA 2BVNA 2XMRA 3DDNA 4GE0A 3C3MA 4HMQA 1T5BA 3AP3A 2KE5A 3UJBA 3V2GA 4GP9A 4R3NA 5K0FA 1MJHA 1G42A 3DMRA 4MQ4A 4HLQB 3NH9A 1USUA 1WTAA 2W70A 5J2TB 2C5LA 5D51S 4EW1A 5C7OO 4FWTA 1U7PA 3B1YA 4ZAGA 3SPXA 3CO0S 3WKDA 4X90A 1MH1A 2W8BA 2O9JA 3A1DA 2IBTA 1NATA 1I0ZA 1NLUA 3WL5A 3F8SA 3COVA 1P4AA 1VC2A 3I9FA 4MR8A 2ATEA 2R60A 2WIJA 3I6BA 3R5FA 4KP7A 1DHTA 2E49A 2QIPA 2VAXA 4GPBA 4MIOA 5HF9A 1H8HA 4GOLD 3AV0B 5LL6P 3HWX1 4QDTA 1G63A 1MX9A 2BFOA 2RIRA 5DGXA 2XPCA 2M9MA 3CH6A 5D8DA 1T3SA 4JQCA 4KGZA 4ZJYA 4D42A 4YCLA 1ZRNA 4QZVA 3HXMA 4RK4A 3UT6A 2IHKA 4OFBA 3AHFA 1NX9A 3MXOA 2V6MA 4GDFA 2DE0X 3QVWA 5FO1A 4G5XA 2M6RA 1FXUA 4CLRA 3L0ZA 3ZX5A 4WTOA 1R4NB 3T94A 2A86A 3GCWA 4TUYA 2GPYA 1U7HA 2QX4A 1IPEA 1ZH6A 6REQA 5KOJB 3B38A 3QG1A 4JWKA 5FT9A 4Z51A 3I2GA 5KAMA 3U4CA 2ZIUB 1BWPA 1RRPA 2X7HA 4QHSA 3P4XA 121PA 3W2HA 1DL5A 2FJ0A 2P9QA 2J5BA 3P4UA 1YI1A 3F3KA 4RNCA 3VJMA 4EJ2A 5DX1A 5F3WB 1JXAA 5K0GA 4W9MC 4EG8A 2P4EA 3CLRD 4FI3C 1YVPA 3DZJA 3GMDA 4RF4A 2DQZA 3CTPA 4WASA 4Z3OA 5AM1A 3GMIA 3HR8A 3OO1A 1QR6A 5F5NA 3BF8A 1TMOA 3G1UA 5EMLA 1UJ2A 1T6ZA 4KXNA 1T0HB 2BDEA 4OUDB 3GBPA 4Y2UA 4D82A 5H9VA 2V7XA 3TRHA 2D2IA 4P22A 1VSVA 1UDXA 2GKSA 3LLSA 5IBQA 3W5JA 1T5OA 7ABPA 3NJRA 4HUQB 1UT6A 1YR8A 2O2XA 4OGFA 2WR8A 4TTSA 3T1VA 4Q9DA 5EJ2A 4BCDA 3HN2A 4IR7A 2Q6OA 3SR3A 2QQ0A 3MG9A 2IYNA 13PKA 4NHEA 2P0EA 1OFVA 3ZZUA 4XDHA 5A71A 4P3YA 4HNTA 2OGTA 4KQ1A 3ZE1B 1EFRA 3FPJA 1G55A 1UKCA 2CL5A 2GM3A 1II9A 2FZEA 4FHGA 4KNVA 4WY5A 4ENWA 5LQDA 1T15A 3DMFA 3VC2A 3L4SO 1NVFA 3C41J 3LT1A 4DSAA 1V2GA 5SZJA 1L5OA 2L18A 2J4FA 3NC0C 3Q85A 1QVAA 4M37A 1V3TA 4C4ZA 1UXJA 3SQDA 1P5RA 1XTVA 4FHFA 2FN8A 2R1TB 3TSOA 4DN6A 1RBQA 3T4XA 1K68A 3AR5A 1X9HA 4AMBA 1C0LA 2PMBA 1YACA 3QLVA 5EIBD 2G8LA 3LUFA 4WCFA 4EY8A 2YNMA 1QONA 2PGDA 2QZ4A 4QDKA 1OU0A 4FNOA 4RF2A 4BQSA 4A2PA 4D2IA 3O93A 5A0FA 5BURA 4J0DA 3DAOA 1X7XB 1J90A 1T2NA 5GJVC 3AFMA 5I3CA 1FS5A 3O8NA 5DISB 3BFVA 3RHFA 1DE0A 1YVRA 3MRVA 1X1SA 4FHDA 1B76A 2OESA 2X6TA 2BE9A 3I12A 4MSUA 3O3MB 1E64A 1GFWA 1LLDA 4HUJA 4MB0A 1SOUA 1WZIA 3R5KA 1U99A 2JLAA 2XVXA 1IZ7A 2WJYA 5F2EA 4JI3B 5IFLA 3FMVA 4CMCA 5AUPB 3EXHC 1C14A 1CNMA 2OCGA 3G6KA 2Q2OA 3OETA 1G3IA 2VYQA 4N3BA 3TUIC 4QHTA 2OBXA 3AGPA 1TUBA 4Q3NA 4BQRA 3P0EA 2VYFA 4RK5A 2HNBA 1G8AA 4LRSB 4LZOA 1C9KA 4UBJA 2IYTA 2DJIA 3RWBA 3F47A 1UXHA 3U4AA 1OX5A 1TECE 4D7AA 1E2DA 1OPXA 1GUYA 1Z74A 1AKMA 3EXEA 3H2YA 3MC1A 2YNMC 3TRFA 5KKAA 1VPDA 4WCFC 4ZFNA 3WBKA 5JMTA 1IXKA 1T9GS 2OZVA 3JQ9A 4ETWA 1PWZA 3G7UA 1RAAA 1UINA 3MTAA 5HCNA 1GP2A 1N2JA 1NF2A 2ZDQA 4NNJA 4F5DA 1D07A 1GPMA 1C9JA 1I7LA 1FTGA 3NBYC 4MLDA 2EJVA 3KJGA 2FDXA 2QKYA 4XSHA 5EQTA 3V80A 3KM0A 4AG6A 5HOQA 4B3SB 3AVVA 2WWRA 1UPUA 2IZOA 4M7WA 2OAQ1 3D7SA 5DJ5A 5JRZA 3ACDA 3HR7A 2JLSA 5F1YA 4L74A 3U3RA 1UXOA 3DD5A 2HSJA 2QU7A 3UATA 4IRUB 5DBOA 1U7XA 5GOZA 2PCLA 1E8MA 1YRYE 4L51A 1SU7A 2ERCA 5KDLA 2EERA 3EEQA 3WB1A 3D7MA 1P7PA 3RAGA 3LHDA 1PK9A 1Y5RA 1C0IA 4G0MA 2XBMA 2N46A 2Q7XA 4YV1A 1E0DA 4KZPA 1UIMA 2OFPA 3IAS6 3HY6A 1Z0FA 1OREA 3C3BA 4PHHA 3RYFB 3WMWA 2Q2QA 3F67A 4BNWA 1XCJA 3H84A 3OCCA 3PNQA 4NR0A 4I1PA 5KVSA 4TKLA 3THYA 1A4UA 4PIMA 3TN7A 3HKBB 3OZVA 3O1IC 4DLXA 5TMPA 3H11B 4XGIA 5LYYA 3X3HA 4L95C 3TW6A 5JTUA 1N6NA 1X1QA 1WZNA 1C30B 2Z5GA 2HSGA 3FIUA 2I33A 4PYQA 3AXTA 4D25A 1ZYUA 2HDHA 3C70A 3O8OA 2BR3A 4X1OA 5CCDA 2YC2C 1MAWA 5B1DA 3HFRA 4NK5A 4UHBA 1COWA 3RUDA 3IEXA 1RPNA 1MT0A 3QU7A 2E37A 2EBWA 2F55A 4M46A 4MVJE 3E03A 1PL8A 3HACA 1FFDA 1MLDA 2C4UA 3FOWA 4JLUA 5BT8A 2AA3A 1IEWA 1KVUA 4GXTA 1Z2OX 4RGBA 5KYYB 5EJEA 1AQUA 2I62A 1CQJA 1FFXA 1Q57A 1QK5A 1QWSA 4RVUA 5J2UF 3DDOA 4MMYB 4N1AA 5JYBA 1M6YA 2A3RA 4RWEA 5LXTA 1S2NA 5EVCA 2YICA 2GD0A 3LK6A 2I66A 3SOZA 4EY3A 3NVAA 2B4RO 3I6ZA 3HB0A 2QL7A 3D8HA 4PVDA 3C0KA 4L2IB 4QTZA 1TFUA 1W36C 1UWCA 3NYRA 2D5CA 2QI9F 5I51A 1N0HA 3OFJA 3VBEA 1XD2B 4OJTA 1N7IA 2G6TA 2WJ6A 4IM7A 1PT5A 2PR7A 2H31A 4DDHA 1NGSA 1P2DA 4GWGA 5D6OA 4B3TB 3NNDA 4TSFD 2AS0A 4YXWD 2RARA 2D0IA 4A82A 3A7DA 3DDHA 4QU5A 3HLYA 4N0QA 4XFJA 3ZTYA 3ROQA 1JDPA 3GWGA 3ZQJA 1L7MA 3AC0A 3KR0A 2Q6LA 4I4TF 4IJVA 2F1RA 5JVDF 4KXXA 3HKDA 1S7CA 1UAGA 3UMRA 1P0QA 1SMKA 4BP8A 1M72A 5AD1A 4IBOA 1GWNA 4UAUA 2Y93A 4WGFA 5F4ZA 5FRDA 2RJ3A 4H7FA 2TMGA 1RS0A 2WHYA 2MMGA 5FLKA 1A8HA 4WSOA 5CLLA 5JQGF 5LQCA 2G1KA 1W0JD 4MKGA 5CRIA 2F3PA 4CDMA 1UUFA 1W9HA 5A7HA 3RTCA 2P2DA 1U0OC 4Q5IA 1DEOA 3N6XA 4Q4AB 2FJPA 2H4FA 1L1FA 3T3MB 4LFBB 5JTTA 1RKXA 5B3AA 2V59A 1Z62A 1WQ3A 1NJSA 1NXTA 1E0KA 1E2FA 2PPVA 2XVAA 5JZSA 1W0CA 2BDUA 3ZU3A 4Y6PA 4LJKA 3S2YA 4I9HA 4A03A 2WTAA 4OATA 1XVAA 1WETA 1Y7IA 1DWUA 2JGFA 3E8XA 4KK4A 5JNWA 4HN4B 2ADFA 3LTNC 1H9CA 1F2VA 2C0CA 4Y9DA 3S2ZA 1IMJA 3H0EA 1HDEA 1GCOA 4ER0A 2PMDA 3IBCA 4DYVA 1IJFA 1WBDA 2EVWX 2PGJA 3OOJA 1ZGHA 4JR0A 4KQGA 4LOKA 2XUPA 5HF8A 1PTJC 3ANMA 4Q4HA 4GMFA 3U26A 1HWYA 4K0RA 3ZQUA 1P17A 4ITVA 5K3OA 2EBUA 2QMUA 3I04A 3RUEA 4ZAXA 3EIXA 3O2JA 2QN8A 4GL2A 2JAXA 3VM6A 1YS2X 5FBQB 1W88A 3TZLA 4MW4A 2H00A 2O3RA 3D1VA 4I4TA 4LRUA 3ZD6A 1YZUA 3UPDA 3GLGA 4LE0A 5ER6A 1ZD1A 2HUNA 4KQIA 1YAJA 3ABIA 3HB7A 3SM3A 1Z6GA 4XIIA 4UBMA 1BCSA 1N5LA 1O95A 3MGCA 1DXOA 3B1VA 2BUBA 1Q1QA 2I2FA 2VT6A 2ZWIA 2QT9A 2DSTA 3B9RA 3FETA 3HJAA 1U4NA 3UNXA 5JXJA 4U2FA 3CSUA 1UPXA 3KYJB 3MTGA 1JHMA 3AY7A 3LRTA 3M6VA 4LZNA 4EY6A 1QLHA 1WR8A 2D62A 1HYEA 2O2EA 3D3EA 3P9XA 5GP1A 2RGXA 3U80A 3BGOS 4P54A 4NRDA 1ZM9A 2QX8A 3II6X 1XRLA 2VF4X 5SZHB 2FYTA 2HRBA 4HXFB 3SYRA 4D3XA 4ERNA 1L6RA 3ILSA 5EHQA 4EHAA 3KJNA 3M5DA 2WM9B 3OF5A 2ZWVA 2R7MA 3PQFA 5BVGA 1JSXA 2EU8A 2Y76A 2QYHA 3PFKA 5J4HA 3UAXA 4Z53A 1QHIA 1RXWA 1UZMA 1Y8RB 3FKSA 3THYB 3OLZA 1PLLA 3KQWA 1ZY2A 5LA6A 4OB8A 1GZUA 4CLXA 4MARA 2D0DA 3G7NA 3OPMA 5I7WA 4F97A 2QE7A 3UAWA 3H0KA 4AROA 4XR4A 3D3WB 3GLTA 4J91A 1MO3A 3V32A 3RS4A 1Q6ZA 3BH0A 1ULUA 3I2YX 3IQEA 1YVEI 5JR3A 2ZJOA 5CBKA 4C2TA 1NXVA 1NDQA 1TCBA 1WSAA 1QH1B 2XIQA 2ZUVA 5C8YF 1JKJA 1NXSA 1ESNA 1VLZA 3UG6A 5IC4A 5BOVA 3V5NA 5JASA 1LU9A 2OZEA 2QVCA 4Q15A 1LW7A 3ER6A 3KKOA 3OY2A 2A88A 4MRRA 2IHVA 1ZCZA 2BFDB 1IL0A 3EW7A 4HDMB 1PUXA 4LAFA 4LZJA 3WYGA 4OEHA 2H1IA 3Q8LA 3OCUA 1GAQA 2C8LA 4MGYR 4CMEA 5HCIA 4UVIA 1CR0A 2NVWA 4JU8A 3NJ4A 1NQXA 2AXNA 3GJ5A 4R8LA 1ABBA 4N7JA 4EJ0A 4CM8A 4NZYA 1RRFA 4DKXA 1XRJA 3CB4A 3BILA 1IRXA 1M34E 1NUPA 4URUR 2FWMX 2NLOA 3RSHA 5L4NA 1G59A 4KXVA 2A9RA 1RXYA 4DG9A 3ONVA 1XMVA 5LLDA 4AQ7A 5JUWA 1OAOC 3U44B 1VYHA 2BFCB 3PXAA 4FKBA 2R6HA 1K3TA 4M1EA 5PNTA 5JEEA 4BNJA 3H3JA 2NMVA 1FQOA 3Q9SA 4I8XA 5H3CA 5LZ9A 2ISSD 1V48A 1K7FB 2GN0A 3KZ1E 4JBLA 1FP7A 4WCVA 1TW2A 4A8JA 3N2GA 2B7CA 4OJMX 1KJNA 3DJFA 4ABYA 4EAQA 2VDOB 2BHRA 1OH5A 3RC8A 2XA1A 4EHBA 5CU7A 1ZK4A 1CX9B 1E79A 2A57A 2H2WA 2JFXA 4JJ4A 4Q82A 4BE4A 4YPVA 3A6HA 5L7WA 1C41A 3ZGVA 4C7JA 5C4IA 1OROA 3ICOA 2VK8A 3OPXA 4LYYA 5CLQA 4UHCA 3W7VA 2H6EA 3LQQA 9LDBA 1V3UA 4B33A 5BV1A 2J07A 3B2QA 4ZXPA 4G23A 1JFRA 3DDWA 4P86A 5LFAA 1THMA 4DE5A 1JSZA 5JADA 4NICA 1Q0SA 4QKQA 1NP7A 2QVYX 5CD9A 3I62A 1CFJA 3E15A 3N7TA 3FYTA 2DBRA 2QAGA 4QU8A 3W9SA 3R76A 3ZLBA 2GPNA 4CKEA 1BJTA 4BRUA 1WV1A 8GPBA 4AAYA 2XMDA 5GIPE 1NUTA 3F49S 3LHFA 1F8FA 1LJLA 1TAHA 2J5KA 3MWEB 1NVUQ 3VR5A 2XZTA 3E1SA 3R3YA 2J7PA 5E95A 1Z75A 4JQOA 5AOBA 5IKXA 3RRJA 2BEWA 3U13A 3BWEA 4XQEA 2FWAA 3B7GA 5F1PA 5JD4A 4C22A 1DOAA 2RB5A 2XSZD 3AETB 2B2XA 3D2CA 2XUIA 4ID3A 1T29A 2FAXA 3LFUA 2FP4B 3AEKB 4OBXA 4R7GA 5EUBA 2BGNA 2Z9DA 2WFMA 3WWCA 4C30A 4IYJA 3U31A 3HMQA 3SC2B 3BB4A 2WPDD 2AEEA 2CJXA 2J3JA 2BAGA 2M2IA 3AK4A 2C5BA 1PR0A 5D3MA 1DUIA 2IDMA 1KE2A 3VTFA 2NYUA 2ZCUA 3BZWA 2IF2A 4J2HA 1W34A 4IGKA 1U3WA 1ZICA 1M6VB 1NZJA 3NHPA 5DXFA 2EJTA 4N8SA 4AS2A 3O8RA 2ROQA 2UVPB 1SIUA 2ZTLA 2YCBA 3SJBA 2HMVA 3UJCA 2OCYC 4MX8A 3UYKA 4UTRA 4KMMA 1JFTA 3GVPA 3CX8A 4FX2A 3W79A 1JH9A 3QEOA 1V9LA 1GQOA 4MZXA 1MAHA 2B35A 4YWJA 4JJAA 4EF6A 5KWIA 3WA7A 1RKUA 2DBZA 3NT4A 4R1UA 1AJEA 1TK9A 4O02B 1E5QA 1EDZA 4LNHA 4JLKA 3G8CA 1ZW1A 2UVPA 3KO8A 4P38A 1VLLA 5IWCA 1BO6A 3DEKA 3B1ZA 4JH0A 3EYAA 3G0BA 3K8QA 4WD3A 5BSTA 4C21A 2IH4A 1OFTA 1P0CA 3AUXA 1VZ2A 4QJIA 4A8JC 4CQLA 4F4UA 2J48A 2VDNB 2VBGA 1EUDA 3PCRB 1KJ9A 2L69A 1QOZA 4IO0A 2BGMA 2ODWA 1PAUA 4DIBA 3FWKA 4HGQA 2HSDA 3AR6A 2OG1A 1O89A 4ATNA 1MIOA 2XOKD 3A8TA 3T3GA 4UE3S 2FZVA 4JI4B 1WMFA 5KHOC 5K1ZA 1UMBB 4ZVUA 1HGXA 5C7YA 2FEMA 5CDHA 2QTGA 4TYWA 1KRWA 1U02A 1O96B 2AZMA 3K5HA 3VSDA 4DMMA 1JIXA 1VIMA 1XLVA 4FXPA 4FM9A 5TS3A 3O3NB 4OQFA 4E88A 1DO0A 1WUYA 3Q3HA 4Q21A 4QFDA 3M6FA 3MFYA 2F9FA 3NEPX 2JI8A 5KQMA 1L5WA 2PGOA 3UT5A 1T3GA 4ENRA 1N1DA 3FCXA 3JCZA 2CLMB 5EMJA 1S1CA 2B21A 1E32A 2VHCA 3LT5A 3PGKA 4JEIA 2WKRA 5KNDH 3LC2O 4I5DA 3MGGA 4QYSA 1E60A 3RTGA 4E3ZA 5ALDA 1E1CB 2GHRA 3BKWA 1KZHA 2ZYVX 1GR0A 1XZ8A 3KUXA 1V3QE 3DZGA 4MQ5A 1EVKA 3QEMA 3UXYA 1O6ZA 4EGCB 2ZIEA 3VR3D 1A8SA 3WSWA 3F7OA 1D2HA 3F6RA 4K1XA 1DT3A 3OX4A 4KQHA 4Q6BA 5HKOA 4DJAA 2NXNA 4IIJB 1DOHA 2WJJA 4GMGA 3EIOA 4MR9B 2CJPA 3L8CA 2Q5QA 3CLVA 1DDGA 1LBTA 1TKAA 3JQBA 3JYLA 4HLUC 3FWYA 4LY3A 3WMXA 2Z2JA 1NBME 2YVUA 2CLDX 3SEQA 3UAGA 1OAOA 1YRHA 4JVOA 2XWQA 3EQ2A 4Y6RA 3IUJA 4D96A 1UFKA 3IAUA 1JJIA 4GKAA 5JT1A 4IV5A 3TXXA 3LQYA 4KI0A 4PV7A 2W42A 2YOHA 2V97A 1VPLA 4NCNA 1HQCA 2CW5A 5EVJA 3THXB 4RDHA 2XB9A 1TL7C 3GLIB 2MSLA 4K2HA 4TVKA 1MO6A 3KQLA 1WD7A 4PNPA 1BDMA 3W2EA 4W5NA 3VGPA 4EYOA 2HY7A 3WB0A 2V7WA 2V3VA 3ILHA 3G8DA 3KX2A 3P9IA 3PF9A 1L5FA 4X54A 5AIBA 8ABPA 1ZZGA 1SBZA 4JUCA 9LDTA 5DM1A 3CNLA 5EA2A 2AN5A 2Q4OA 2BEUB 2WT9A 3AZPA 3GAZA 3ZDDA 5A05A 1DG3A 5JH7B 2E6KA 1QPBA 1EIWA 1Z4QA 1AXEA 1SWWA 2PKYX 5T57A 3R6GA 3W5SA 5KNBD 4LF9B 2EHDA 1WY5A 4WZBA 3L46A 4NPCA 3PFBA 1MBZA 3DVAB 5IFKA 2OPHA 4AJ9A 4IV8A 4K86A 4EGFA 5CW1A 3HEMA 1R88A 1FX1A 1W1IA 2QTFA 3BULA 1IPFA 1KOLA 4Q1AA 4BMXA 2SKEA 3W2GA 3CH5A 1GYPA 1SIBE 4HEHA 4N12A 4YXFA 2QUIA 5CFQA 2JJYA 3HB4X 4Z4CA 3GPIA 4BE9A 4Q3DA 3J81A 1YR9A 3H65A 4O1MA 1W5FA 4RAQA 1YAHA 2GCIA 3TNLA 2YV3A 4F3TA 1A8IA 2MSDB 3DR3A 4TMFA 3E22B 5F2NA 3R09A 4X5OA 1CF4A 2PUBA 5F9FA 4BWGA 3I23A 3R1IA 1XCPA 4KIUA 3UANA 1IWPB 1KFJB 3RYTC 1GUDA 4DSNA 4CM7A 2DETA 3VPFA 4FEEA 5AFSA 3ZE8A 1Z7WA 4UREA 2HCRA 2VL7A 1G7RA 1L4NA 1NMEA 1GL9B 3NT2A 3S1AB 2FMUA 3OTIA 1BA2A 4D0GA 4CF7A 1K8QA 1ECFA 3K0BA 2GWRA 4TS4A 5LU9A 1KFKB 1V45E 4NPAA 5DHPA 5IBRA 2WU4A 3BE8A 3AWIA 4M21A 5AI9A 5CNJA 1LSSA 3M9WA 3ADOA 5IAAA 1DXYA 1GKUB 4F3KA 4ISCA 2JH9A 3CLKA 4G4IA 5CDFA 4D8XA 3KXDA 5FFMA 1EFKA 3AGQA 1OR8A 5AKXA 1HDZA 5BYJA 4ZV9A 1MCZA 5AI8A 3RVKA 3BZBA 4CDNA 1D5CA 1GZDA 1MVOA 2CLIB 4MWTA 1J9ZA 2EXXA 3KLMX 4D80A 4QUBA 4ZO7A 4KPEC 1O6CA 3RVLA 3TCNA 1E5XA 1MA3A 1COWD 3MELA 1WXQA 3S99A 2XT6A 4J0FA 4BBZA 1AKRA 4AZSA 4DSOA 4HWSA 3A1FA 4JOCA 1AF7A 3ZWVA 2IYQA 4QXMA 2I99A 1UANA 3GRUA 5DSZA 3KPYA 3JQ8B 1HI9A 5KNBA 3B6ZA 4JOSA 2CDAA 3F6SA 3I37X 4ERXA 3GP8A 1DJMA 1XMOB 2QN3A 1B2RA 3IQZA 4L0CA 3MS2A 5JAZA 4INJA 3DWIA 3ORSA 4I66A 4R9SA 5E8JA 1Y8QB 1DAEA 1JQEA 4GBGA 3WGMA 1LPAB 1ZISA 2GQ0A 3PC4A 4JJ6A 2OE2A 2YZGA 4JLVA 1W5TA 4LC0A 4MMXB 4LSGA 4RW0A 1SBTA 3QXSA 5K20A 1GKIA 2AD1A 3HV2A 2Z6VA 3CF4A 1Y0BA 1F5SA 1DBPA 1KS2A 1N6LA 1IRIA 3K0CC 4UOEA 5I4KA 3ENQA 4CQMA 4UMFA 4IH4A 2FW1A 2O20A 2VDRB 1SC3A 1I01A 4OQMA 1L5VA 2XDWA 4V0ME 1WU7A 2Q5EA 4B7UA 3H1TA 2BFCA 1SVKA 1L5NA 5JPIA 5IC6A 1BXRA 4P92A 3QFTA 4XUEA 5CLJA 1H0SA 1A5SB 1F0KA 3BJZA 3VI3B 3SIXA 1QS0A 1G20E 1NJ6A 1F6WA 2JLUA 2W11A 1XFDA 3UJ9A 2Q3MA 1N34B 2TECE 3AVQA 2GCNA 4G36A 4MPDA 3KLPX 3LU1A 3ZE6A 4BC1A 5IW8A 2HHLA 5CNMA 5F7JA 1QV9A 2Z58A 2ZULA 3BEDA 4L07A 4YV7A 2LPMA 4PSCA 5FA8A 1QGYA 4RYDA 1V35A 2CEKA 3DPUA 3HBJA 5I01A 1LK7A 1GGJA 3O82A 2HX1A 2V5UA 5LA6B 2VSFA 1LW6E 4IXNA 2JG3A 3Q15C 2H4YA 1H3NA 2QSYA 3LECA 1XEFA 4XYEA 2IDKA 2Z3ZA 3AY3A 1BQ4A 3BG5A 1GGMA 3G9QA 4LY9A 2R1TA 3CZAA 3G9ZA 3IPXA 2YCLA 1CJTC 3DZIA 4GKVA 3TTYA 2J1LA 4ZI2A 3THWA 1QMGA 3WYDA 4OQLA 4ZT5A 3VJRA 3K09A 1GFSA 1PKEA 3C2QA 1NP6A 3VO9A 4ALNA 5ITSA 2AE1A 3A28A 4Y9UA 5IJXA 2CDNA 5AKZA 1RBZA 4TKUA 1TM3E 2C2BA 2OCIA 2V7QA 2VQ3A 2BFBA 3DH0A 3RM3A 4EYEA 5I6DA 5JPDA 1X80B 3EZ6A 3RVPA 2GF0A 2JCVA 3PITA 3PKIA 2WU3A 5IARA 3HK2A 1HORA 4D5EA 3C87A 3LQRA 5IEJA 3C1AA 3EISA 1RC0A 2FWPA 2PM8A 5K0TA 3RJ5A 4CIBA 3GLSA 3ZUGA 1QYRA 3SQNA 4XSGA 3TQRA 1F7VA 1GRCA 4N0EA 3OEEA 2WF5A 2FTKE 3LMKA 1LDEA 5DEOA 4WBNF 1NVVQ 2OV2A 3AF5A 3OQ1A 3TB4A 1HT0A 2GNOA 3E4CA 3WLIA 1KZ6A 4IDAA 1OTXA 4G5QA 4TWRA 5ES4B 3L1KA 5JSZB 4E5SA 1E6UA 2FV8A 4G97A 3SXUA 4A0QA 5FPYA 4NYMR 2VDWB 1L4YA 3ETHA 3O4RA 5DXAA 3DNMA 3SM9A 4CL8A 4EUEA 4FQ7A 2VJAA 5B3JC 2IWHA 1JTFA 1EX6A 4GBMA 2XMPA 5CH3A 4AJIA 2HCBA 1YS6A 1XTQA 4UASA 3PNLA 2D2EA 1KAEA 3GDOA 1UQTA 3OLCX 2RFLA 3CMCO 3Q7EA 2RGEA 1AKQA 2EBHX 4QUAA 5TV2A 2ICAA 2HA6A 2WUWE 3SC3A 3CC8A 3NYIA 3WQHA 2PL3A 1E99A 1V5IA 1XDBA 1B4DA 4RJ2A 4KTTE 3ZQKA 2ZRDA 3BHIA 5IXYA 3OOSA 4HH0A 2APJA 4F4IA 3V7WA 4HZUB 3B82A 5DULA 3AU8A 2QP3A 4PFJA 5EZQA 4CN9A 5JRDS 4EELA 1L1EA 2QX9A 2Z5LA 3ENZA 3OF2A 2VPPA 3Q0IA 4KO2S 4MPRA 3REOA 3HTXA 3FA2A 4WL0A 1MAUA 2VWQA 1DKOA 2MJLA 2OM6A 2QE7D 3RDPA 4EKGA 1VJ5A 2RGNA 4B6QA 5EPOA 1U1GA 3SKVA 1KZ1A 4DC9A 1GZ4A 3VSAA 1UOQA 4TKMA 3FCOA 3EEYA 1A95A 4DAOA 3KUDA 3K70C 1OYVA 1WHTB 1TQ8A 3B1JA 4BE7B 4IFEA 4CIWA 2JIDA 1DQSA 3ERCA 1V8PA 1UMDB 1Z8HA 3Q3JB 1ZN9A 2R6DA 2R44A 4G41A 2YRXA 2A0WA 1KEVA 3DQPA 3C39A 3IESA 4PICA 4R84A 3ZV5A 1GQRA 4PAGA 2VP9A 3H42B 1S9DA 2W43A 3QV1A 1V95A 3UCEA 3HCWA 4O2BA 3BB1A 2O2JA 3A05A 3FYUA 3SXPA 5D5HA 1PK7A 1S2DA 4QOSA 2QUJA 1SJ9A 5L51A 5AKHA 3L6DA 4R2JA 4ECEA 2HJGA 3C3JA 4J49A 3AJRA 1ADYA 3QOFA 4EB6B 2WM3A 3MWGA 4GPTA 2X9NA 5CIWA 5A02A 3T3OA 1N2EA 4F2DA 4RSGA 1I4EB 2X6QA 3IULA 4TTVA 2BGIA 1L7EA 1VHQA 4DWWA 4TVSA 3BHMA 2BLNA 4RA6B 5LCXA 1N1GA 1JJAA 2BI8A 2IU6A 2VOJA 3PNMA 4DCGA 3QKIA 1BGVA 3LCCA 1C9EA 3VC1A 3WIEA 4LDNA 1BWSA 4PXAA 1D8AA 2W7TA 2I2WA 3DAYA 3PZBA 3KXIA 4G1FA 3KQHA 5B58T 3H8JA 3P5SA 4GOXA 4EMBA 1JEYA 4ZRNA 1E1YA 3F7TA 3FPAA 2P5SA 4JNKA 4UHHA 4AVYA 1JDVA 1VSBA 3IDOA 1G8JA 1OI3A 2GAJA 3BD8A 4GM1A 4GQIA 5FI1B 1O5IA 2ZJ0A 4P83A 3DB2A 3KAJA 1EP2B 3B9PA 5K01A 4KI7A 1Q77A 1GG8A 1ZM3A 1GNRA 1HG1A 2G25A 3H3FA 3L7JA 4UPVA 1G4HA 3FF4A 5BWLA 5KIAA 4LWQA 3PI7A 2GERA 2GN9A 2JFBA 2OVFA 2XGSA 1I3OA 4K9PA 1TFRA 3RU3A 1GV1A 4IEEA 1Z7EA 5JNUA 2YKGA 2H8KA 3K1AB 2E7ZA 1Z45A 1DUSA 2JL1A 3L0BA 4Y18A 3L01A 4QPNA 4O5AA 3BWDD 2PV7A 4NNOA 3L04A 5A06A 2I9KA 1N3YA 4Q03A 2IHUA 4ALJA 1MDFA 2IJGX 2UKDA 4RD2A 2MOKA 3WGKA 1VKHA 1ICEA 2Y99A 1G0NA 4GX2A 3VOBA 3WL8A 2V5AA 2XRMA 3C4VA 2PGNA 1RYFA 2ZB7A 1G18A 2HMSA 4BVEA 5KOHB 5IT9A 3C3EA 3NBXX 4K9DA 1Y3CE 3DO5A 1GPDG 4LMAA 4NZZA 4XLLA 1AO3A 4JUDX 1B3BA 3B8HA 3T4EA 2UAGA 3T61A 4D4JA 2PUCA 2OB1A 3JR7A 3U3KA 3CLSD 2P75A 1Z2NX 2EGUA 4UTNA 4EB3A 3PXBA 4DLNA 3H4TA 1RQRA 4X7PA 4NG5A 1TT5A 2HJ9A 3GEPA 1VL6A 3D6VA 1B6TA 1YJ5A 3DTVA 5DBGA 2JKVA 3TFWA 3A0UA 5B36A 3QPUA 1WNFA 2OP0A 2IKQA 3RC3A 1E3DA 3UMSA 3ZXYA 4CM4A 4G0VA 1D1TA 4A0GA 4E22A 1PSDA 2F3SA 4NG4A 3T7EA 3E22A 5JAIA 4IHKA 4DSUA 5JU6A 1MU0A 3OX1A 2RH8A 4EGAA 4YMGA 1DVRA 2H1CA 1DRVA 2AWNA 4RD6A 1HZZC 3I76A 2DZDA 3IGFA 4BVBA 1IN4A 3T0FA 2XQVA 3EMDA 4U7PB 3NHMA 2FUNB 5AKEA 2HT1A 3N7AA 1XRPA 2OAEA 3NEAA 2V6JA 3IBFA 1BE1A 4ZMBA 4LC1A 2C3MA 2QN2A 3K2QA 3D3NA 4GPZA 2VSQA 1Z17A 3ZDQA 3FIJA 1ECBA 3W6ZA 4OQYA 4PLVA 1BEEA 4G0NA 3QF7A 3VNQA 2G28A 1PFGA 1RQ2A 4MW2A 5HE9A 3T5GA 2V45A 2ZB3A 2YUTA 1ZMRA 1Y4DE 5FI5A 1YDEA 2EIXA 4UNSA 3PHIA 5H7XA 3C1UA 2QRKA 1XCGB 3IAM1 1YUNA 1MX1A 5EKXA 2FFQA 3H5VA 4FB5A 2OCDA 4X3CA 5GZ6A 2HPHA 1LDNA 5KYUB 1LQTA 1A1VA 5ERGB 4RKWA 3GT3A 3TLBA 5F7ZA 4AJEA 5IM4A 5JJCA 4RTJA 4YUXA 4OI4A 4W8GA 1EVIA 1OZ0A 2WAXA 1E2JA 3PK0A 5IHXA 1CEEA 1DC6A 1HNNA 4KW7A 2QSJA 1Y1PA 1Y4AE 3QXXA 1H85A 4AY4A 2RHBA 3CY6A 4N8EA 4R69A 1PJCA 3P0JA 3Q9UA 1DELA 3KAPA 4KXWA 4CW7A 3ETCA 5C9ZA 3TNFA 2MINA 1P7ZA 1Q44A 3LX5A 1YJBA 2FCRA 1QK4A 2CJWB 4E7PA 3PXEA 5GMOA 1TIPA 1J33A 5FTWA 3FTCA 3H4IA 1E18A 4L5BA 5CK4A 1BYIA 1R4MA 3NHAA 3NTQA 4HNGA 5BQXA 3WRVA 1F3LA 4RMJA 4B7AA 2J9GA 1KFEB 3DC2A 3T15A 4DDMA 4TMXA 1K5PA 3F5MA 4TSFA 1S8FA 1WKVA 3IAXA 4GFDA 4HYEA 4LSWA 3B12A 4UCWA 1JI3A 3G85A 4W7HA 2FWIA 3SMVA 2KHZA 2VHTA 1U2RA 4Q4LA 4RHXA 2O8DA 5BY2A 2Q4RA 1KO7A 2DPMA 2P30A 2DUNA 2FGKA 3IBYA 2W6OA 4N7MA 4O4HF 1TYBE 1Z33A 4X9XA 4WOPA 1MRSA 2IYSA 4WXHA 2J3EA 4E0BA 4TN1A 1S01A 2PXXA 4Q3AA 1G9TA 2A67A 1BE0A 1JBKA 1KYYA 4G86A 2Q41A 2WG2A 4DV3B 4ENTA 3FJYA 5B58C 3W5VA 2D6FA 1UMKA 4PQFA 2JHFA 1QF6A 1VOTA 5AICA 3PWTA 1L3BA 4ISBA 2R87A 3FAZA 1Z0UA 3VNSA 3DFMA 3OF3A 3L6EA 3SZUA 2XCSB 4QPDA 3K4HA 5ARCA 3WLAA 1L7XA 4V1CI 1CYEA 5AMXA 3L5KA 3OQ6A 3PJFA 2G1JA 4MS4B 4BKRA 2XKKA 6YASA 2C2HA 1YI0A 2Z2IA 4WLEA 2YJ4A 1KC3A 4CV0A 3EPLA 4HDRA 4FCVA 5GJWC 3ACBA 5TR9A 1GCAA 5HGXA 1T3ZA 2M6SA 4P34A 1PV4A 2PX6A 3W1EA 1E6MA 2HEGA 2O3UA 2ZOSA 4W99A 1FDUA 3DL2A 3SIPA 3M5PA 2VUTA 4X95A 2ST1A 4KQCA 1X42A 1ZGZA 2OUIA 3D3KA 2AFHA 4UJ5A 1N75A 5DTEA 7MHTA 1C1HA 1OFGA 5JD5A 1OWPA 4UHEA 1WSBA 4Q48A 1XZLA 4EA6A 2YFKA 5EE3A 4HDCA 1LDBA 3RAPR 1M8PA 4IIYA 1CW2B 2HJSA 4CLRB 3FCCA 3ZY3A 3A1TA 5BPFA 3OKAA 3CONA 4C3ZA 1Q14A 2X9LA 4ARBA 2DY1A 4JL8A 1AHNA 3I45A 1G60A 4MHSA 4YRJA 3AVUA 1ESCA 4JR1A 4OQEA 3TCKA 2X5JO 3GJYA 3Q8XB 5J58A 3CWQA 5FOTA 1CJKC 1ID8A 3BWMA 4EPTA 3OTWA 1RYHA 5B55A 5DDIP 3JQGA 3IXQA 5IVIA 3AG5A 1PFUA 4DOMA 1TUIA 1T43A 1NUAA 2CXXA 3HCFA 2CDBA 2JI4A 3GA5A 2DU8A 3TQHA 1R4MB 1P7CA 1ZOSA 1CC1S 3DFFA 3Q12A 3TJMA 4CL0A 5IN4A 2ATCA 4QTXA 1QF7A 3IT2A 3TO5A 1GT6A 2I71A 3KJEA 1GD1O 2ZT8A 2C29D 5KJCA 4OMUA 5DHRA 2AJBA 3E70C 1ADCA 4LW8A 1U8EA 3BX1A 2WV7A 3JZAA 4FE3A 5ALWA 2HDNB 3OQMA 2ZE8A 4C2UA 2ONKA 2OB2A 4PLCA 4ZTZB 1NW4A 5CDGA 2WV9A 3IUMA 5JMOA 3D0OA 1VG9B 3BXFA 1KO8A 1KERA 5TPZA 2ZDHA 1LCIA 1DRKA 5BYAA 2SCUA 1DCTA 1JB1A 1M9NA 2J3HA 4YYEA 2DB3A 4HBGA 3BPSA 1RYBA 4XX0B 2OENG 2GVDC 3WKAA 4HI0E 3RADC 1U2EA 3RUCA 3UV7A 1JMYA 1R12A 2GHIA 3TIGA 4DLSA 4XSVA 1VB5A 3VSCA 4RORA 3CR8A 3ZDCA 1H1DA 4BZZA 4ZHSA 5LKRA 3D54D 2ZYTX 1IWOA 5H8WA 5CVVA 3SR4A 3V3KA 4OB6A 1VGRA 4GUAA 3W5IA 5KUTA 2GPJA 4MKRA 4QE3A 1TEZA 4B6PA 1IBKB 5AJYA 1H8HD 3QHPA 4YO7A 1FLNA 1LA2A 1NNSA 2DPXA 2XWJI 3JARB 3R4VA 5K8JB 1VB3A 4IQ4A 2BELA 5DGIA 4Y2TA 3VZSA 4X64B 1HT3A 1E6KA 4M1KA 3AF3A 3BIOA 4EHNA 1TZ2A 1W46A 2W98A 2WD7B 3T5DA 5J43A 2FQWA 5LQNA 3K30A 4YK7A 1YZ3A 1Y42X 1ZC3A 2GAOA 3C4QA 3PX3A 4PLZA 4PZLA 3HBLA 5HZKA 3HJUA 3X1MA 5I7FA 4EEKA 1ZAKA 2OFFA 3FGOA 4D57A 4F1WA 5IDYA 4K6GA 4URZR 1ZDMA 2F90A 1RAHA 5EIOA 2QJWA 4DA7A 3CKLA 3DBIA 4GMHA 3ROEA 1YB7A 3WGOA 3GZNB 3W5UA 2XRFA 4IICA 1IPHA 4Y2YA 3MUOA 3PUYA 4AB1A 1SC6A 4QQNA 1U7TA 2I2XB 4PPYA 4JT2A 1ATZA 3KT8A 2H1LA 2WIFA 4GPAA 4E4RA 5B7GA 3ZHXA 2JFOA 2PWYA 1WY7A 2DWCA 3E61A 1VHLA 2A0KA 2XUQA 3OBBA 2EX1A 4PG5A 4ZJUA 4PLPA 2HB6A 1PT7A 3A0RB 3LL4A 4N8DA 2XE6A 4RE6A 1LLFA 3NLLA 3BIWA 4KWTA 1A4XA 3M70A 3EF1A 4O4IF 3D5TA 2GCGA 1KR2A 1TB4A 3P0RA 2ONZA 2VJKA 4O2AF 1OC2A 4PG7A 4QDOA 4LHWA 3LUGA 3DLAA 4C4AA 3HZZA 4DDUA 3BB3A 4RCVA 3P9ZA 2O0KA 4XQCA 3WHLA 1T1SA 2O8CB 1B23P 1M2HA 4OKIA 3ZBTA 5KZMB 4I5FA 2GXAA 1YA4A 1R5BA 3V7NA 5K0CA 3C6BA 3STYA 5JCJD 2VRBA 2ZW9A 4RPLA 1DXQA 3LUCA 2HHJA 3MXTA 3U4HA 1QHSA 3EPPA 3VR5D 4RPGA 3GNSA 4MK4A 5HKKD 2VBIA 3QKTA 5JZ9A 4MJXA 4ON9A 4CIXA 5K99A 4NXNB 1XIVA 2AR0A 2BR5A 2O3QA 2NYAA 5F78A 2OV1A 2OZLA 3D6MA 1E4EB 1IHUA 4F2HA 2QRPA 3U4MA 4QYIB 3D3QA 4HRAA 2YN4A 4JNCA 2BZSA 1RTTA 4U9IS 3T7AA 4RULA 4PPQA 2LGJA 3RBZA 3QVTA 4JKIA 2PUGA 3MLBA 1C7IA 5FBHA 3RYIB 3ML1A 1VFPA 2FDCA 1SEVA 3FY4A 3IBSA 4WFQA 1IIRA 3RYHA 2BJHA 3KD2A 5LPNA 1OF1A 1WWKA 5ILQA 3O91A 4PZAA 1FS6A 1WL8A 2RHHA 3ELYA 2CVHA 2FSPA 3O84A 1R6DA 2GSWA 1QUFA 4FFMA 2HO5A 1FOEB 4URYR 3VI4B 1ZBDA 1Z68A 1E8DA 1VM6A 3SOPA 4EKYA 3ESRA 1WIWA 5HRAA 4TRRA 4DUZB 2BMEA 3CJTA 5KQRA 1O8BA 2AC2A 2EOAA 4ACBA 1M8KA 3BMXA 5AOCA 3RT1A 4E33A 1UMDA 3KCQA 3W3AH 3WTCA 3EGIA 3ADDA 4EL5A 1N7HA 3ZZ1A 3LXXA 4LI3X 1II8A 2RJNA 4C78A 1KYIA 3ZBPA 4M7PA 3AR9A 5CFMA 2QZ9A 5H9WA 2WW8A 4BP1A 4MRAA 1LQ2A 1HF3A 1XF1A 2C31A 1VSTA 2YWRA 2KYRA 2PEYA 3BXEA 1X7ZB 4PPFA 4CF3A 4DR1B 3FOFC 1YL6A 2NN3C 5K0ZA 5JY6A 2PZMA 1ZEMA 2F9LA 1BXZA 2XKJE 4QGHA 3N0XA 4M0CA 4OLJA 4PS0A 4E14A 5C4MA 2CBGA 3DWGA 1IDN1 4LY0A 2D1YA 2IYPA 4OJNA 3VVCA 3PPYA 5BN1A 4EWLA 5EIEA 3D6HA 3OTQA 1M1UA 1T8WA 2GZMA 1T8RA 2QENA 4XYMA 4MUYA 3T7KA 2ZYDA 3CZQA 4MCIA 5FHQA 3ZCQA 5BWMA 2XCOA 4JB8A 1EDEA 4IY1A 4V0MA 5THKA 4YHBA 3U1TA 3V2IA 5K0JA 2R7NA 2XAAA 3M6UA 4S35A 3ZCUA 2Q9CA 2Q2WA 3B1XA 3L7OA 1L7DA 1IZ8A 4LZWA 1PKXA 5DN6A 1R0XA 2HMUA 1JHRA 3UVEA 2ZUSA 5CEEA 5I5EA 1U0LA 3C6KA 4UUBA 1JEYB 4NONA 1XXLA 1VE3A 1US8B 4BQOA 5HP4A 4ARAA 4PCLA 2WP8J 3QVGB 1N2ZA 2ECQA 3PQCA 4I1VA 3GGDA 3GLIE 2O1WA 3M1AA 5L6MB 6LDHA 2BCEA 3OZDA 4FZVA 3UFXB 2VDUE 3VNRA 4NJMB 4FFRA 4Q3OA 3NYWA 4MUGA 4QFCA 5PGMA 1QV7A 3ZCVA 3AP2A 1JXMA 4HVTA 3CJQA 3LPDA 3OAAD 1V4NA 1W19A 2NGRA 1ESEA 4U8GA 5B3JA 4CJXA 5KOIA 3CRQA 1M67A 1L5KA 1WSDA 1V9CA 3TK1A 1XTRA 1FZTA 1KMHA 1QHGA 3DHWC 1RQPA 1WHTA 2FR0A 4XLTA 4HDNB 5IMBA 4BU1A 3KKLA 3OM9A 1VXOA 1JG6A 4BKMA 4Y0NA 4B4VA 1CRLA 4O1HA 5T6MA 1N2CA 4CYMA 4Z1OA 4J7UA 1V8BA 3P0FA 4MJLA 5GIOE 3V9AA 1ZN8A 1F8GA 1U5BA 3SHOA 1P9LA 3DBOB 3DG9A 3ZXXA 3VNVA 3AHIA 2BHLA 2GYWA 5EJMA 1TD1A 1Z6ZA 1SHTX 2LIPA 2QNRA 2FEKA 4ARSA 3TRJA 3QWAA 3VO8A 3PV0A 4IL5A 4INPA 3PQDA 1NJ2A 5CTJA 4KDRA 1EVEA 3BWCA 4NCAA 2GS9A 4YHHB 3P45A 1RJFA 4DIKA 4M8KA 4UNNA 4EJFA 4Z5XA 3FYHA 4GW3A 5HMLA 4BO8A 5HJ7A 5EMMA 4PCVA 4QUIA 4G4SO 2RD2A 3BRWA 2QE6A 2BRUC 3LXRA 3PFGA 1IEVA 5A3SA 1UR5A 1ZNQO 3Q72A 4NJOA 1WOMA 3VNAA 5KBYA 2N47A 3TIVA 3KELA 3DO8A 4OP3A 5KYNA 3L93A 1B0ZA 2ZT5A 3ENWA 3VOTA 3VU8A 5A1TA 3GOHA 5I45A 4P98A 4EENA 2WICA 1A72A 4UOZA 2NZWA 4DNXA 3BEOA 4YCCA 5SICE 4C7OB 1I1OA 2UVQA 5JJLA 5MHTA 2DUJA 2J41A 1DDOA 2AQIA 2RGYA 2BMAA 3QBVA 3QH4A 5IK2A 1WXGA 2P35A 3V8BA 4ICIA 4V38A 1GAXA 3VFDA 3GHHA 5E1OA 4YI5A 1QV6A 3MGAA 2WNHA 1KR5A 3TRDA 1R0ZA 3W5DA 3GV0A 3IAHA 2O8EA 4EARA 3ELBA 4FJ1A 1QRSA 1Z25A 4YP9A 1WXIA 4Z1MD 1C1XA 5HQJA 4UKDA 5T8KA 2SBTA 2CMKA 3BD6A 1M34A 3FDZB 2QD5A 3H8VA 1T26A 3KTAB 1QXSA 3MJRA 4UTXA 3LY5A 3TQOA 3AEUA 5AW5A 2GPSA 5L3ZA 1RR6A 2BRUA 3E23A 1DG1G 1CLEA 2IEAA 1WBBA 1ST2A 2WVAA 1ZNWA 2QLTA 4PTZA 2D5AA 5EG5A 5E4TA 1KMCA 1MO5A 2X41A 3R6LA 3SC4A 3WA6A 2GDJA 2DRIA 5C1OA 1SOWA 1FJGB 1ILEA 5BVHB 2CE2X 3ZWMA 1VIAA 1XD2A 2VUHB 3THOA 1RIFA 3MMNA 4JT9A 5CHEA 4YTEA 2X0EA 2XGOA 3UFXA 2ZJFA 4J90A 1CJUC 1AB5A 3BTUA 1H2RS 2XYQA 3FNRA 4X91A 4EHJA 2B99A 3KSZO 5M7EA 2XADA 2F4VB 3IPYA 4K6HA 1YR3A 1VYUA 2IZ1A 4MP6A 2C77A 3NWOA 1I1NA 4CIVA 4F96A 1FDTA 3ORFA 4HRXA 4FJ0A 4YQFA 1EZZA 1DKLA 4C76A 3QUTA 4ZZ2A 1H0RA 3ES9A 3A6ZA 2RB4A 4I1OA 1B8OA 4MUBA 5LDGA 3RFFA 3T4PA 3VXKA 3EZ2A 4DA8A 5HX7A 2DR3A 3TLJA 3U81A 1M2VB 5KNBH 1IBSA 4BGDA 2PSJA 3ZU4A 3SBEA 4U2CA 3TTUA 1NVMB 3AP1A 1DQPA 1Z0ZA 4FCTA 3B53X 3HU2A 4BO5A 2OQVA 1DMSA 2P3QA 4IXWA 3DMTA 1QZZA 4FOOA 2PL9A 1UODA 3PE6A 4MRPA 2IYFA 4IIXA 1KAHA 1WRBA 2BFFA 1AZSC 4OP2A 4RVHA 2K5UA 4I55A 2CFTA 1QGAA 5BT9A 4CQMD 1XZNA 1NU8A 3TJZA 5GVSA 1C3VA 1AO0A 2CT8A 2LVBA 4GE3A 2V74B 4RSHA 4RU1A 1P74A 4NZOA 1WB9A 2A1TS 1WW8A 5G1NA 1XSEA 3VO2A 2Y1GA 3NWEA 1M10A 2PD3A 4YIKA 4EJSB 4NQRA 1EE1A 3N59A 4PYNA 1RZRA 4WLFA 2GBLA 2D1TA 4FPXA 1OFIA 1Y5LA 2ZIXB 4P4LA 4NV1A 4WW0A 1TK3A 1KSHA 4IG9A 4LCEA 3S40A 4D98A 3SSAA 3O94A 3TLAA 3F73A 7MDHA 2ZTVA 3OQJA 4L5JA 2ZIZA 4RPHA 2IXTA 1SCUA 4LDZA 4RHUA 2O6HA 4XW2A 4BLQA 4UVHA 4DYHA 1ZESA 2IYZA 1CQZA 5AR1A 4WDQA 4U2DA 1L1QA 3OEHA 5AM2A 4DIUA 2VH1A 4MYCA 3PC3A 1U7ZA 3VH1A 3N2LA 2XBUA 2VZ9A 4HV4A 1N3BA 2VYVA 3UTCA