3RVUC

Structure of 4c1 fab in c2221 space group
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
QIVMTQSPFSMYATLGERVTITCKASQDIYSYLSWLQQKPGKSLKTLIYRANRLITGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPYTFGGGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4C1 Fab - light chain
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvuC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvuC01
1LEIA 1RAMA 3CZJA 3GSWB 2Q20A 4Z0BH 3CMGA 2R9HC 2NLJB 4U1LB 2QR0B 1ZT7A 4G6ML 1AC6A 3VRLE 4Q74A 3SDCA 2DTML 4YDLB 3I6GA 4UU9A 4E42A 1DE4B 3ULUE 4LLWA 5FYKU 2RHEA 4J4PD 3LQMA 5F1IA 4KUCF 5CUSL 4JZNA 4U1HB 3IDYC 4XMPH 4NQDA 1WUNT 3REVA 2H32B 4LSTL 3T4YB 4GUPB 4DEPC 2HRLA 3WHE1 1M7XA 1RZFL 2FSEB 4L9DA 2BMKB 1EXUB 4JB9L 4R4FL 1CXHA 2JLLA 3EFDH 4Y8DC 3FB7B 3QRGL 5J57B 1CFVL 3BVNA 5TF0A 2G2RA 5FK9A 5CZVH 1BFOB 2IAND 2RR3A 4KUZH 4D8PA 1FIEA 2E6JA 3OR7B 4TOYL 2EKSA 4MDJB 2WLZA 3MCKA 1H5BC 1DLFH 5KSAB 4L4VB 2ZG1A 3NIDE 3DXAD 1HHHA 5C7XL 2PXYB 1GH7A 3OPZH 1OLZA 4WO4B 2XZCH 1A1MA 4JEGB 1QO3B 4P3CH 4PG2C 4F3FA 1JHLL 1CICB 2MCPL 1OGTB 4OFPA 2ICES 1HKFA 4N8VG 5D2LF 1ZLSL 3PV7A 1OLLA 4Y88A 5EOTA 3I6LE 4BH7B 1DUYB 5DS8B 3R06B 3KLDA 4X4ZA 5C6TL 4R4BB 1ZT4A 4Z9KB 4JFDB 4HKBA 4UDTB 1FNEB 1ADQA 1HHJB 4HFUH 2WIMA 2I9TB 4M7LL 5EA0L 1TMCB 1S5IH 5FECB 2H1PL 3RVWD 2ITDB 5ID1A 5H2BA 2C3VA 2ZSWB 3EAKA 4U1SA 5F1NA 3ARFD 5D72H 5IROA 4RQQB 4U3HA 2ZOLA 4XP4H 5AAWA 2ITCB 5IW1A 1V5JA 1JBJA 2VZOA 3QDMB 4MXVE 4NNXB 5HPMB 5CJQL 4S10A 2NY5L 5TFSL 5E03A 4HWBA 5CGYC 4OD2A 3RPIA 1CE6B 1EBPA 3B2VH 2EIZB 3PWVB 4X6CE 2APBA 7FABH 2HFEB 3RNQA 2NY1D 2X4PA 2FO4B 5FO7A 3CFJA 3PGFH 4WY7H 5EIIB 4D3CH 1JWMA 1F4XH 3QXWA 3SGDH 4KKBC 3LN5A 2M8XA 4Z5RA 2QSQA 3ZKND 3X14A 5MEOA 2WINA 1R3KA 2J8UF 5IB3B 5HYJE 4I1NB 3MACH 2Y07H 2VXUH 2QSVA 4B0MM 4DVBA 4PJ5A 2IALA 4KY1L 1DBAH 3LKOB 1W0YT 4UUJB 3C2AH 1CT8A 4L8BA 3KPPA 5HI4D 2AEQL 3H42H 5I1DA 1RUAH 4P5TD 3FCTA 2DWEA 1U8KB 4OSUH 2Q76A 4Z7WF 2DQDH 5LXGL 5I15H 1F4YL 5JA8B 4N8VA 3O9WB 1P7QA 4M5YL 1I1CA 2FJHA 1WCBB 3MRQB 1P1ZB 3SQOL 1F00I 3BXNB 1T1ZA 5FA3B 1JGVL 3PWPD 1AIFA 4HK3N 4X8JB 5F7MC 4KJPC 2NW2B 4D9LH 2VAAA 1A5FL 3AROA 3ULVH 3ZL4H 4AENB 2Q86B 4NJ9L 2MFNA 4PB9H 4H0HB 5J6HB 5J3HC 3MLRL 1CFTA 5J06A 3O45A 3NFNB 3BWUC 2Q87A 4X9GA 3GMQA 4X7DC 2JJVA 1F90L 5GGRY 1IBGL 1AXTH 5I1AB 1H0DA 3RDTB 1OTUD 4R2GC 2BRRH 3ARBD 2NR6C 2BNUA 3SKJL 1K2DB 2EXYC 2PYFB 2XI9A 2IANE 2OQJA 1F6LL 5EC1B 1J8HA 4JPVH 1OARL 4NIKB 4YHIA 1FFOA 5DJZA 3C6SB 5DJCB 3BAEH 5DJDB 1A4JB 3DX9A 2HT2C 4J6RH 3QIWD 4LBEB 4TSBH 3SGEI 3LMJL 3ROLB 4ONFH 1R3HA 2Z31C 4ETQB 1BEYL 2VLMD 3U4EA 3TBVA 3OX8A 4YQXH 4F15B 1I1AA 5ALCH 4FG6D 4WUKL 1F02I 3NCYP 4MQ7A 5K33A 5D6CA 4U6XA 4G6KH 1OTTC 1FVCA 4PB0L 4K2UH 2A38A 4N9GB 4XNUH 3FOLB 3CK0L 6FABL 2LABA 3TZVB 4PTTA 3L5WA 5EWIL 4Q6YA 3SE4A 1FL5B 5ACZA 4JFHD 4DVRL 2FR4B 4K9EL 2ZSVB 3W9EA 3TO2A 5LGHH 4XVUC 4QGTA 5H8DA 4KV5F 4JPWH 1M05A 4JAMA 2YD6A 5HBBA 2DD8L 1HINH 3MLYL 4WNQA 3QUYB 2KL6A 5FYLH 3PDOB 2Y36H 4ODUA 2G75B 4M7ZC 4OGZA 5F1KC 5GRUH 4PRPA 4I3RH 4RGOL 5C0RH 3VFNA 4WRLA 1YYLH 1FJ1B 1TJHH 1XIWB 1R3LB 1HHKB 1XF4A 3FRUB 3PL6B 1UM4L 1MVUB 3TT1H 5ALBH 5FHAH 1EZVX 3WDIA 5ESQA 1BQSA 3BZ4B 3QIBD 5E5MB 5HHVH 2PTUA 2FCBA 3UZVB 3CPLB 1KN2L 4NO5A 4EN3C 3EDDA 4PGBB 1OSZA 1KJ3H 5I8KL 5FDYA 3WYRA 1KG0B 3P77B 4YDIL 3BKJL 4FFYH 3OG6B 4HLZG 4L3EA 5MENA 5KSAD 4DJMA 5KN5B 4JFFD 1H3PH 3WUWG 3QEQE 2PXYD 3ARYA 4WO4D 3V4PL 3OGCA 4LSQL 1FH5H 3EO1B 4Y8AA 5EFIB 3BFOA 3X3FL 4HIHB 1RY7B 4LFHD 3G5ZB 3INUL 1YDPB 1ZE3C 1BREA 1LO2L 3MBXH 3W9DB 1IEAA 1KUMA 3MV7B 1RZJH 4GRWE 2LAAA 1HXYA 3MRJA 4LCIH 4QTIL 1KC5L 2HT4D 5FCUH 2W9LA 4M7KL 3FMGL 4WTZG 4R0LC 4UIMB 3EJJX 3MV11 1K9TA 3VD9A 5CBAA 4Y2DC 1S5HB 1A9EB 1VCAA 5AG9A 5FUOH 1T4KA 2V7HA 4M1CD 4APQB 3F62A 3VGHA 2IAMA 2MQCA 3QDMD 5E00A 1D5ZA 5HGBB 5DD6A 3WFDL 1SMOA 4QEGA 4ZXBC 4YHYB 4R4NC 4XVSH 4DUWA 2HVJA 3S3JA 4EJ1C 2OTPA 5ECJE 2ED9A 2QQLL 1X6NA 4K3EH 4MLIA 3VFOB 2EE6A 4NDMA 3QEHB 4BZYA 2FATL 5D70H 5ISZD 1WAAE 3LPWA 4GG6E 1PKQA 3JWDH 5DFVC 4MJ5A 5EUKB 4ZTPH 3OKNA 3OR6A 1NC4D 1U3HC 2WBJA 3BISA 1R5WB 3LZFH 3Q3GA 4TRPL 5C0JB 3WS3B 1JNHA 3T65B 3FHQA 5DUPL 3OWEA 5KSBF 3FB6A 3QHFH 5L9DH 1XF5B 3VJ6B 1IZJA 3D25B 5CSBA 3EO0B 3HNVH 3V79C 4ZUVA 5I16B 4OM0H 4ZD3H 4YPGA 3ES6A 2Y6SC 4GKOA 3EYVB 4UBDC 4PRAA 1KCUL 5FKAA 2ZKHH 4AMKH 4N5ED 2IC2A 3DX6B 3WUWA 2R2EB 4G8EA 2AJSH 1YEKH 3FN0L 1X7QA 3HC4H 4KWUA 1B6UA 3DROA 3KLSA 4NZUL 4RMWA 2PCPA 3VGAB 3TVMA 5IVXE 4OJFH 4TTGA 1HYRC 2BCKB 1CBVL 4JVWA 3BDXA 4U49A 2GTWB 2YD5A 3OAUL 4HS3A 1NUNB 2EDHA 4X6BB 5IBUB 3AREA 3JZ7A 3UJIL 3NZ8B 4Z7QE 4R26L 3UTTD 4QRQB 4LRNH 5EBMB 1HHGA 4LF3A 2DQEH 4HX1A 3TIEA 4FABH 4XXDA 3K0WA 4WTZA 2XG5A 2FECL 4DGIH 1TZIA 4HK3J 2VLLB 3DMMB 3NIFE 4X9HA 4G9FB 1QZ1A 5IGXL 2FJFA 3MSPA 2Y9RT 4U6YB 3WSQL 1A1NB 1YEIH 4KU1A 1FVEA 1T22B 1P4LA 5I8CB 2DYPA 1OB1B 3GIZH 4OUUA 4PGEB 2VDNH 1UFUA 2DIAA 2HKFL 3S88L 3RWCB 4XMLH 3I9GL 5FDWB 3W11C 5F6IC 3U7AA 4GMSH 3O11A 4Q6IA 1NLDL 2J5LC 1YEEL 2ICWB 5H94A 1VACB 2YC1B 1A2YA 4QXTA 1LEGB 2VL5A 3QDGD 4OZFG 4U2YA 4L4VE 2B7DT 4LPXA 3CDFA 2FX7H 5GGQL 1QHOA 4DTGH 1D6EA 2UYLA 3W39A 1KLFA 5DJ2A 4GQPH 3MREB 3RTQA 4X6DF 4S11A 5GS0D 3HI5H 3T8XA 4WFGD 2VLRD 5A2KH 1J86A 1YN7B 4P2RA 2MKLC 2VN4A 2GHWB 3NACL 4X98A 4A2MA 2VDLH 3VRIB 5T5FH 1OAZL 1MFDL 5DK2B 2X10A 2PF6A 3ARPA 3QH3A 1HZHL 2NXZB 2X4RA 2V7NB 5D7IA 5HDQH 4PGDA 3L95A 1AC0A 4OCXL 4NRZA 3QNZA 4OZHF 1AE6H 3ULUL 3QG7L 2G9HA 4BFBD 3BEWB 5D2NA 5CP3A 2AKRA 1I7RB 2EXWC 3QXAB 4NPYA 1FSKB 4PS4H 2BK8A 5F71A 3UTZB 3PQYD 1KPUA 4ODVL 3QDME 2G5RA 4Y5YC 1P69B 2JIXA 2JCCF 3Q5YA 2JJUA 4WI4A 4UNTA 3P0VH 4NNYB 3QUYD 3MPCA 2KQNA 1G7IB 5HHXL 5ISZE 1NANI 1KIPA 3LD8B 3VWKA 3AAZB 4FTVA 4LCWD 4NNPH 1XIWD 4BSVB 2XWTB 5FO8A 5HVGB 1MWAL 2VOTA 2Y7QB 4PLOB 4GLRI 2B1AL 3MOAL 4JZJB 2W07A 1NCTA 4OZ4B 4ZO8A 5CEZH 4WU5B 1JRHH 43C9B 1KJVA 3MNVB 4U7MA 5C9JB 1FLRH 4LLVB 4L8DA 1UG9A 2R0LH 4OZFA 4Y4FC 4P4KA 1MRDL 1MI5B 4KJYB 4JO3L 2RBLA 1P4BL 4DN4H 2FL5A 2OR9H 5DJYA 2ZP0T 1NFIA 4MGXA 4RIRB 1IEBB 5DVKA 2AK4A 2PTTA 1YEHH 1WITA 4KROC 4ODXB 5ICYA 2WIIA 1ZKAA 2BVQB 4PRNA 4NQSB 1A0QL 2DRUA 4XWGL 5CILL 4TVSa 1R3IH 1FG9C 4RMQA 2ICCA 1BWWA 1HXMA 5I75B 3SQBA 2ZUQC 2O5XH 1BQLH 5IHZA 3RI5F 5B4MD 1T89A 3LV3B 1NL0H 2IPTL 5EN2A 1JI2A 4APQD 3IU3B 1FPTL 1CQKA 3S36H 4RNRB 4U1GB 2VC2L 1Y18A 4YHKH 3ZKXB 3U9UB 2HKHH 4EKXA 3IJYB 3F6IA 3IDUA 4HWNA 1EO8L 1KNOB 3RNKB 5C0EB 4IRSB 1QLEL 2PR4L 3QCTL 1WBXB 1IZKA 5KZCD 2ICEA 4M5ZL 2WWMD 5TH2A 2UZYB 3QWOA 1XGUA 3JWDC 1KEMH 1X4YA 3P4MA 3SE9H 2I07B 5H37G 5SWSD 3U0PB 2QLVB 4G5ZH 3A0OA 5EOQL 1DQJB 4QHMA 1CL7I 4GXUN 3MMEA 1LP9B 3JV6B 4QTHB 3CFDB 5GRVK 3MLXH 4LP4A 3RY4A 4RFEA 5IESH 1C7TA 3KPTA 4L9LC 5IBTH 3N1FC 2FYYB 2XXMB 3RU8L 3GSNH 5DT1L 1MJ7H 3D39D 1YPZF 2FX9H 1F3JB 2J3SA 3BIKA 1T7YA 3MRRA 1MCHA 3MJ6A 6CGTA 3HKFA 3C5SB 3O0RL 1AGDB 1CGSL 1MHHB 3GJFA 5DO2D 1G9MC 3VXMA 1JF1A 5J11C 3WLBB 1MFAL 4RISL 3KYNA 1G7LA 1R5VA 5DXWA 2V2TA 4KQ4H 3QCVL 1FIGL 5FXCH 3GSOB 4LLYB 4HPOL 5SX4H 3RWDB 3OMZA 1VFBB 4GBXC 4JZOB 5DJ0B 4BFIB 3PQYE 2V5MA 2EE3A 4ORGA 3R1GL 2FJGB 5HDOA 1UJ3C 3UJTL 4FQ1H 4PLJC 4MAYA 1I3RA 1AFVH 4HMDA 3B6SA 2A6JB 2D0FA 32C2A 1CDJA 1PYWA 2VUOA 1T1XA 4XAWH 2J8HA 1NC2D 2EDDA 3V52L 3WIIH 2MSPA 5IFJA 4HIJB 2OBGA 1JHKL 3DVGA 1MCWW 5EZJB 2ATPA 5FYJU 3HNTH 2P47B 4JM2C 4G6JL 2UZIH 4CVWA 3CGTA 4S1RH 4ZOCA 4Y4HB 4TN9A 4GAGL 4GKZA 4JRWA 1BIHA 1BJ1J 1SBBA 4DCQA 2V17L 3BQUD 4K7FA 1MQ8A 4X9IA 4ZDHB 1U8HB 5DGRA 5ANME 5ESAB 1T20B 4HKXA 4YBQC 1U8LB 4XCNA 4PJAF 3SKNA 2R1YB 4EQ3A 1X5AA 1QG3A 3ULSA 4XPAL 1KPRA 1UM5H 3GMPB 4LVNB 5EUOB 1MWAA 1LE9A 2YD4A 2C3GA 3DHJA 3B5TA 3NCMA 4RGMC 3QNYB 4TSAH 1PSKH 2YR3A 3ARDD 3MV7E 3VXUD 1S7QA 1D9KD 2X42A 3I84A 3L3KA 3OKOB 2B1HL 2BDNL 1J1PH 3P9LB 4EDXA 1NCBL 1A6TA 1ADQH 5BZWA 1MIEH 2DMKA 5JTWA 3VRJA 1I85A 5DJ6B 4QCIA 3GNML 3L3GA 2BVPA 2F58L 4MA1C 4IHOB 5DK3A 3K1KC 5FUCC 3QUXA 4FQXB 2E7HA 4KQ3H 3MBEA 1PEZA 2EC9U 3HPLA 5F88A 5B38G 5I1KL 1RVFH 1GC1H 3IETA 4NKDB 4NM8H 3VE0B 5IMKB 3ARGA 3MJ7A 2X4OA 5I2IB 1DANU 3DYPA 3VW3L 1V3LA 3ZYIA 4HWBH 4P2OD 1R0AL 3RWJB 1P6FA 2B4CH 3B9AA 4XPGL 5BW7A 4MNGB 2X4SB 4KHXH 3MLZH 1PVHA 1N7ML 3IDXL 5M7QA 3PABB 3ZKQD 4DZBA 3F12A 3NABH 4X6CA 4IRZL 5SWSE 3MRKB 1HH6A 5JDSB 4MJID 5KVEH 4I5BB 3OAYH 1S7RA 5GGUB 1QR1A 5CIPA 1MIMH 5AWNH 3V7AG 2CGRL 3U0WL 4EI5B 1A9BB 1SJEB 4JG1L 1CR9H 3DUSB 3EOBB 2IBZY 5AG8A 4TVPH 2R15A 3ARUA 4WTWA 3WN5B 3QA3A 5HYJA 3D39E 5IVNA 4LLQB 1JPGA 1AO7B 4JDTL 4XH2A 4D94A 4NKOB 2NY4B 2QSCL 4J3UA 3MLTA 3BGAA 1S7WA 2PNDA 5CAYB 1U8JA 1KB9J 5JIIA 3GB7A 5C2BH 5KG9B 1K5NA 1IKNA 2QJDA 1MNUL 1S7XA 2JJWA 4K8RC 2EO1A 5BV7C 3RZCA 3CX2A 4EOWL 5C0BD 5JW4Q 5F9AC 2LTQC 4OFIA 5C07B 2XQYK 4MX7B 3EOAA 1U8NB 3MGTB 1VFOA 4OQ1A 2XA8H 2DQGL 4X0KA 5D7SL 1WBYB 1P4IL 1MJJA 35C8L 4KDTA 2I26N 2BXYA 1K8DA 2VXSL 3FT3B 1EK3A 5B38A 3V6ZA 1EHLH 4L4TD 4PJXB 3K4DA 3QO0B 3IXAA 4CMMB 2FGWH 5F9DC 4HIIA 4J4PA 1M71B 4YGAB 4HMEA 3RVXD 4XPHL 4ENED 3PJSA 5L2JA 3TH4T 3CX5J 4G6MH 1ND0A 2XPGB 2W0FB 4MDIB 2PW2A 4I3SH 5F7DB 2EH8L 5I18L 4PPTA 2DTMH 2XFXB 1J05A 4IM8A 2NMSA 5SV4A 2GITA 2WMPA 2AXGB 3UC0L 3TBYB 3I3EA 3DETC 4WHTB 5GRJL 5J12C 5CD5D 1WT5A 1ORQB 1I4FA 1OW0C 2IANA 4JRXB 3ROOB 1T1YB 4U1JB 5CUSH 5IOPB 4WJ5B 1K6QL 3GSUA 3LY6A 3T77B 5KSVB 3DXAA 5HGAB 2ARJQ 1CXFA 1RZFH 4PBWD 2D7PA 1L6ZA 4JB9H 4LOUC 3SO3B 4R4FH 5EBWB 4NQTA 4YC2B 3RPKA 4PIRF 5F21B 5EU3A 3IXTB 4MD5A 5I73B 3WE6B 3UBXB 4TOYH 1IMHC 2IH1B 1N4XL 5HDBE 3K1DA 4EUPG 4WFED 5DRZA 2F74A 3PGDA 4JFYA 4M7JL 5C7XH 2YUVA 2OZ4L 1JHLH 4XVJL 4ZFFB 4CMHC 2MCPH 5INDA 1EEYB 3ARFA 1UXWB 5FHBL 2VB5A 1ZLSH 4IJ3C 5I71C 1NBVL 1ORSB 1X5LA 3M17B 3PHOB 3BE1L 1WWAX 2MPAL 1I8IA 1JV5B 4LHUG 4QOKB 5C6TH 2F54D 3HLAB 1UC6A 3RFZC 4M02A 2NW3A 4R97C 4HJ0D 4XHJC 1IAIM 4X6FA 2BOCB 4M7LH 1A6UL 1H15B 2H1PH 4PP2B 2RQ8A 2BRQA 5F3HA 5F6HJ 1CFSB 5EO0A 3WLWC 1P9MA 4DZ8B 5EB9A 1WJ3A 4N0CD 3DGCR 1I8MB 1X5YA 4S2SA 2FRGP 3FO2A 2DM4A 2JJTA 1NDGA 4WV1B 5CJQH 5D6DA 1QVOA 3VXRB 5IWLA 1I7UA 5TFSH 5TDOB 4YDVB 4OTXL 4Z78B 5FA4B 3S4SA 4Y16D 3S97C 2X1QA 1MI5E 5JOPD 5IBLC 5JQ6L 3WL9A 3CFIC 4LEOA 5IKCA 1F45A 1OP5K 3IDIB 1YMHB 5DQDL 4CNIA 2EDNA 5JIKA 4UQ2B 3L1OH 5EU4A 1J12A 4G6AD 3TBSA 5J6GA 2XZAL 2J88H 4PRDA 4P5TA 3LH2L 5C08B 2VUYA 3QEQA 2FLBT 4I9WE 1H8OA 5JW5B 1W8NA 4NWUL 3B5GA 4QY8B 5EBLA 4HS6B 4D0BA 1RIHL 4ISVB 5I66A 3MUY1 4KY1H 1Z0MA 5L2KB 3L7FA 4CBPA 4EUPA 5B8CA 4JE4B 5AUMA 1B3JA 4RX4A 4XP9L 3E6HB 4JJ5A 2VMFA 3KPQB 5JO5B 5IROC 2OP4L 3IGAA 2EDTA 5LXGH 1KULA 4LIQE 4MB5A 3BPNC 2I5YL 3O8XC 5TF1L 1UKTA 1ED3A 4M5YH 5I1CH 2YEZB 2XWJA 1GZQB 2B4CC 1QA9B 2DKMA 3SQOH 4LHUA 1HOCB 2CIIB 4N90D 3WJLC 4CRPA 1JGVH 3AS2A 1JPFB 4PJDB 2VABA 4ZOBA 1A5FH 5GGRA 3MRMB 3ARBA 3V5DA 4NJ9H 2AV7B 4QRSA 3TH3T 1WAAA 4PTUB 4GG6A 2VXTL 2W9DL 3MLRH 1ZGLB 4CW1B 5D5MB 1LP9E 4K3DH 3T0AA 4J8RA 3HR6A 5C3TA 3QIWA 1F90H 2BOBA 3KWWA 4XBGB 3WEXA 3LKPB 2F8VA 4HLZH 5IW6A 2NYYD 3TV3L 2ZZUT 4LFHG 3OJMB 4PJCF 3SKJH 2NY4D 1SYVA 1YJDL 4GAJL 1K4CB 2E7LA 1N5AA 1QLRA 1PX3A 2IH3B 2XKSA 3IDNB 1YUHA 4PJFF 4WFEE 4KRPB 2AQ2A 5JXEC 2ORBL 5I8OL 3B9KD 4D9QD 2EE9A 3IKKA 1OF2A 1WV7T 3RWGA 1PG7W 4YHNB 3MNWB 1FZJB 5IVXA 1BEYH 1DN0B 5C9KA 1ZHNA 5F9JB 4NHUB 1KCVL 4FOMA 4LARH 3GSWA 5FF6A 1G6RL 1XMWA 2O5ZL 4MNQB 4B5EA 3EO9L 2NLJA 2F54E 1FNGB 2NZ9C 4K3JH 4U1LA 4WUKH 5D1XD 3LS4L 4F7MB 4UZGA 4LQFH 3X3GL 4PB0H 1L7TL 4HJJL 3QUML 4F7TA 1DE4A 3MLSL 1V3JA 6FABH 4XNXL 2WQ8A 3FQNB 4N0UB 3HZMB 3V4VL 1BQUA 4KPHL 5EWIH 2OZ4A 3FZUC 4U1HA 1YY9D 3O4LB 4DVRH 3O6FD 1JL8A 2N1KA 5D71L 4K9EH 3ILQC 2H32A 3T4YA 4GUPA 5B22A 4M48H 2FSEA 2BMKA 4P23B 4LAQL 2DD8H 3AC0A 4M3KB 3PXHA 4DKEH 2EZ0D 4PJIF 3ZE0E 3FB7A 4F7PB 4KJQD 4UB0L 3SOBL 4QWWD 1XGQB 1BFOA 4RGOH 4JRXD 5K59E 3ET9F 4QHLB 3OR7A 5CHNA 4MDJA 5EUOE 5KSAA 4XNQB 4JFFA 4OBSA 5IFAH 1UM4H 2PXYA 4WO4A 4JQIL 1QO3A 2V5YA 2UWEB 3VA2C 3R0NA 1OAXL 4XT1C 1ROWA 1JF6A 3CUPA 1WIOA 1KN2H 4BH7A 4KZEL 4R8WL 5I8KH 1DUYA 4YDIH 5DS8A 3BKJH 4KTEL 4R4BA 1KGCD 5CP3H 4UDTA 1G7PB 3RRQA 5BVPL 1QSFD 5FEBA 1Z0NA 3QWRD 2VH5L 2I9TA 1IAKA 3LKNB 3V4PH 2P49B 3SE4C 5FECA 2ZSWA 2A6DB 2GJZA 3HCVB 2JELL 3UTSB 3X3FH 4RQQA 2B5IB 3INUH 5D9SB 3HRPA 1D5MB 1S7SB 1LO2H 4OCYH 2ITCA 2IEPA 1SEQL 4P46B 4HDIB 4MNGE 5E8PA 3QDMA 4NNXA 1MCDA 2CRZA 5HPMA 1CL7L 4YDKL 3VXTB 4QTIH 3TNNB 1KC5H 1CE6A 4M7KH 3PWVA 4M1DL 1OAYL 5ISZA 1W0VB 4D0CB 5C0GB 2N56A 3V4UH 2FO4A 4QHKJ 5EIIA 2AAVA 1WFTA 3HG1D 4NQCB 3MCLL 1MAJA 1NC4A 1U36A 25C8H 3CH1B 3Q48A 3T08A 4BK5A 1QSED 1RIUH 1Y6MR 3WFDH 3T0EB 5F7FA 3VXRD 4L8CB 4FQPA 5IB3A 4YWGH 2NY5C 2EYSB 5HGGS 4WI3A 2XZQL 2QQLH 4OZFH 1AO7E 3K2MC 4U0QB 3IDJB 4E0RB 3DSFL 3BD3A 1MCSA 3QI9B 4Y5VA 1Q72L 3VI4E 1G7HB 2C26A 3LKOA 3C5ZD 5JHLL 5E2UL 4TRPH 2X1PA 2VDKL 3U30B 3UTQA 4LVOB 5C08D 5DUPH 4D9QE 1VENA 5E8NB 3SN6N 3FQWB 3BDBA 1O7VA 3EYUL 5T1KB 4QNPF 2M2DA 2X4TB 4HWEL 3EJZC 1P1ZA 4PJHF 2G5BB 5IMLA 4JKPH 3L9RA 4XWOD 5L2KD 3BXNA 5FA3A 1KCUH 4DAGL 5GSVB 5HVHB 4WTXA 3QR2A 3L3HB 1SHMA 4PJBF 3SJVB 3FN0H 1GPOL 4AENA 2Q86A 1A6WL 1A6VL 2GT9B 4NZUH 3P0YL 2P5ED 3IFLL 5J6HA 2DIBA 1CBVH 4PRHB 3NFNA 5J8OA 3OAUH 5KANI 4H0GA 1H3TA 5JW4R 1GGYA 5DJAB 1I9JL 3ARRA 4R26H 4PV9B 3KLAB 3ZDXE 3RIAF 5C3LD 2XTLA 5I1AA 3K3QA 3RDTA 4LCCB 1G6RA 1MRCL 4JANB 4FQQB 3VXNB 1K2DA 2UV3A 4U0RC 2PYFA 5HHPB 4JRXE 3T0WA 4Z95H 2NY6C 1T0MA 3TN0C 3OKKB 1MF2L 2HT3C 3QUMA 4ONOA 2E8YA 3G9VA 5IGXH 3K8KA 1RIVL 5A2IH 3C6SA 4UILL 5DJCA 3WSQH 5DJDA 3S9DB 2I25N 4A6YB 4R96B 5CGMA 3BN9C 1AGFB 3A6BL 3ZMRA 4LASL 1TETL 3HB3D 2HKFH 4J1UB 3S88H 3I9GH 4ETQA 1XH3B 4L1HA 2OJEB 4NC1C 2H3NB 4L3CB 4YHPB 1UACL 1LE5B 1NLDH 2EH7L 2AJ3B 3ZKSD 1JPSL 1YEEH 3GJFH 4OFDA 5T3ZD 1CDCA 1HI6A 3QIUB 2YD1A 3L6FB 3ORJA 4OFYD 4KRPD 4FZEL 4GO6B 4MXQC 3TVMC 5J9PB 1QSFE 2OLDA 2XN9B 3DLQR 5DLMH 4X5WA 4N9GA 3FOLA 3AREC 2X1OA 2HWZL 3KXFB 3O41B 4H20L 4MAUL 1D5XA 3TZVA 2IADB 4U1IB 3NACH 5D8JL 5CGTA 1Q9LB 5CFHA 1FL5A 1FC1A 3PQYA 1A6AB 4LSPL 4HLJA 1OAZH 1MFDH 2R69H 4QOKE 2C5DC 3X13B 3QO1B 3R0MA 3OKEB 4IEFB 5LKNA 3QUYA 4JFZH 1JMXA 4S1SL 1T83C 3ULUH 3QG7H 4UDUB 1NMCC 1FJ1A 1LQSR 1XIWA 1KLUB 1R3LA 1HHKA 3O4LD 5MI0C 2X5PA 1FORH 3JXAA 4ODVH 3THML 1KTDA 1QSEE 1MVUA 3VXRE 3WNMA 4PJ7B 4YEFA 5DQ9A 3MODL 1ITCA 1ZT1B 5SWZB 2MTPA 3BZ4A 5E5MA 2KBGA 5CZXC 4JKLA 5T1DL 4UIKL 3CPLA 1RK0A 2BSED 4CJ0A 5HHXH 1BX2B 5H37H 3PGCA 4PGBA 1KG0A 3P77A 3EYFB 1DQTA 3H9HB 5JZ7D 2QADD 3GSVA 4EXKA 4N0RA 1CGYA 1RJZB 3RTQC 2OL3L 1MWAH 5KN5A 3ULVE 2CO7B 5ANMA 5C08E 1TZGL 2VWEC 4QYOB 3JVGA 4JN2B 2CR6A 5A40E 1Y0LA 2B1AH 3TA3D 2GYSA 2R0ZH 3D3VB 4X7SL 5EFIA 3MOAH 1F4WL 4HIHA 1AJ7L 3TFKC 3G5ZA 1YDPA 3DX7B 4O51A 5IBUG 4Y4KB 3TO4D 3W9DA 5BJTB 3KPMA 1RHFA 5L2KE 3KYAA 4G80B 1MRDH 5I8EA 1E27B 5HHQB 4ODBD 5D2NC 1PW3A 2A9NL 1P4BH 2X9XA 4N68A 3S37X 4H25B 4ERSL 4HAFA 1WZ1L 4UIMA 2R2BB 1JWUB 2XQBH 2JJSC 3UTSD 1S5HA 4D2NA 1A9EA 4PGJA 2VYRE 2YA1A 4P46D 4APQA 2FEDD 1A0QH 4OF7A 3VXOB 4I0CC 1XZ0B 1VGKB 3BGMB 3VWKC 4PJDE 2HRPL 4IBLT 3SY0B 1XGRB 3QQ9D 4U1MA 3QEHA 2EIBA 4YHOH 3GSNB 3SDXB 4U6HB 1OT1A 5D5ME 4XTRC 5EUKA 5CIPH 4MQTB 1A1OB 2IPTH 2FHBA 4OZIF 1R5WA 1FPTH 3P40A 5C0JA 3WS3A 1CDIA 3T65A 5SWSA 3KHOA 2WP3O 1KB5L 1XF5A 1XGYL 3VJ6A 5GJSL 2OX5A 3C09C 3D25A 3H8NA 4P2YA 3EO0A 4BQ8A 1V3KA 1EO8H 1LEIB 1QLEH 5I16A 2PR4H 4FFWC 3QCTH 1XGPB 2BSRB 5T3ZE 2V6HA 4M5ZH 1ZT7B 4NBXB 3QFDB 3EYVA 3D39A 2Z0BA 3DX6A 5FYLE 4OLUL 3N50A 3SDCB 3P2TA 3KPSD 2R2EA 2JTDA 3TCLA 5EOQH 4XXCA 1Q0YL 5AYUL 2Q7NA 4LLWB 4LIQL 3H2WA 2CSPA 5T1KD 2BCKA 5GGTL 3KAAA 2VISB 3BGFB 2GTWA 4X6BA 3HUJB 3NZ8A 3RU8H 4MNQE 5K9OB 1G6VK 5DT1H 5CEXB 1LD9A 2DAVA 5KW9L 5EBMA 4DQOL 1T89C 1CGSH 1CFNB 3SJVD 5T33L 1SYSA 3BVNB 5FK9B 4RISH 3MZGB 3RHWF 4D8PB 1KFAL 2G60H 3QCVH 1FIGH 4ODTH 4N0UE 4HPOH 3O4LE 4W4NA 3DV6B 4FHBD 5DA0B 3R1GH 3WS6C 1A1NA 1T6VN 1FLTX 5AEAA 1T22A 1RMFL 3UJTH 5I8CA 3GBML 1OB1A 4PGEA 5CLWA 1JGLL 2OTWB 4MVBD 2YD8A 3RWCA 5FDWA 5EOTB 4JVUA 5E99L 1DEEB 2C3XA 4Y2OA 3V52H 1VACA 2YC1A 4AK1A 5MP6H 1JHKH 1LEGA 2DL2A 3BQUA 4HKBB 1ZLUH 5CBEA 1JN6B 4XI5C 5HHMB 5C92A 2W0KA 1TNNA 4UAOC 3KDMA 4HCRL 1DFBL 3NCBB 4G6JH 2UWEE 3MREA 4U1SB 4DFHA 1WIUA 4HEME 2EDLA 1YC7A 3RJQB 1QLFB 2ZOLB 3WJJA 4EBQL 2R56L 5DSCB 4CUCA 2H2PC 5DZOA 1D9KA 4ZNCD 2D4FA 4M3JA 5DK2A 1JI1A 3D2UB 4KXZI 2XN9D 15C8L 5B3JF 2YKLL 2KQMA 3EYOB 3KXFD 3CFJB 3KPOB 4AEHL 2OL3A 3BEWA 5TJWK 3UTSE 1NLBL 1I7RA 4MAYC 3LN5B 3UTZA 3F7PC 3X14B 5IQ7L 2ZJSL 2B1HH 2BDNH 1TITA 3LB6D 4ZS6C 3GMLB 3P4LA 1FGVH 1NCBH 1SEBB 4P2OA 5DVOA 2OS7A 4NNYA 5CEYB 3GNMH 2YA2A 2IALB 4MJ2A 2F58H 4YXHH 1UADC 2X09A 3ULUC 2BP3A 1CT8B 8CGTA 4BSVA 4LDLB 5I1DB 5I1KH 3FCTB 1T66C 4I48A 4RGND 3QQ4B 2OSLB 5B21A 2D0GA 4PJ9C 4MJIA 3LVEA 5BS0B 3VW3H 4F57H 1R0AH 4GRLB 5TE6L 3BKCL 1EO5A 4JZJA 4XPGH 4ZAKC 4OZ4A 2FJHB 4BQ6A 1S78D 4WU5A 5DMJB 4NBYB 1V8HA 4NN6C 1CVRA 1N7MH 2B8OT 3IDXH 3MNVA 3WD5H 1RK1B 1QRND 1AIFB 3GKWH 3TF7C 1MI5A 4KJYA 3C5JB 5ID0A 4YBHA 1Z5LA 1WF5A 2VAAB 5D1QC 3KPSE 4IRZH 3QDHA 2EEDA 1KPVB 2GK0B 4QRPD 4WWKB 5A2LH 3WBDA 2QKIB 1OTSD 3LS5L 1CFTB 3D3VD 2CGRH 4MA8L 3U0WH 2CMRL 4RIRA 5FGSA 3T3MF 4JG1H 3MJGX 3OTTA 4ORZC 3I3BA 2NY0C 3L5JA 4Y4KD 4P5KB 1KB5A 3HHRB 4NKMB 2BVQA 4D9RE 4NQSA 4KJWC 4EUPH 3UPCA 4GQ9L 1YEJL 5INCB 4JDTH 3C8HA 2B2XH 3QUXC 2QSCH 3E2HC 3SJVE 3IKCB 2BNUB 4Z76B 3D6GA 3QXVA 2H9GB 3MBEC 3MNZB 3K2UL 1VADB 2WV3A 3F5WB 4GW1B 4Y1AD 5L6YL 3S5LG 2P24B 4NQVB 4RA3A 3ARGC 1QBBA 4PRHE 4Y89A 3MC0A 1MNUH 2RAMA 5DJZB 4GXVL 3IU3A 4NQXB 1S9WB 3O4OB 4YE4L 3RKPA 5IMOB 4EOWH 5GGTA 3RGVC 3NGBB 3HE6D 3IJYA 2DBLL 4JQXA 4YHML 3TBVB 1KNOA 3RNKA 5C0EA 4IRSA 2DQGH 4H26B 5ACLA 5D7SH 1P4IH 3FQUB 4Z0BL 35C8H 1I1AB 1WBXA 2VXSH 4CJ1A 2DQHH 4M93B 4F7EB 3O6KL 4JKKA 1G9NL 3ZT7A 3B3IB 2BY2A 4MHHI 3OXSB 4U6XB 4YK4B 1G0XA 2I07A 1HQRB 3U0PA 1UWEL 3ZT6A 4OI9A 3LQZA 5F7EL 1MRFL 3D48R 5I6XC 2RCSL 1LP9A 3NPSB 4XPHH 4QTHA 3CFDA 1CVSC 3EZ8A 3DUUB 1FVDA 5KS9F 4U4BA 4GS7C 1P7KA 5GS2D 3W9EB 1BBDL 1U8QB 2FYYA 1N0LA 2EH8H 1F3JA 5I18H 4JAMB 4XVTL 4HT1L 4JY6B 2BY1A 2XN9E 2C1PB 3C5SA 3UC0H 1AGDA 1MHHA 5DD1L 5J1AB 4ODUB 2NXYC 3CCHA 1IKNC 3ARQA 2HVKB 1NDMA 5HYFA 3OZ9L 3KXFE 3QG6A 1IM9D 1CG9A 1UH2A 3BMVA 3VFNB 4ONHB 1EHXA 1AQDB 1K6QH 2FEEI 4IOIB 4U3XA 1VFBA 4JZOA 1YN6B 4HCRA 2NNAA 4URTB 4FFVD 3VFVB 4PJXF 4MCYA 2H45A 4KDTC 1ZHBB 1CXKA 1NFDF 2XYCA 2RGSA 5CEZE 3WUZA 4NZJA 1JK8B 1OSZB 3K8LA 2XNAB 1VEMA 4EIZC 1N4XH 1PLGL 3C60C 4PRBB 3EDJA 2F54A 3CFKB 4HIJA 4E41D 2BHZA 1IRAY 1UB5B 4M7JH 2E9IA 1QRKA 4J4PC 3FRPG 2OZ4H 1RZGB 5HI3C 1T7XA 2VKWA 4XVJH 5ADOL 2P43B 3IAQA 5F7LB 4LGPB 5A43C 1L9NA 4PJ7E 1NMBL 4M1GL 5FHBH 1NBVH 5GZND 2VSDA 2XTJD 3D1MC 1EHAA 1A7PL 4X4XA 1HXYB 5JW4N 5D7JD 1QRNE 4Z7UF 3MRJB 3VD5A 5HHMD 3KJ4B 4ZDHA 5ESAA 1T20A 1MJUL 4U7SA 2BNQB 3OG4B 4QRPE 2R1YA 5KVGL 2VR5A 4WI7A 5CJOL 5CBAB 3D3VE 3VDBA 3GMPA 5EUOA 1IT9L 1UCBL 4WY7L 1J18A 3LHPL 5HHOD 3JTSB 3KJ6L 1I1YB 3QNYA 3FFCD 1IGJA 1HN1A 4OTXH 1EEUA 2HVJB 3CSPA 3OKOA 2HTKD 3EJYC 5C0NC 5JQ6H 3P9LA 3NCCB 1IILE 5A3IC 1IC1A 4NDMB 3V6FB 3F7RA 1Z6JT 1JMZA 4Q9BA 5DJ6A 5LGKA 5K9QI 1DBAL 3RVWC 2H41A 4O00A 3WFEH 2OJZL 4MJ5B 4FQXA 2XZAH 5BOPA 1CDYA 3ARFC 1KTLA 3LH2H 3Q3GB 3H42L 2CLRB 1JNHB 5I9QC 5JLZB 4DKFL 1WZLA 1YYML 3VE0A 4OSUL 3CSBA 5IMKA 5A2FA 3EIFA 2FO1A 4NWUH 5I2IA 3IAGC 1IGCL 4JFED 1RIHH 1AD0B 4XX1E 3RWJA 4BZ1L 4ZUVB 2E3VA 4MNGA 2X4SA 1NCCL 1FFNB 1PAMA 4CN1A 2Z92B 3PABA 1ZSDB 4I18B 4GW4B 4XP9H 3VWJB 2PYED 5FKAB 2IQAA 4K55A 4OV5A 3FRPA 2BXZA 2OP4H 3DGGB 3FO0L 4G8EB 1N6QL 2Z8WC 5I74C 3ULVL 1X7QB 5E24E 2X4UB 2JJTC 2I5YH 4B7LA 5TF1H 1BD2B 3OHXB 3ZKNC 4FN0A 5D6DC 5IWLC 4GMTL 1A9BA 1SJEA 1VKXA 1DUZA 3DUSA 3EOBA 4D0DA 3BSZH 3B8SA 3WN5A 5T5NF 3SKOA 2P8PB 2V9RA 2HAZA 1HHGB 4LF3B 2VZ3A 3F58L 4HX1B 4TUKH 3TIEB 1AO7A 5I1EL 2BVUA 3VXQB 2VXTH 2W9DH 4WWKD 1TZIB 3SEPA 3VMNA 4Q97A 1C5CL 1Q9KB 5DEZA 5J7CC 3W5MA 5IHLB 1G84A 3C87A 2HA1A 3OAZH 1P2CB 5KG9A 2FJFB 3B9KA 4L29A 4F8QA 3HUJE 1AHWB 4JFXB 1T7ZA 1QFHA 4NUGH 2XICA 4J6RL 1P4LB 3PWLA 5CGYD 2DLEA 3QZWG 1S9YB 2XY1A 3TV3H 5HYSB 3MRDB 4N1CA 3GKZA 3MGTA 1YJDH 3O11B 1NBYA 4Q6IB 4RFNC 1MHCB 3OXRB 3CFEB 5KANG 4UNVA 4KKBD 3HFML 8FABA 4FP8L 4QXTB 4E41E 5E8DL 2ORBH 1YNTA 3C2SA 3FT3A 5I8OH 4H5SB 1NANH 1TIUA 3ISWA 1GGUA 1Q9WB 4G6KL 4CMMA 1YEGL 3W39B 4K2UL 2VERN 3TJHD 1GOGA 1N59B 3PP3H 3RBSA 1M71A 4X7EC 1N6VA 2P8LB 1G6RH 4GLRH 2O5ZH 2K3TA 4C57C 3BD5A 3EO9H 3I02B 4KK5D 2XPGA 2YRZA 3VGEA 5LGHL 5T3ZL 2W0FA 2NTFB 3LS4H 4MDIA 5I1LA 4MS8C 5IR1B 5F7DA 1Y6KR 1HHIA 5HHME 3X3GH 2XFXA 4I77H 1L7TH 4HJJH 3QUMH 2AXGA 1HINL 5FYLL 3TBYA 2YSSB 4XNXH 4WHTA 1ORQA 4JRXA 4LSUL 4JFOA 5IJVA 3ROOA 3V4VH 5EU6B 4ZTOL 1T1YA 2BY3A 4KPHH 4U1JA 5GS0H 5DHYA 3EW3B 3UO1H 1LNUB 5D71H 5HHOE 3T77A 4AZ8A 4NQED 3BYTA 5KSVA 5IEHB 5HGAA 5GJTL 4YJZL 1V7ML 3WO4C 2JIXB 3MJ9H 4KJPD 2V5RA 3RQ3A 4LAQH 5EBWA 2E7LC 3QYCA 1LO0L 4FG6C 4BA8A 3IXTA 5J3HD 3WE6A 4FTVB 4OCLC 4BM7A 2IH1A 4FQCL 1E0OB 5SX5K 5IVZB 1QSZA 1QSFA 3NH7L 3WKML 3QWRA 5J0BA 4JQIH 1X6LA 4WHYG 2BSSB 5C8JB 1OAXH 2PO6B 2WSKA 4JM4L 4ZFFA 1EEQA 4OGYL 3QZWA 5T1MB 2NR6D 1ORSA 3M17A 3PHOA 4KZEH 2EXYD 5GHWH 1JV5A 3CFCL 2AVGA 4JHZA 4YDLC 4QOKA 4KTEH 4L8DB 4N5UA 1CQYA 5F93C 4OZFB 5BVPH 2H6PB 2PYEE 1OWWA 2EEBA 3OKDB 2VH5H 2DS4A 3GK8L 2HT2D 3S34L 4PP2A 2Z31D 1CFSA 3FB8B 5BS0E 4DZ8A 2JELH 2HN7B 1I8MA 2C9AA 2AK4B 2PTTB 2IWGA 4O2EB 1DQML 3TBTB 3KYKL 4PJEB 1QSEA 4WV1A 1YEFL 1CL7H 4PRNB 3VXRA 1PBYA 4YDKH 2ZUTA 5TDOA 4YDVA 5L8LB 5FA4A 5J13B 2UWEF 3F8UB 1OTTD 3UZQA 4M1DH 4HQQL 4ZPVB 1OAYH 2YPVL 5KSAC 3IDIA 2BNQD 4ZO6A 5IHZB 4G3YL 2X70B 4FXGB 4UQ2A 4WO4C 5CKAA 3C5ZA 3BJ91 3MCLH 2CO6B 2P4AB 3BI9X 1CICC 3HZVB 3STZB 3CXDL 1T03L 4K94L 5EN2B 5C08A 3LZFL 4UMGA 2SEBB 3K46A 2IG2H 3GM0A 1Y18B 5L9DL 2XZQH 2CRIA 1ZAGA 4QY8A 1SVZA 1HK6A 3QULB 4W6WB 5GZOD 3DSFH 4ISVA 1FAIL 5E7BA 4ZD3L 1Q72H 1A6PA 2DF3A 2EDXA 4UQ3B 4BQCA 1KIQB 5L2KA 3G6JF 5FM5M 5E2UH 4HUMB 2WK2A 1RQ5A 2VDKH 4JQVA 3E6HA 3KPQA 5JO5A 4OLZH 2DKUA 3GI9L 3SHSA 1YEKL 3FAXA 4M1CC 4QXUL 4PRIB 5FIEA 1JNNH 5IB5A 1KF9B 1LO3L 2YEZA 1GZQA 1F3RB 4HWEH 5L88L 4EN3D 5IIEA 1QA9A 3PIQA 4RFEB 4I0KA 1HOCA 2CIIA 4K23L 4LPWA 4JO1L 1FFQA 4DAGH 4PJDA 2GJJA 4LRNL 3MRRB 1OM3L 2DQEL 3TP4A 1GPOH 3RVUC 2IBGA 1A6WH 1A6VH 1FGNL 2Q6WB 1XT5A 4PTUA 2XXCB 1BD2D 3FN3A 4F9PA 1ZGLA 4DGIL 4CW1A 1JYWA 1MCPL 3PWJB 5D5MA 4M8QA 3FL7A 2Q3AA 4LSSL 4YFDB 5FM4A 4AIZA 4NQEE 1I9JH 4ELKA 5F9WB 1YEIL 1EUTA 3G6AA 3IU4L 1JP5A 3HI1B 4NO0D 4MA7L 2ADIA 4XBGA 3LKPA 1MRCH 3W81A 4C56D 1KB9K 4G9DB 1PYWB 3P11L 3IDNA 4JM2F 4OFYA 2D0HA 2ZCLL 4H8WH 1MF2H 1RIVH 2ADFL 1EAPB 2F5BL 4UILH 3O9WC 4KDVA 5CS7A 1X5XA 4ZXBD 3MXVL 4R4ND 1PG7X 3A6BH 3IB4A 4YHNA 4JLRA 4LASH 1TETH 3MNWA 5DMIL 1Z9LA 3QXTA 3VG9B 1DN0A 1RD6A 1UACH 4GKZB 2EH7H 1JPSH 4M7LT 4CU8A 1WVZA 1YJDC 4JO4H 4MNQA 2IQ9L 1LGVA 1U3HD 4FZEH 5T5FL 1TJIH 3KG5A 3Q5TA 4F7MA 5LBSL 3TWCL 5DVNA 1IL1B 4HKXB 3RAJL 3UYOD 4XCNB 4H20H 3CX5K 4MAUH 4A6YL 2VDML 1UENA 4N0UA 3HZMA 1S9KC 4X80L 1ETZA 5TDPA 5D8JH 2FBJL 3MOBL 1JE6A 2Y6SD 3O4LA 3RDTC 4M8VA 5EPMA 1ZHKB 4LSPH 1GRWA 1UCTA 4Q0XL 4UBDD 2GAZB 2LU3A 3L3KB 1S8DA 3OAYK 5LGJA 5KVMC 4PJ8B 4OI8A 4EDXB 2CK2A 5BZWB 5CSZA 2YXMA 2BNQE 3VRJB 2BC4B 1SM3L 3VFSB 5EU6D 1NGZB 2W91A 2XQYG 2EDQA 2Y5EA 1L0XA 2YS4A 1QPXA 3THMH 1RU9L 3MODH 3MJ7B 4F15C 2X4OB 2Q8AL 4UIKH 4Z7VE 1H9VA 2MNUA 1VFMA 4BQ9A 2C4XA 1MOEA 5TPWL 2NY3B 5CEZL 3MV8B 2OL3H 4ZOEA 3TZVC 2E9WA 1RZKL 1Y6NR 1BP3B 2F15A 2XKUA 3LKNA 2Z91B 3BIAX 5DMKB 1UYWH 4PJFA 1HH6B 2A6DA 3HCVA 3MRCB 4X7SH 3RUGB 3DSNA 1F4WH 4OIAA 1QR1B 3W11D 3UTSA 5CIPB 3G08B 2C1OA 5D9SA 5AZEL 1D5MA 1S7SA 1UH4A 4XHQA 1AH1A 4P46A 5E0QA 4XBPB 4CU6A 2Y1VA 1FYTB 1ZWIA 3DO3A 3VXTA 3TNNA 1JPGB 3CH8A 5JR1L 1MCBA 2A9NH 4P9HL 2B20A 4LEXL 5E95B 1WZ1H 5IW3A 1BD2E 3O3DB 3PL6C 1LK2A 1KLGB 2EDYA 3FKUS 4TSCL 1GL4B 3IAPA 1L7IH 1K5NB 5HDLA 1T0PB 5I76A 1T7WA 5ADPL 4HK0B 2ICWJ 3RZCB 2FEEL 2HRPH 5E1AA 4NFDA 4HV8A 2KZWA 3IDJA 4E0RA 5DURB 4RWYH 3DRQA 2DDQL 4BK4A 5E8EB 5F3BB 4X0KB 4O5LL 1MJJB 1G7HA 1J11A 2EXWD 3JVGC 3OJDB 1K8DB 1GJIA 5C0CD 3M1BB 5HSFA 5FCSH 4WW2B 2EYRB 3OJVC 3KPSA 4EVNB 1CF8H 3I85A 4FS0A 4ODHL 5E8NA 1KB5H 1XGYH 4K3GA 3N1QC 5DYOA 5GJSH 3CMOL 3FQWA 1G9EA 3WNOA 5T1KA 3BKYL 2CLVB 1MCFA 2RFXB 4HBCL 4L8SB 5L2JB 2G5BA 3CVHH 4J3SA 3D85D 5F7NC 3B83A 4ZFZB 1LHZA 4AEFA 4G8GB 2O61A 5GSVA 1VA9A 2OMBA 1MJ7L 5JDJA 5I1GH 4OLUH 1I7ZA 3L3HA 3T2NL 4BYHA 2GITB 4UV4L 3SJVA 2QHRL 3BP7B 1Q0YH 1BVLA 5AYUH 4POYA 4APQC 1I4FB 1HWGB 2AI0L 4LIQH 4PRID 1KXTB 1ZHLB 5MHSE 3OKLB 4YHYC 4KQ4L 5GGTH 3SDXF 2A83B 4PRHA 5F1SA 1XF3A 5GGSY 3DXAB 4KK6C 3S8WA 1VB9A 5DJAA 2RB8A 1DQLL 1IARB 4KI1A 4LDEB 4PV9A 4YDJB 3KLAA 4Y4FD 4GRMB 3ZDYE 5KW9H 2VLKB 4MHHG 4DQOH 3AVEA 4LU5H 2DKSA 5T33H 4LCCA 1IE5A 2FX8L 4JANA 3T3PF 4FQQA 4FQJL 1KFAH 5HHPA 3QXDB 4WGVB 4XAWL 3EYQD 5EU6E 2DI9A 3RY6C 3OKKA 3AFLA 4KROD 4HF5L 4JFYB 4Y5XA 1YEDB 5BV7B 3H3BC 3UPRB 3N06B 1RMFH 1T04B 4R96A 3GBMH 4A6YA 4C55A 5E56A 1AGFA 1EVTC 3GHBL 2LTQB 2DLHA 4JREC 5INDB 4J1UA 4XCEB 3BEVA 3HPJB 4J3WA 3QAZB 4YZFF 5E99H 4S1RL 2OJEA 2LU4A 4YHPA 1LE5A 1I8IB 5DZLA 3SDDC 3QIUA 3DYMA 2FIKB 3I6KB 4FTVE 2IFFH 5HJ3A 1OHQA 1MH5A 4XXCC 1IGIL 5CCKL 2XIDA 3VGAC 2LVCA 4X6FB 2XN9A 1IKFL 4HCRH 2P5WB 1CDHA 2NY1B 5EO0B 3DTXA 3KXFA 3O41A 4EZMA 2LU7A 2IADA 1HQ4B 4EBQH 2R56H 1UM5L 4U1IA 1ZLWK 2R0WL 1NDGB 1F3DJ 3P3YA 3QPQD 3S3SA 1A6AA 1YNKH 4OKDA 4XB7A 1I7UB 3GSRB 3SO5A 3X13A 4CKVX 3DMMC 5CZKA 3OKEA 4F80A 43CAB 4XX1G 1EVUA 2DMBA 3IF1B 4LEOB 2PN5A 5EU7E 5IKCB 2CDEB 15C8H 2YKLH 5IP4A 1BBJB 2HYMA 5K93A 1WK0A 4AEHH 1NLBH 4F9LA 3IYLW 5EU4B 3MV9D 1NCDL 4XCYB 1KLUA 4P5TB 3TGXA 2Z4QB 4PJEE 4X5XB 1RVFL 5IQ7H 2ZJSH 1GC1L 4PJ7A 1ZT1A 3PXJA 4PJ8D 4OQTL 4XGZB 4UT6L 3D0LA 1MJ8L 4Z7OE 3ESVF 5FGBC 4LVHB 5MEPB 2A6KB 4HIEB 3RX5A 1CTOA 4X6EA 1DJSA 1BX2A 3ZDZF 3KS0H 3EYFA 2GJ6B 5B8CB 1QRNA 3PWPB 3BMWA 5AUMB 4GBXD 1QKZL 3QUZC 4M9OA 4JJ5B 4JDVB 1UJTA 4TYUA 3WDHA 3IDGB 1AP2B 1HIMH 4QYOA 1PEWA 2XWBB 5EOCL 3ZYJA 4QRPA 3MFFB 4PLJD 2HJFB 3RWHA 4NT6B 1ED3B 3D3VA 3BKCH 4ZPTB 1ZOXA 4B50A 5DMGD 3VD4A 1BGXH 2NXZC 3OBAA 3DX7A 1MCKA 4Y4KA 5K9QG 4UI2A 2P48B 4M4PA 4QRRD 4G80A 3RX8A 3MV8D 4H0IA 4AG4L 4WU7A 2R4RL 4DFIA 5HHQA 3ARBB 5KJRL 1NBQA 4H25A 1FSKC 3R8QA 4QRSB 4GAYA 4JJHA 4M6OL 3OB0K 1R3JA 4PD4J 3LS5H 4PRIE 2R2BA 4MA8H 2CMRH 1U95B 2DQCL 1QFPA 2JKXA 5EH1A 3TESA 1MLCA 3VXOA 3DYOA 3QIWB 1XZ0A 3SDAB 3BGMA 3LD8C 3TEUA 1YEJH 1DBMH 3WEXB 3HE6A 4U3CA 1K4DA 2YD2A 4YBQD 1RJLB 3DBXB 1OCWH 3K2UH 4I0PB 5L6YH 3EGSB 4X7CC 3B2UC 3MTRA 3QWQB 4U6HA 1MUJB 4O2CB 4WI9A 3QJFB 1A1OA 4GXVH 1DQDL 1AI1L 3GSXB 1N6UA 3PP4H 4JZJC 3NCJL 4WGWB 1EHLL 4YE4H 3D18A 1YY8B 2DBLH 1ZHNB 4YHMH 3W0WD 2ZPKL 3WFHB 5DURD 1XGPA 2BSRA 5FF6B 4K7PY 2CIKA 1NGYA 4TUOB 3NFPB 3O6KH 1G9NH 1AXSB 3QFDA 1SJVA 1WZKA 4I3SL 5E4EB 2DQIL 3Q5OA 4F7TB 1M7DB 1UWEH 5F7EH 1GOHA 1MRFH 2RCSH 1A3LL 1XR8B 1WIPA 2VISA 1GYAA 3E6FA 4BH8B 3HUJA 2HG5B 3NMEA 2K7PA 5GXBB 1BBDH 1GGTA 2CXGA 5K9OA 5I75C 1MFBL 3S35X 5CEXA 1UWGL 3HR5B 4G8GD 2YRPA 4XVTH 3QIBB 4HT1H 3T0VA 2Z8VC 5T3XD 3TBWA 5DD1H 1CFNA 2CUMA 2ESVB 2K7QA 3FO9A 2X9WA 5D7LD 1PGRB 3OZ9H 4HIXL 1TQBB 1OPGH 1E4XI 3QEGL 4E41A 5CHNB 1QBAA 4U1GC 3SKMB 3MV9E 2ZG3A 3ZKXC 5BRZB 4IIQB 5HHNA 4JFFB 5ITFB 5TE4L 4M6ML 3DV6A 3X12B 3LSOA 2VSCA 4JQXC 4IRSC 4NP4L 2VLKD 2CH8A 3GSQA 3CUPB 2OTWA 2F53B 4LPUA 1DEEA 1JHTB 1PLGH 3C9NB 5JORB 5D7JA 1BZ7B 1EFXB 1JN6A 4LRIC 2DTSA 2MJWA 4K8RD 1M7IB 5FYKD 1IAKB 5ADOH 2X7LB 3DRTB 4DGVH 1NMBH 1JYVA 4M1GH 2GJZB 4ESKA 2HLFD 1DSFL 1QLFA 5DGQA 2YD3A 1B0RB 5HHOA 5DSCA 1A7PH 2ZCHL 5E8PB 5JHDD 4Z7NF 4GG8B 4OQTA 4QRRE 4XCFL 4AQ1B 3MV8E 3D2UA 3VFPA 4UNUA 1MJUH 3BZFB 2R23B 1VEPA 5ISZB 2P5WD 5KVGH 3EYOA 5CJOH 3KPOA 3RUGE 1IT9H 1UCBH 1FN4A 2D7TH 3L1OL 3LHPH 4KVNL 1X44A 5L7XL 1NC4B 3KJ6H 4RAUB 2KUTA 1QHPA 3QDJD 1J10A 2VZUA 1NCWL 2J88L 3G5YA 4HFWB 2FH8A 2WANA 1FYTE 2DQJL 4X4YB 2OXHA 4G7VL 3GMLA 1MVFA 4LCYB 1SEBA 1MELA 2W65B 3DETD 2FIRT 5CEYA 2APVA 1FE8L 4GFTB 4IOFC 4Y5VB 4UTAL 2D7NA 5DQJA 1ZEAL 5FUZL 3T09A 2OJZH 3U4AA 1ZMYA 2PYEA 3UTQB 4U1KB 4DKFH 4PG2A 4Y4HC 1YYMH 4PP1C 3QQ4A 2OSLA 4LOUD 1WWBX 5DJXA 5BS0A 3PE9A 4AEIL 1IGCH 2YUZA 4GRLA 4BZ1H 5I1CL 3LQAH 1NCCH 5IMLB 3L9RB 2GJ6D 3OSKA 3CSGA 4M62L 1CI5A 5D2LB 4ZNEA 1RK1A 3UTTB 2QSTA 2DMCA 1K3ZA 5LQBL 1BJMA 3C5JA 3FO0H 1N6QH 1KCSL 1VFAB 2W60B 1DVFC 4LVNC 5I19L 1KPVA 2GK0A 2WWKO 4WWKA 1A22B 2QKIA 4RDQG 1EEZB 4GMTH 1JVKA 4K3DL 3WIHL 4LSRL 3MGAA 4P5KA 4QLRA 4HWUA 4NKMA 1II4E 4OZGE 3QBTB 4YFLI 5KSUA 4WWID 4G8GE 3F58H 1JTPA 5I1EH 5INCA 1NBZB 3S96B 5T3XE 1G6RB 5GS1B 4FQXC 3IKCA 4Z76A 3WLWD 2H9GA 4PV8B 4K3HA 4WHYH 3MNZA 1D6VL 1VADA 3F5WA 4MJ4A 1C5CH 4GW1A 4NZRH 4PG9B 4PREA 1T0MB 2P24A 4NQVA 3V7AE 3QDGB 2DI8A 1WC7B 3V6OC 3QUMB 3DXAE 4PJGE 4NQXA 1S9WA 5IMOA 3SDAD 2VLKE 4XC1L 5IBLD 5IMMB 4V2BA 2XG4A 2VLRB 3JTTB 3QB7C 1CFQB 4LDOB 2R1WB 2J8UB 4H26A 2KDGA 4LARL 3ZTNL 1NAKH 4I0PD 1PKOA 3FQUA 1HI6B 2WW8A 3HFMH 4F7EA 3WFBL 4FP8H 3LKSB 5E8DH 4K3JL 4X9FA 3B3IA 3MRHA 3OXSA 2V5SA 4LQFL 2YK1L 3KHQA 5C09B 4EI5C 1YEGH 4X5WB 4KI5F 1HQRA 1CXEA 1RUQH 2Q7YB 1EDQA 1IGTB 3H6JA 2EDEA 1S9XB 1D5XB 3WN5C 3FB5B 5CJ5A 2LV4A 2J2ZA 4NQEA 3DUUA 2FBOJ 3PQYB 2E27L 3GMOB 2GW5A 2NY4C 1U8QA 4P4RA 5T3ZH 4OLXH 4M48L 5DVLA 5D1ZB 1C7SA 2WQRA 4JY6A 2VE6B 2C1PA 4DKEL 4OF0A 5J1AA 3O8XD 4LSUH 2P5WE 3BJLA 2HVKA 2LQRA 4ZTOH 2MCG1 1WFUA 4LCWB 3TPUB 4KRNA 4ONHA 4HUVB 1AQDA 4M43L 2HMIC 2ILLA 4NO3B 3M8OL 4IOIA 1OP3K 5E6YA 1N5YL 3QDJE 1YN6A 2Y5TA 3PHSA 5GJTH 5IFAL 2GY5A 1KTDB 2HH0L 3JWNC 1V7MH 3VFVA 4Z0XB 5DQ9B 3EFFA 1LO0H 1D5BB 2W92A 1ZHBA 1RK0B 1WICA 1EMTH 5GGVY 1BFVH 2ESVD 1JK8A 3PGCB 2XNAA 4FQCH 3RI5K 4C54A 4PRBA 3ABZA 3GSVB 3CFKA 1JFQL 1UB5A 3E8UL 3ZE2E 3NH7H 5BRZD 2QQKL 3WKMH 5ANMB 1RZGA 2YMXL 1YY9C 5D7IF 4PJ5D 1E4WH 2Z31A 3CXHJ 4JM4H 4S0SD 4OGYH 1Y0LB 3HZYA 3P9MA 1NGXB 1IAOA 2HP4A 5IB4A 4J23A 2F53D 1JGDB 3GRWA 3OKYA 5IG7A 1B4JL 1NAML 3CFCH 1RZIB 4O51B 4OCYL 5SWQA 5E1HB 2F8XC 1XCTA 3ZYOA 1BVKB 2EZ0C 3REWB 3KPMB 3NIGE 5JOEA 2GJ6E 2ERJB 3STBA 4KJQC 5JXED 1EFXD 3CDGA 3PWPE 4LK4A 5I8EB 1HNGA 4OV6F 3GK8H 5DRNB 3S34H 2X44D 1T2JA 5EO1B 2AEPH 2IFGA 2BNQA 3UX9B 4J2XA 1FNHA 1C8PA 3V4UL 3VI3E 1RFDL 4MA3A 1MLBA 1IGML 1U42A 3LIZL 1DQMH 3JTSA 1AXIB 3KYKH 5GS3A 25C8L 1I1YA 1AD9B 2XOTA 1YEFH 2NZ9D 1RIUL 1MCJA 5I73C 4YNYB 4Z7VA 4YWGL 5JXAL 2X2YA 1I7TB 4HQQH 2YPVH 5HYSG 4U1MB 1SJHA 3M45A 3V6FA 1R24B 4G3YH 3GGWB 4S1QL 4Z77B 5KZCB 3FZUD 4I3GA 1W2KT 2Z35B 3CXDH 3NA9L 1Q38A 3ILQD 4K94H 1T03H 1LMKA 3WDJA 2CLRA 1A14L 5JLZA 5SWSB 2XACC 3IJHA 4KUCD 1H3XA 3T2PA 5MERB 4HUUB 3WIHA 4ELME 3BWAB 1AD0A 1FAIH 2VLME 1TZHB 4EN3A 1JTTA 3CJJA 1N0XH 1X5FA 1UWXK 3BT2L 1F2QA 1EAJA 3JSSA 1QFWM 1FFNA 4UV7L 4JKPL 2CUIA 4GXUM 4OCMC 2Z92A 5DTFB 4LQ1A 3D39B 1ZSDA 4I18A 4LLDB 4GW4A 1QFWI 3VWJA 3V6BR 3ZE1F 5B3NA 1MFCH 1CD0A 3DGGA 5IB1A 1MCNA 3GI9H 4QXUH 3TCLB 2X4UA 1FL3B 5DRXB 3RVVC 1OP9A 1BD2A 3OHXA 5CLTA 4WV1C 3G9AB 1LO3H 4J12A 1QPPA 1INEL 4OD3H 5L88H 2DLIA 3D9AL 1ZLUK 1U93A 3P4OB 1X5HA 4ZO7A 4JFHE 4K23H 1T80A 4JO1H 5ILTH 3U79A 4EIGB 1LD9B 3HE7B 1C08A 1KOAA 2P8PA 4KTYA 4NO0A 1OM3H 1OQOA 2JB6B 1CDUA 5EORH 1QACA 3O6ML 2COQA 1FGNH 2YD9A 4C56A 3VXQA 3ULVC 1SYSB 2DM2A 3VFWA 1MCPH 4H1LG 4KXZH 3WFCL 1NC2B 1Q9KA 4Z95L 5L0QB 4P3DB 4LSSH 4TUJB 2VZVA 3V95A 1P2CA 4YLQT 1NEUA 12E8H 5JIPA 2XKNB 4XP1L 4ZXBA 1SVCP 1AHWA 4NZTL 4JFXA 3IU4H 4PRPD 5DUML 4MA7H 1AGCB 1FG2B 1S9YA 5F6HI 5HYSA 4UOJA 3MRDA 3ECBB 2ESVE 3P11H 1U0QA 3EUUA 1O0VA 1MHCA 3OXRA 3CFEA 4LPVA 4KMQA 1DP0A 2ZCLH 3QT2A 1U3HA 1T21B 5LVEA 2VLJB 3BQUB 5L8JB 2ADFH 5CBEB 4H5SA 5BRZE 2F5BH 3CU7A 4JFFE 3MZTA 3H9ZA 3MXVH 4HW6A 1Q9WA 4JRYD 3ZTJG 2VDRL 5DLML 3KDMB 5BQ7A 5DMIH 3HZKB 5LG1A 3D87B 1ZA3A 1N59A 3T1WA 3U9PL 5ICXA 5E08L 5IF0B 2F53E 3N9GL 5KSBB 3RVTC 5HYIA 2P8LA 4EDWL 2BVTA 3ARDB 2IQ9H 3I02A 4G8FB 3VXUB 1NGWB 1D9KB 3V8OA 4JGMA 4MQXC 2R69L 4N0YL 2NTFA 4F9PC 5IR1A 5LBSH 3TWCH 1UZ6E 3CLEL 2UY6A 5C09D 3RAJH 3F7VB 4JFZL 4GKNB 3SDYH 2YSSA 4O9HH 4P59L 4A6YH 4UOW1 2VDMH 4GJTB 5EU6A 4X80H 2OL3B 2FBJH 2EO9A 3MOBH 3QDAA 3EJZD 1LNUA 3VRLF 3U4BL 1T5WA 5IEHA 3LN9A 4Q0XH 1FORL 3RZWA 3VXSD 5I30L 4K71B 5D1ZD 3ULUF 1BHGA 2FH6A 1AGBA 1NAMA 4OFVA 4P2OB 2X40A 3G04B 4KRPC 4LNVA 4OIIL 3VDCA 4IMKA 2R29L 1SM3H 2EC8A 4H1LA 5EIQA 1M6OA 3CLFH 3BN3B 3IDMB 5IVZA 4BELD 2RIKA 3VD7A 1E6OL 1RU9H 3FFDA 4I48B 2NCMA 5HVFB 5C8JA 2BSSA 4IRJB 3LOWA 2PO6A 4MJIB 2Q8AH 1U9KA 5T1MA 1VESA 4ZUUB 3OJ2C 4LPTA 2BX5A 2R0ZL 1GGCL 4HH9A 4F8TA 2FZ3B 2PKDA 5DDHB 4KGJA 3L3JA 5TPWH 1L0YA 1Z3GL 2NY6D 1ZANL 4Q9QL 1MCQA 3NIDF 3MA7A 1J0KA 3TN0D 3TCXA 3AXLA 2HT3D 2H6PA 3F7QA 5ID0B 4NBZB 3OKDA 1Z5LB 1RZKH 1OP5H 3KGRA 4BKLA 1FNFA 3BN9D 3N85L 1FBIL 1ZGLP 3QXUA 3FB8A 1JNJA 2HN7A 5AZEH 2XQBL 4KH2A 4MMZC 4P23C 1TCMA 3MRIB 3PHQB 4HWZB 4O2EA 3DURB 4LSVL 3TBTA 1CZ8L 4PJEA 4X6DB 1KB5B 4GAFB 5GSRB 2AXHA 1RZJC 4MXQD 3TVMD 1CD9B 5D2LE 3UTTE 4ONGL 1NSNL 5C0BB 5JR1H 4JHWL 4XNYL 2EE2A 5JZ7C 4P9HH 3GDBA 2X9YA 1I8LA 1IC5L 1IQWL 5D93B 4ZPVA 1K8IB 3CVHB 3EDKA 4LEXH 1ZLVH 3QNXB 3ARVA 4YHOL 2X70A 4FXGA 4HUNB 4TSCH 4LGRB 4MXVF 5C0CA 2Q3ZA 1MAKA 3HZVA 3STZA 3Q6GH 4L4TB 4CL7A 4OZHB 2SEBA 3TPKA 1ZV5A 5ADPH 1F4HA 1E4XL 1FDLL 4X6CF 1RUPL 4X7TB 3QULA 3BPOC 4NN7B 4HHAB 2I9LB 2A2QT 2DDQH 1WTLA 2JCCB 4O5LH 4J7RA 4UQ3A 1LEKB 1KIQA 1SQ2N 1FZOA 1IFHL 4NCC1 3NVQA 4O2FB 3QDGE 3VGDA 4XNMA 3OF6D 2B5IC 1R5IB 4K94C 1Q1JL 4ODHH 5FOBB 1CDGA 4JRYE 3CMOH 4P46C 3LQZB 4PRIA 4NRYB 2ATKA 4F37K 4Q7DA 1VFUA 4GOSA 3BKYH 4WFGE 1OAQL 4HBCH 2VLRE 3PF2A 3QSKB 4V1DB 2VQUA 3UDWC 4MSWB 2J8UE 1FVDB 3U83A 3BP4A 4DKAA 4MCZB 1J0ZA 4S1DC 1P7KB 2C7UA 4Y4FA 4KKLD 3RTQD 1IGFL 3MLPA 1NJ9B 3T2NH 1KJ2H 4UV4H 4P2RD 2QHRH 5EZIH 5C09E 2APFA 4NRXB 2Q6WA 3CCHB 4YX2L 2AI0H 1NDMB 4Q2ZB 1YMMD 3QG6B 1CG9B 3PWJA 3T0EC 2G60L 4YH6A 4ODTL 2ZUUA 5C2UB 1BFSA 4OCSL 4Z7WE 2NNAB 1CD8A 1DQLH 1ZS8B 3VXSE 5GS2H 3HE7D 3QI9C 4MCYB 3HI1A 4HUWB 1YECL 3MR9B 1I3GL 4RAHA 4TNWF 2FX8H 5T3XL 4FQJH 4G9DA 3U30C 4KK8C 4LVOC 1KYOJ 3S5LB 2BERA 2F54B 2WBWB 4LCWE 1J0HA 5DUBA 4PY8I 4HF5H 4M61A 5MP6L 2ZNWA 2YRLA 1EAPA 2Z9TA 3CU1A 3GO1H 1MCCA 3VWKD 1G7QB 3GHBH 1WBZB 4OCWH 2JE8A 2EEAA 4P0DA 1NGQL 3BH8A 2ZUYA 3EDEA 3NCEB 2GFBB 4GSDL 5HVHC 4QHKI 3VMOA 2I60H 1BQHG 4XBEL 5J1TC 1H3UA 4XTRD 4ODWB 3O6LL 4X4XB 4CU7A 1IGIH 4FRWA 5ITBL 5H35B 5CCKH 1BECA 2VLJD 4Y16B 4JY5L 5I1IL 1IKFH 4FA8A 4KKCC 3L7EB 1B6DA 1IL1A 4K8RL 3C08H 5BV7L 2DICA 1CN4A 4NC1E 4FFWD 1RHHA 3MV9A 2R0WH 4L9LA 1UM6L 4L1DA 1L4IA 4LCUB 5BXFB 1EO7A 1ZHKA 4LCCC 4X99B 1IGJB 2UZXB 5I1HL 4WFHD 4HC1H 1FAKT 2GAZA 2QTEA 1U8PB 5EG6C 9CGTA 3O2DH 4PJ8A 1FGVL 3CNKA 4MZ3A 4QXGL 1REIA 4NJAL 2P8MB 1YPZB 2BC4A 3VFSA 3DX8A 4YXHL 1NGZA 5FYJD 1NCDH 2D9QB 4GBXA 3PV6A 2F8OA 1KTLB 1PY9A 3NAAL 5DD0L 1ZTXL 3DO7B 4YIQA 3UYPA 1HKLL 5A16A 3QIUC 4OQTH 1NUDA 4UT6H 1MJ8H 4F57L 2VDPL 1HSBB 3BDYL 4MZ2A 2HTLD 3LDBB 3BHBB 3C60B 4R9HA 3QHZL 2EDFA 4KV5E 5J1SC 4QRRA 3MV8A 4HZLB 1QKZH 3WD5L 2IQAB 3GKWL 3V0WH 4OV5B 5F7WC 2UUDK 5EOCH 1RJYB 4F7CB 4JY4B 2Z91A 5DMKA 3UAJC 4YAQB 4FQIL 4IRJD 3MRCA 5I1JH 2PW1B 3RUGA 2EYTA 3G08A 3V0VB 2E9BA 1VKXB 4XP6H 1DUZB 4D0DB 3NCFB 1BQHA 4XBPA 4S0TD 4JHAL 3OL2A 1FYTA 4AG4H 4RMTA 3SKOB 3KVQA 4XI5D 1J0YA 1KIRA 2R4RH 5DI8B 1HSAA 5KJRH 1OL0A 4AY0A 2N7BA 2H2SD 2B2XL 1RZKC 2APXA 4M6OH 4QHNA 1DL7L 3O3DA 1FHGA 3IFOB 2A0LD 4GRWF 1KLGA 2DQCH 3P4NA 4WEBL 1V05A 4MNHB 1L0QA 4M4RA 2H2PD 3GMMB 3RA7L 4PJAB 1IVLA 3B9KB 4L29B 4HK0A 3PWLB 4LKCB 3OKMB 3UYRL 3CAFA 2EKJA 4YGVB 3ZLQC 1NBYB 3AS0A 5JQHC 5F3BA 5E8EA 2GUOB 3OJDA 4NUJB 2DQHL 8FABB 5D1XB 4MAYD 1YNTB 3M1BA 1DQDH 3DVIA 1LK3L 3UXFA 4WW2A 1AI1H 2EYRA 4WHDA 3RIFF 3NCJH 4EVNA 2BHUA 1JPST 4ZS6D 3QEUB 4Y4KC 1UB6B 1WAAF 1F42A 4GG6F 1CS6A 2CLVA 2ZPKH 2RFXA 2HFGL 4P57B 4L8SA 3O6FB 3MFGB 1TTGA 1I1FB 1XEDA 5C0FA 3ULUD 4OZGA 4TULL 4ZFZA 3CZFB 3BESR 4FNLH 4G8GA 5I1LB 2WAHA 5FM8A 2VLJE 1BF2A 1XF1A 2DQIH 1HHIB 4MJ6A 1JTOA 1WZMA 1ITBB 3BP7A 4PJ9D 5D7LA 4XPTL 4JFOB 5IJVB 1A3LH 3U1SL 1ZHLA 5C0IA 3OKLA 4ZAKD 5DHYB 1XGTB 2A83A 2EDRA 4V1DD 5KSBE 2FB4L 1G7JA 3RWIB 4PJGA 3EOTL 1MFBH 3VXUE 2DLGA 4YDJA 1UWGH 4GRMA 4WFHE 2VLKA 1NEZB 4LNRB 4J3VA 3MRGA 4JVPA 5D1QD 5IVXF 5DD3L 4HIXH 3QXDA 3C6LC 4HXBH 1MPAH 3WIFA 3QEGH 4Z6AT 4Z7QF 5FYJE 2NY0D 4POZD 1QSFB 5TE4H 4M6MH 1YEDA 1MCWM 3UPRA 4KJWD 5IV2A 1T04A 4NP4H 2NY2B 4F37F 2FD6L 3QZWB 4XCEA 2ED7A 3QUXD 3HPJA 1CGTA 1F6FB 3NIFF 2ADGB 5AAMA 4WCYL 5HPOA 3CDCA 3SDCC 1NH6A 2AJVL 2FIKA 3I6KA 3ARGD 3FQXA 3AB0B 5GGVL 4LLAA 3NPZB 4NHCL 2AQ1A 4HSQA 3IVKB 4K7PX 4X7FC 3MXWL 3BGFC 4DOHB 2P5WA 3RGVD 1IAII 2D3VA 4MJIE 1QFWL 3ZHKA 3MUJA 1DSFH 1ZVSB 1HQ4A 4OIBA 3HG1B 5F44A 3QDJA 1X9QA 2ZCHH 1M4KA 1QSEB 2GK2A 5T1LB 3LCYA 2LFGA 4TQEL 3VA6A 4XCFH 4C59B 3GSRA 3NFSL 3EZJB 43CAA 4MB3A 1F8TL 3IF1A 2CDEA 1BBJA 1ACYL 5E70A 3HS0B 4U6TA 3L3IB 3QPXL 5HYJD 3C5ZB 4KVNH 5L7XH 5J56B 3IJSB 4X4ME 4XCYA 3WFEL 1NCWH 1J9CT 3GRWH 3SCMB 4DWHA 2IGFL 2Z4QA 4NN5B 4X6DE 4YBLB 4BFEA 5GZNC 4X5XA 2DQJH 4MXWL 4G7VH 3RIAK 1MHPL 5C0BE 4XGZA 4R7NB 3TIDA 1X5JA 3O81A 4OAWB 2AJXL 4MD0B 1OT2A 2E7CA 2JK5B 5MEPA 2A6KA 1FE8H 4HIEA 5I17B 5F7UA 4JGJA 4UTAH 1ZEAH 3KPRD 2A9ML 5CSGA 5FUZH 5IT2L 2GJ6A 2PTVA 3PWPA 2WP3T 5LWYL 3F6LA 4JDVA 1HCVA 3IDGA 1AP2A 4L4TE 4NO2A 2Z93A 4OZHE 5E6IB 2XWBA 2AK1L 1S9VB 3MFFA 4UINH 5IFHL 2HJFA 4AEIH 1GC1C 2P5EB 5IB5B 4NT6A 3PUCA 4ZPTA 4LPYA 3AGVA 2HTKC 1CLOL 1TPXB 1F6AA 5IIEB 3C60D 4Q9RH 3PIQB 2JCCE 4CVZB 3NTCH 4M62H 1Z9OA 3BSZL 5HD8D 3RKDC 4LHJB 1X5IA 5LQBH 2CD0A 5HI3D 2FGZA 4OF3A 1QNZL 4B41A 1KCSH 5I19H 4TUKL 3U7YH 3RBGA 3K4AA 1QOKA 3SE3A 3TYGL 4M8QB 4HMCA 3S36X 1QEWB 1U95A 3WIHH 4LSRH 5CD3A 5C0AD 4V1DE 1LO5A 4AIZB 3O3EB 4GKSB 4R3SB 4ELKB 3BIBX 3QRFM 3SDAA 1DQQB 4NUGL 3G6AB 1PZ5B 4OLYL 1EBAA 2ADIB 4RBPK 4ELMA 1HNFA 2V9TA 1E4KA 3GIVB 1RJLA 4KK9D 3DBXA 3TYFA 1D6VH 1CK0L 2AV1B 4I0PA 1I1RA 1D5IL 3EGSA 1WLHA 4WI2A 1MUJA 4O2CA 5IUSA 3QJFA 4AT6A 2A74A 3MLWL 2ID5A 4GRLC 3MGOB 3GSXA 5C0ND 3P30L 3TJEL 1BIIB 3EJYD 1BWMA 4NFCA 4XC1H 4JLRB 4PGZA 4FXKA 3FO1B 5A3ID 1TTFA 2D9CA 3LN4B 1YY8A 4HJGA 3H0TA 3WFHA 3ZTNH 5KVFL 5EO9B 4BZ2L 4XPFL 2CRMA 4ZMAT 2KZ1B 1PDKA 3WFBH 4TUOA 1QUNA 3NFPA 1AXSA 2VXQL 4WWKC 2V2WA 2P1YA 2DB8A 3F65A 1QBLL 4R7DB 1IC7L 2YK1H 5HI5C 2Z8SA 2J6EL 4I77L 3T0XA 2PETA 1M7DA 3O8XA 5DR5L 5MEQA 1MEXL 2XA3A 3VFRA 1XR8A 1ETZB 5TDPB 5GS0L 3IS1X 5C0DB 1I3UA 3UO1L 3WJLA 4BH8A 2E27H 2HG5A 3GZKA 5EPMB 1SJXA 4FQ2L 2X89D 3DVFA 1AR1D 3CFBB 3HR5A 1S8DB 3MJ9L 3QIBA 5LGJB 4DUVA 3S37L 2EDWA 1EUUA 5JOPE 1F4AA 5CSZB 5JW3L 5D96B 2ESVA 1A7BA 2QADB 4M43H 3O4OC 3M8OH 1CIUA 3TJHC 3SKMA 1N5YH 4NOFA 5BRZA 4IIQA 1CD1B 3NGBC 5ITFA 2VL4A 2HH0H 3X12A 1J1XL 4XNZB 3V9FA 4JCLA 1N26A 1TVBA 5F96L 3TA3B 4KK5C 1A3QA 1I1AC 4M93C 4JFPB 4HS8L 2F53A 5KVDL 1EIBA 4KHTL 4W68A 5LCVL 3QEQD 3TO4B 2VITA 1JHTA 1YPZE 3C9NA 5GHWL 4YK4C 3KPRE 5JORA 1JFQH 5JXEA 1BZ7A 1EFXA 3E8UH 2GSIB 3I3DA 1IQDA 4PJCB 2QQKH 1QP1A 1I8KA 1CE1L 2YMXH 3VCLB 1M7IA 2W9EH 3NPSC 5DHVA 3HAEG 4PJFB 3E3QE 2X7LA 3DRTA 4NYLA 2NY2D 3VGBA 4RX4D 2C1OB 1NAMH 1B4JH 1B0RA 3H7BA 5C1MB 4N90E 4GG8A 3Q6FA 4H1LH 1CDBA 1ZWIB 2C3HA 4F33B 4KKAC 5HVWA 1MCRA 1DLHA 4KAQL 3BZFA 4AIXA 4LHUD 2R23A 3JV0A 3VFTA 1G7MB 4UTBH 1WSST 4JPKL 1LK2B 1RFDH 4M00A 4CADB 1IGMH 3J7HA 3LIZH 4RAUA 4ZFOL 5C0AE 3IFPB 4HFWA 1UEMA 5I76B 1LVEA 5T1LD 4C4KO 2FNBA 2ZOKB 2P42B 3BD4A 4MS8D 4X4YA 5AYQA 2IG2L 5JXAH 5E1AB 4YO0B 4LCYA 4HV8B 2VR4A 4JFQA 2W65A 2OR8A 5JNYB 4O58H 4WVRA 4TNVK 3DRQB 1L6XA 3ZTJH 3RHWK 4S1QH 2B0SL 3K4ZA 4G7YL 1W0WB 1IEHA 1T0NB 4PJIB 2X05A 2GTZB 3NA9H 4P9MH 3KPSB 1A14H 3SCMD 4PJAE 4U1KA 5JPNA 3LRGA 5K9KB 3MCG1 5DJ8B 4OLZL 4ZYKA 2HLAB 2NX5D 5DYOB 1JNNL 2J1KA 4LGSB 1B88A 3DPBA 3BT2H 3NOIA 3KJ4C 5BO1L 4UV7H 1T1WB 2CKBB 2DWDA 3WNLA 5I0ZA 3WHXB 4JDZA 5A2JH 1EERB 5D2LA 5DA4A 3UTTA 2O61B 4IDLA 1I7ZB 4I13B 1VFAA 2OI9C 2W60A 3HAEA 5E6ID 1BVLB 5IM7B 2IAMC 1INEH 1EEZA 4KFZC 1A21A 3VG0L 3D9AH 1W72B 1XF3B 5GZOC 3O6MH 4PD4K 3V5HA 4BSWB 2ARJB 1NBZA 3S96A 1QQDB 5GS1A 1BFTA 1Q94B 2WBJC 1B9ZA 4PV8A 3SE8L 2X4QB 5K9JH 3WFCH 3B9VA 4PG9A 3BUYB 3QDGA 1WC7A 2J6EA 4H8WL 4Y5XB 3HMXL 1QR4A 4XP1H 3SKUD 4NZTH 4JRYA 3MRPA 5DUMH 3HA0A 4DGYL 5IMMA 3BEVB 1CGWA 2VLRA 3JTTA 4L4VD 4I18C 1CFQA 1UKQA 3VWJC 3EYSL 2R1WA 2J8UA 1MHEB 4HKJA 1KTRL 4W4OA 2CK0L 3IRZA 4PLNC 1U2HA 2V2XB 3MJ9A 4NZDA 4JO4L 5HJ3B 4NC0B 1MH5B 2Y23A 1CICD 3LKSA 3WHE0 3U36A 1KGCE 3HMWL 1TJIL 1A47A 2BNRB 2AP2A 5C09A 2VDRH 3DI3B 4XZUA 2Q7YA 4OLEA 3U9PH 3DTXB 1IGTA 4JFDD 1FZMB 1JZ7A 1S9XA 5E08H 4NM4L 3FB5A 3O2VL 3N9GH 3UJJL 4EDWH 1RV6X 2FWOA 2VKXA 4Z7WA 3GUTA 4BQBA 4KI5C 3G6DL 3GMOA 3VXSA 4N0YH 1OAKL 1MREL 1MAML 5D1ZA 1MFEL 2WNGA 2AERT 1KBGL 4PJHB 3CLEH 2VE6A 5EZOH 2IPUK 4PLKD 2OXGA 2EIEA 1CLCA 4P59H 1SMAA 4DOHE 5CWSB 2MQ0A 3LKQA 1AHWC 1TLKA 4LCWA 5ENWA 3TPUA 4PJBB 3VGFA 1CU4L 4HUVA 2VNCA 3HG1E 3BP5B 4NO3A 3U4BH 4ZUWA 4CDGC 5E6ZA 1HH9A 1FV1A 4RGNB 2CDFA 3LEXB 4K9EC 3QCUL 2L0DA 3FAWA 5I30H 3FTGA 4Q6IC 4Z0XA 1UXSB 1HYSD 1D5BA 3RVUD 3D0LB 4OIIH 1T5XA 1KACB 5F1OB 3MRNB 4X6EB 1TQCB 2R29H 3TN0A 2VDQL 5GIRA 1QRNB 4F2MB 1OSPL 1GGBL 1E6OH 1NCAL 5FYJL 3FT2A 3UTPD 1HILB 4JREB 3DUHA 4QRPB 2NX5E 1UYWL 4NQUA 5E94B 4QRUA 3RWHB 1NGXA 3KYOA 5F7YC 1GGCH