3RVUC

Structure of 4c1 fab in c2221 space group
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
b'QIVMTQSPFSMYATLGERVTITCKASQDIYSYLSWLQQKPGKSLKTLIYRANRLITGVPSRFSGSGSGQDYSLTISSLEYEDMGIYYCLQYDEFPYTFGGGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4C1 Fab - light chain
molecule tags Immune system
source organism Mus musculus
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvuC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvuC01
3G6AB 1MF2H 1FFOA 3NACL 5DO2D 4AH2A 3Q48A 1QQDA 4X4XA 3EOBA 1G9MH 2AI0L 3QFJD 1XGPA 5LBSL 4OLWH 1BJ1H 4LSVL 4Z7NE 6FABL 3WO3B 3PQYB 1TPXC 2F8XC 1NFIB 1U2CA 3V8OA 5KTEH 3EYQD 2BSRA 2GJJA 3V4VH 4Z8FH 1BIIB 3X13A 1HXYB 1U42A 2ARWA 3EFDL 5BZWA 5JXEC 3JTTA 4N9OB 3V5HB 5FYJU 3HRPA 5HHXH 1LO0H 5JOPE 4HZLB 1ITCA 1GGIH 1G6VK 1A6WL 3MROA 3AFLA 1AD9A 1I9IL 4DN4H 4EI5C 5F1IA 5DRZA 2WP3O 5FYKD 3B2UC 3IDXH 4XMLL 2HLFC 1IEBB 2XTJE 4LCUA 4MYWB 4QHUB 3VXSA 1KEGH 1U2HA 2NXYD 5DRXB 4IJ3B 3HZMB 2R39A 2D7QA 5HGHB 3MODL 4Y2DD 2P44B 2ZNWA 3VXSD 2A6DA 1G0XA 3VFVA 5D7SH 2PTTB 4MMZC 3R8BB 1AO7D 1TZHA 5D1QC 5D7JB 5DHVB 3D69A 1X5FA 1A6UL 3S36X 1HIML 3BWAB 4PTTA 1ZA3B 3HNVL 4EEEA 1KLGB 1KELH 2RR3A 3L5WA 5AD0A 4H20L 3OKLA 2F54E 1DUZB 5CILL 2B4CL 1RMFL 4MD0B 3O2VL 4RGNE 3GSNB 5IUSA 4ZXBA 5CGMA 1EFXD 1OARL 1X7QB 4YX2L 3DMMB 3GMQB 3ZKXB 3LD8B 3PNWA 4OD3H 4HK3J 3MRLA 3DUHA 1AH1A 1IQDA 3R1GH 2CRMA 2OQJB 1FZMB 5FM8A 4LCYB 5LG1A 3MNVB 1KF9B 4Y2OA 3QDMD 4L9LC 4F7EA 1YYML 5IFJA 4MA7H 1M1SA 2D9QB 5T3ZH 4NM4L 4DFIA 1SVZA 4DVBB 3O4LB 5I1JH 2P8LA 4TVPE 1N6QH 3B4NA 4NN5C 4KKBD 1JCKA 4PRHB 4LLUA 1JNHA 4HX1A 2XWTA 1B90A 5CBEB 1MVFA 2C1OB 2H2PC 1MY7A 1X5GA 3ESVF 5CJOH 2YKLL 2NR6D 3AS3A 4OZHA 4L4TA 4DGIL 3S98A 2XT1B 3HI1A 5ISZD 4LLVA 4JFDE 1H15B 1ZGLA 2UVFA 3H7LA 1TXKA 1U95A 5I71B 3OAYK 1SJHA 1HCVA 3I6KB 4O9HH 1NCBL 4L8SB 3TZVB 3WN5B 4EXKA 3LMJH 5IV2A 3WO4B 1FVEA 4FZ8H 4URTB 1ORSB 4DTGL 3O81A 4LHUA 3U9UB 3BVNA 4XRCB 4M5ZH 2VTFA 3VXSB 4WEUD 1KFAL 1IGTB 2X1WL 3IJHA 3P9MA 3X3FH 1A7QH 1INQA 2CUMA 1F2XK 4X7TA 5FV1L 1F8TH 5M94B 2JK5A 3RNQA 2FGZA 3D25A 1UM5H 4LPUA 3MODH 4JFOB 3MRNB 2H9GA 1FN4B 1KTLA 2X4QB 3PWVB 1VGEL 4TTGA 2VDOL 2WIIB 1R3LB 4FQLL 1F4WH 4PG9B 3OR6B 4N1CA 3DMMD 2AK4E 3WFEL 3DTXB 3WHE0 3DRTB 2FCBA 1U8PB 3T0VA 1N4XH 3WSQH 2AEPL 3H9SB 5HHXL 3RI5K 2A74B 4PB9L 1UXSB 3EFDH 3QA3B 4ZDHB 3SKNB 5JOPD 5E8PA 1MAJA 1U3ZA 3EO1B 4P2RD 3ZTJH 4B50A 4Q97A 4PUBH 4EUPH 4HAGA 1I3RB 3GKZA 5MI0B 3X3FL 5EUOE 3SCMB 3V6FB 1HYSD 3JSSA 1PW3A 2NY5L 1QQDB 4X4XB 1UZ6F 2K1MA 1QO3A 4OCWH 5BCAA 2I5YL 5TE4L 1T7WA 3BGAA 1N5AB 5T1LD 4YIQB 3GSXA 5KBNC 3IGAA 2VXVL 4U1GC 5IESL 1U8KA 1MCLA 1AY1H 4WI6A 1FFNA 1MSPA 1OP9A 4DZ8B 3DPBA 5CBEA 1AHWC 2D7PA 2FLBT 5AYQA 3ISWA 3VMOA 3QIBD 3MJ9H 2G9HB 5JUEL 2AJZA 1QSZA 2YPKB 4CNIA 1P7QA 3CNKA 5F1IB 1NAMB 4X98B 4N8VG 1IFHH 3SJVD 3B9KA 4S1RL 1HZHL 4HF5L 5ALBH 1S9WB 2DLHA 1FVEB 3SCMC 4XMPL 4RQQA 2ADIB 3TN0B 3VDAA 2L7UA 5TGBB 2NY7H 5F1NB 1AC0A 1HHHA 3NAAH 4LFHD 4BKLA 2IALA 4M5ZL 4I18B 3D39B 5IJVB 2E27H 5KN5A 3VFPB 5I1LA 3T0AA 1RV6X 4C56B 35C8H 2CDGA 2PYED 1CTOA 2FWOA 1JF5A 4LLYB 4NO3A 5F7YC 1MVUA 2H8PA 3UYRH 1DSFH 1E28A 5IK3A 1K8IA 1LEKB 1EHLH 4GKZB 2J8UF 3UROR 2A77L 1FZOB 4R97C 3FQXB 5HJ3A 4IMLB 4UT9H 3MCKA 1IKNA 4JKMA 1V7ML 1H3PH 3VJ6A 5T33H 2F74A 3QFJB 1CTNA 3EO0A 4JRXA 4M6ML 4PGCB 4I0CC 5K9KB 3MV8E 1T1YB 4UTBL 3T2NL 1SMOA 1UJ3A 1RULH 1TZHB 3T1WA 4KQ3H 4XCEA 1J7VR 4HSQA 1A1NB 1NCBH 4UU9B 1T3FA 1ZA3A 3BP4B 1IQWH 5I1IH 1C08A 3JBG7 3UYOD 1EUTA 2I60H 2KBGA 1VKXB 5I71C 3DLQR 3WMSA 1A6AB 3RZWA 5TQ2L 2GHWB 4PJAF 4NM8H 1S9XA 2BC4A 2FEDC 4YXKL 4APQA 3I85A 4P23D 1AI1H 1T1ZA 2J6EL 5HHOE 2HA1A 1MI5B 4UDTA 1B0RB 2MHAB 4CVZA 3L3KB 2O5XH 4FQ1H 1QFHA 1HH9A 4N0YH 2CXKA 3OAUH 1KJ2A 4M7LH 4WJ5A 1XGPB 4Z76B 3A0OA 5BV7L 1NCUA 1MCDA 1VADA 5KSBF 4OF7A 5C9KA 1FNGA 1QKZH 2NY0B 4X4ME 2VWEC 1WWBX 1I9JL 4OZGE 5IB4B 1CQKA 3VWKC 3RWEA 3C09B 4NO2B 5JDSA 4JKPL 2X4SB 1N5YL 1BJMA 3MV9A 4FFYL 4PJHE 5DDHA 2CK2A 1RMFH 4QXTB 3QUMH 3KLAB 4YZFE 4KXZH 3QEQB 1NCAL 5ANMB 1I9IH 4DN4L 5JIKA 1HSAA 5JOEA 1RZ7H 1AXIB 4NQTA 1KJ2L 3SOBH 4X6EB 3TWCL 2HMID 4WGWB 1UACL 3H9YA 3BKCL 4U1HB 4BFGA 3K1DA 1P7KA 3JV6A 4ODXA 3MLRH 3CVIH 3P30L 4D9LL 4X6FA 3CGTA 2FB4L 1XF3B 2Y7QA 5CKAA 3QIUD 3MV7B 1KEMH 2DQDL 1K5NB 1V5JA 4HHAB 1MRFH 3IETB 4EXPX 2YS4A 3SGEI 3ZKNC 2EH7H 2OZ4H 1FL6A 4OUUB 2MQCA 5SV3A 3HZKA 4OCRL 1MEXH 1YEFL 1CGXA 3EZJB 3U2SB 3VG9B 2CDFB 3G6DH 4P3CL 5IGXL 1FYTE 4PV9A 2ITCB 4TSBH 4ZFGL 3CH1B 4K94L 4YEFA 5DVMA 4PJDE 1D5IL 4ONFL 4NNXB 1KGCE 1OP5K 1LO2H 2Q6WA 2YPLD 4G8IA 3T09A 2Y1VA 3WJJC 1MLCA 4KV5F 4KAQL 1F13A 5IB3A 5KSBE 1UCBH 4GRLC 3D2UA 5HHOB 4OQTL 4LBEA 3F6LA 3QWQB 4I13B 1I7RA 3WXWH 4MQ7B 4G5ZH 3QUYA 4Y19B 3DX9A 4Z7VA 3FB7B 5F3BA 2EE9A 3PWJA 3OKOA 3TVMB 1D6EA 4LPCA 2NY1B 2O61B 4JFDD 1F4XL 3B9AA 4EZMA 2CRZA 2BK8A 3GJFA 5GGSB 2APWA 3LKQB 1EMTH 3N0PB 1PQZB 1WK0A 3PDGA 5T3XE 4ISVB 3P4NA 3ZT6A 3T4YB 1KACB 2CPCA 3TCXA 3HCVB 5HHQA 1WISA 3TH2T 1EUUA 3CZJA 3WXVL 4R0LC 2VLKA 3T3PE 4Q6IB 1M7XA 4KKAD 4UTAH 1PKQA 3P40A 4WU7B 1F00I 3RX5A 2PYEA 4P48A 2DQHH 3GJFK 3HPLB 4B7IA 5BQ7A 3TIEB 5IBLC 3F58L 5E6IB 5F72S 1NGQH 3QHFL 4RMTA 4U1LA 3N1QC 3P0GB 5CUSH 2HFTA 4KJYA 4XWOC 5EOQH 4ODHH 4EQ3A 3GUTA 4WW2A 5J11B 1N64L 2VZ3A 3L3JB 2ARJA 3CUPA 5FAAA 4D0CB 1EEUA 2O5YH 4HGKC 4GKNB 4ZSOA 2VLJD 15C8L 1IQDB 4BKLB 4CADA 5CD5C 2QKIB 3UTOA 3MMEA 4HWNA 4X9FA 2IFFH 3KAAA 4NWTH 1YMME 3PWNA 3H3PH 1T3FB 4RDQG 5GSVB 5JPNA 5IVXE 3BUTA 3OR6A 4XAWH 5LQBH 3ARDD 1QR1B 5ID1A 4GW4A 2YR3A 3ZSTA 5T3XD 4EI5D 3VXRD 4ENED 1J8HA 1L4IA 5I18L 3BPNB 4FRWA 2A2QT 5AWNL 3BDBA 4HKXA 5EA0H 4XCYA 2VDRH 4G6AD 2HT3C 3MCKB 1OPGH 4PR5B 3FFCD 1H3WM 2P8MA 1KJVB 4RGNC 1RHFA 4HC1L 5H2BB 5IWLA 2B20A 1R5VA 5AEAA 2Q7YA 2Z93B 1F2QA 3BP7B 5DJDB 1G1YA 4WWKC 4MLSA 2XZCL 4ODUB 4ODBD 5LJYH 4QY8A 3IAPA 1T6WA 4NHCH 3RU8H 5DJAB 5KSAD 2Z31C 3P4MB 1WBZA 4PJ5B 3QHZL 1U58A 4Z95L 4PBVC 1R0AL 3TO4B 1A6TA 1K9TA 1BZQK 5DZLA 4BQBA 1ZVYA 3OV6A 3X14A 3EZ8A 3G08B 5BXFA 1CZ8L 4L8DB 2H41A 1GAFH 3G9VA 4ZD3L 5FB8A 3HAEB 5DLMH 3OHXA 3RGVB 4I3SH 1LNUA 3VFSB 5DVNA 4XVUC 2X41A 1FYTB 4Z9KB 1OLLA 5L2JB 4KI1A 5L6YH 3HZVB 1YEGL 2FH6A 2PF6A 3ROLA 4LVNC 3VFRB 3EJYC 4G8GA 1EVUA 3BP5B 4HF5H 2WIIA 3BZDA 3E8UL 1Y6KR 3BP6A 4UQ2B 3LQAC 4I5BB 2CD0A 3AB0B 2DYPD 4U2YA 3O9WA 2H26A 4R0LB 3I02B 3IDXL 4XWGH 4ZFFA 3HNSH 1AQKH 1LDSA 5DF0A 5EBMB 2M1KA 2YK1L 2IFFL 4KH2A 3OXRB 3KJ6L 4HMCA 5GQBA 1DQDL 1XGTB 3BKML 3VWJB 4NM8L 1C8PA 1BQSA 5IFHL 2A83B 4X99B 1QPPA 4WDIA 3VGEA 4DN3H 4NCC2 5I1IL 5ERWA 6FABH 1TCMA 1WC7A 1IC7L 2HH0L 3U79A 2QHLA 5LAXB 2FLRT 4PJ8B 5DHYA 2UZIH 1MRCH 1CIUA 2FJGA 1CFNB 2MMXA 2NPLX 2F8VA 3UZQA 4G8IB 1RULL 2HFFA 5B8CA 3HHRB 3QDJB 2YN3A 3EYSH 1KXTB 1QSFA 3VGFA 3QXVA 4RDQF 2AV1B 1T1XA 2WINB 3SJVB 4LCCA 5HHNB 1DBKH 5C07A 1N6UA 3UC0H 3L9RA 3OAUL 3V4UH 4YHKH 5EZOL 4NHUA 1G7IB 4D94A 1QLEH 3TN0D 3AGVA 2UVEA 1AGCA 4M02A 1BM3L 4DK6A 1JWUA 2CDEB 1ZHNB 4EBQH 4FQLH 4H1LB 3KPNA 1R3IL 3I3DA 1FNHA 3GMLA 5HYFA 4KXZI 4ZUUA 4I48B 1Q9WB 4D9LH 4WI3A 1E4WH 4HLZH 4RA3A 1D5BB 4XPBL 3THML 4PJGE 5L88H 5I19L 4OLZH 3WNNA 1YJDH 3HPJA 3P73B 4F57L 1TCRA 2J8OA 3MV11 4M8QA 1ZE3C 1T04A 3FQTA 4L8BA 4NQUA 5ANME 5JA9A 2BNRE 5DURD 3K74B 2WV3A 1FRGH 4Y2DC 5E6IA 4E41B 4LSTH 1KTDA 1K8IB 2PKDA 3AVEA 3MLTA 4L8SA 4QXWA 2VDKH 5L2KD 4UBDC 1JPTL 2UYLB 2H2SC 2NXYC 2UY7A 5DD5H 4M7LT 2P24A 4MXVF 4X7EC 4P2OA 1YDPB 1UYWL 3WDJA 1JYXA 1C16A 2IANB 3KPSA 3KS0H 3K2UL 3MMEB 2AABL 1GYAA 2DL2A 3T0EE 3VXMA 4ZNEE 2SEBA 2VDQL 4KJWD 3EFFA 1UEYA 2AXFB 2ICCA 1QEWB 2V2XA 4WW2C 5IFAH 4E42B 5IM7B 5JO5A 4N8VA 3G9AB 4PPTA 1ZKAA 4RGMB 1LEIB 3MSPA 2F58H 1EGJA 2NY0C 4GAFB 3KXFB 3B5GA 4YWGL 1IM9A 1XZ0A 1VFUA 4XC1L 2X9WA 2R1YA 4XPHL 3AM8C 3T2QA 4X7SH 3DUUA 4PRDA 4AENB 3RNKA 5ADPL 1QACA 1CR9H 2PUQT 3Q3GB 3N06B 4QXUH 2HFFB 5B8CB 2VH5L 3HZKB 1JYVA 3ARBB 1XCQB 1MHPL 1KLFA 1JYNA 4XP5L 2XKNB 5I15L 3LEXA 3RWJB 1CBVH 3O11A 1OGAE 1MJ7H 1MCJA 3ZKXC 3CFBA 4TNVK 3RKDD 3HMWL 5ILTL 3OG6B 3QDAA 3GB7B 2AEWA 2BY3A 2IPKB 2DIJA 2AK1H 3MQIA 4YHKL 5GZND 2HTKC 5HDQH 1LQSR 5MEPB 1FNEA 4OLYL 3Q1SH 4KI5E 4AMKH 2VXVH 3D0VB 3RY6C 3MBXL 1BZ7A 4EIGB 4RAUA 1ZWIB 3VXOA 5D1QA 1UM5L 4QTIL 3FTGB 2C3XA 3H7BA 4EUPB 2BERA 3N1FC 3DI2B 4OCSL 4ELME 2ZOLA 4HJ0C 3CVHL 2VH5H 3EDDA 3IYLW 5GS1C 2PETA 4I5BA 1FQ9C 4JM2F 3O2DA 4YGVB 4E5XB 1T4KA 5ACLA 3RKPA 1NBZA 2CRYA 4ZXBC 5JLZA 5LWYL 4MAYC 5FYJE 3UBXA 4YHMH 5CGYC 5I17B 3X14B 3G08A 4AEIL 3SKMB 2D0FA 4OCRH 1VA9A 3GSQA 2R1WA 2VSCA 1JWSB 2XPGB 4ORGB 1AJ7H 2IBZX 4Z8FL 3OHXB 4H25A 5DUPL 2X70A 3SKUD 2BOBA 5E1HB 3ZKMD 2HRPL 3QI9B 5EU4A 5E2VL 4F33B 4QRPD 3D3VD 4YLQT 1QFWL 5HHMB 3GJFH 2Z8SA 3RVTC 1GRWA 4Y16D 4P4KD 3DROA 2OX5A 1KSRA 3ZYOA 4OZFG 3M1BA 2Z8RA 4GW5A 5TQ0H 2C3HA 4PJ9C 2P5ED 4L9DA 4R96A 4M6MH 1AP2A 3SDDA 4PLOB 1OQXA 2KL6A 2CIIB 1HKLL 3VH8G 4LSTL 1QZ1A 3MA7A 4U6VH 4UINL 3MJ6A 5K9KA 3HNVH 2CJUH 4WY7L 4FFYH 1B88A 1Z6JT 3I3EA 4OT1L 4XCCL 2FD6L 4PS4H 5EUKA 1RD6A 2NY3B 2I9TA 1J8HB 3QHZH 5JW4R 5AAMA 1Q0XL 5CIPA 1QFWH 4PJBF 1WQVT 1CG9A 1Q9OA 3L1OL 3PJSB 5EBGA 1NGYA 2E7CA 3Q1SL 5DQ9B 2ILLA 2ZWLT 5ESQB 1HSBA 4GLRI 4KK5D 5D71L 2ID5A 2O5XL 5C0ND 4PGDA 2AW2A 1G1CA 1PLGH 4JVUA 5CINH 1JZ7A 3L5HA 3O4LE 3F7VB 4E9LA 1H0DB 1A6WH 5IHUL 1WBZB 2PYEB 3S4SA 1T66C 4E41A 1H5BA 4JO1H 2XA8H 4HS8L 3RDTB 1FAIL 1D5ZA 1AGCB 3CAFA 4WUUB 5FUOL 1V3KA 3RWHB 1EXUA 5DC4B 4JKKA 4CMHC 3S35L 4GKSB 1PSKL 4AEIH 2BNRA 3K1KC 2BP3A 2ITDA 4MQXD 3DVGB 1NSNH 5FDYA 1FO0B 4RGNB 4CMMA 4ONHA 5SWSE 1CE1L 2A6DB 5EG6C 4DZ8A 2F54B 1NJ9B 5EWIH 4NQCB 3UTTB 4ODSH 2X09A 2O26U 3NZ8A 2AJZB 1UXWB 3CMOH 4L8SC 5D7LB 4WEMB 4PLKC 3VW3H 4HUUA 5HDQL 1WIPA 4N8VB 2ADJB 4ZTPL 4NKDB 3BAEH 1ZK9A 3DXAB 3QXDA 4EN3B 2Y36L 1IL1A 2VB5A 2Y5EA 4Q9QH 1UQSA 1CK0H 2NW2B 4LKCA 2B5IC 4Y4HC 3U7WH 1NLDH 1X6LA 1YNKH 3U0PA 2IWGA 2XA8L 4JB9L 4HCRL 1PBYA 5ISZE 4HT1L 3OXRA 4XBGB 2IANA 4ZUTB 4K71B 1RZ8B 4LNRB 1YEHH 2DD8H 4LLQA 5I1JL 4Y16C 3FO1B 4XP6L 1A5FL 5FYJL 4GH7B 3O11B 3UC0L 3KPQA 4DGVL 2GQHA 2IPUK 4DUXA 1RZFL 4FTVE 1VACA 2C4XA 1VGEH 3O6KL 4KUCF 3B9KC 4Y1AD 1UH4A 4GRWH 5DLML 3SCMA 3DRQB 2ZCLH 3TO4A 3KYMA 4LMQI 2DQEH 1JK8B 3QIWD 2EH8L 1JGEB 2Y6SC 1A1MA 5E2WH 1DBMH 1GGTA 2ZJSL 3BPCB 3PQYE 4G6JL 5EDXA 1LO2L 4KMTH 5GRZA 1ZLWH 3WKML 4EUPA 5HHMD 3K2UH 3O41B 4LKXB 2VLKE 5GS2H 3G6AA 2HLAB 1TJIH 4BJLA 3QDHA 3Q6FB 3LMJL 3VFMA 4B5EA 3UJTH 1U8IA 3GMOA 1CXIA 5I1EL 4MX7B 4QCIA 4MQ7A 1YY8A 4UILH 1OSZB 1FH5L 3BP4A 5JIHA 2VAJA 1O5DT 1OQOA 4JFEB 3KPPB 4PRPB 3SBWA 5J13B 5F3HB 1IKNC 5I1DA 4ZAKD 3PUCA 4QRRD 1AQKL 1XMWA 4K3GA 2R8SH 2IG2L 4UNVA 3B9VA 3ILPB 5DMJB 3LCYA 1UKSA 3QJHA 3QQ4B 4MD4B 3PWUA 4KFZC 4BZ2H 1INQB 3ZDYE 5D1QB 3BZEB 1YEJH 1XF2B 1ZMYA 4H88L 3HUJA 2J8HA 4NKIL 4MJID 3R1GL 4M61B 1XGQB 4LEOB 4BH8B 1YUHA 5EZJB 1EEQA 3MNWA 3OKNB 2CLVA 5IOPB 5DRZB 4WDIB 2XWJA 4Q0XL 5TPWH 2BVOB 3V9FA 1GC1C 4X6CB 3ZE0F 4JPKH 3ARFD 2X5PA 2BFVH 5I1KL 4YDJA 4CAGA 1T7VA 5MEOB 3IDGB 5EO1B 1DBAL 4NJ9L 4QHLA 1AD0A 4OLUL 2X7LB 4M4PA 1DBKL 1P5UA 5DHYB 1MHEA 1GGCH 3MOAL 1KLUA 1TPXB 2O5ZL 3CZFA 3NTCL 3STZB 3NGBB 4QHKI 4GKNA 3OL2A 5LBSH 4FN0A 2B0SH 4CDGC 2QSQA 2V2XB 4AY0A 1GCFA 1ADQL 1KN2H 5EUOF 2FATL 2OTWB 5DT1L 3EBAA 5DFVD 1KXQE 4OGAC 1MJUL 1I1FB 1KENL 3PWLB 5D1XA 4MDJA 3DV4A 2G2RB 3IXAB 4IDJL 2K7QA 3X17A 3PE9A 5I1KH 5F7NC 4PJ9B 5FYKU 4PRIE 4PJXF 3VCLB 4LF3B 4Q7DA 3S3SA 3DURB 3OZ9H 4DGYH 4EUPG 4JHBA 1LWRA 4LDLB 4NSKB 2YA1A 5IF0B 5E95B 1P1ZB 3RHWF 3QUZA 5FCSH 4UV7L 4HJGB 3TNNB 4RX4A 3SN6N 1RJZB 2PNDA 4NJAL 1NCDL 1MHHB 4JZJC 5TE6L 1YY9D 4F3FA 3RDTA 2GSIA 5ID0A 2DTML 1T21B 4H8WH 3RGVC 4TUKH 5T1MB 3WDHA 1U3YA 1S7UB 4PP1C 3RWHA 3B9KB 5J6HB 3QUYD 1N6QL 1S7XA 3GHEH 3KPRE 3ME0A 3QO1A 3CU1A 4NP4H 2FSEA 5BVJA 5TGBA 5C08B 3H2WA 5EFIB 3MRPA 4MAYB 4NBXB 1C16B 2GJ6E 5BXFB 2VDQH 2OXGA 1DN2A 2AXGA 3O3UN 1FVCA 2CH8A 2LQRA 4XAWL 5LQBL 2XI9A 1UVQB 1KT2A 2A77H 1UM4L 4WWKB 3ZSSA 1W0WB 2XA3A 1EHLL 1R6VA 3TVMA 4K3JH 2UWEF 4JKWA 2ZJSH 4CN1A 4EN3C 1XIWD 4KHTL 2KQMA 2GITB 1GVIA 1RZKH 1CLYH 2LE9A 3MLRL 3QNZB 4WW2F 4LSUH 4J4PC 2EDNA 3VJ6B 3FFCB 2BSRB 2FGWL 1M7DB 1CFSA 1CFTA 5EULV 1IAKA 2WWMC 3OJDB 4V1DB 1RJYB 3CXHJ 1R0AH 1I1AA 2NNAB 5D7KD 2L0DA 4WFGE 1LDPH 4AEHL 2OMNA 4G7VL 2VXUH 4Y5VC 3QP3A 5FGCB 3UPAA 2VUOA 3O8XB 3KYOA 3IFLL 2XQYK 2GI7A 5E24E 2BNQE 2DQIL 3G5ZA 2X9XA 5T1KA 2XOTA 4OIIL 2EXWC 4PGEA 1WCQA 3VDCA 2YD2A 3ARDA 2YRPA 4QT5A 1YMHB 5JHDA 3S34H 3NFNA 2R1XA 3RIFF 1JGLL 1EJ6A 3B9EA 1FL6B 3ET9F 3K4ZA 3QG6A 3L3IB 2J4WH 4FXLA 1WFNA 4NPYA 4QLRA 3IS1X 4PJGA 1UCTA 5F96H 3MCG1 2Y5TB 3SO3C 5DWUL 2I5YH 3L7EA 5HYJD 4WV1A 1S7TA 1UADC 4O02H 2O5ZH 3NTCH 4HIEA 1KIRB 1A7NH 4HZAA 3OKOB 1A2YA 4LLWA 1U8OA 1NBZB 4PYGA 3BPLC 1HQRA 5J57B 5L8LB 3CC5B 3BEWA 4DK3A 2E3VA 4H5SA 4OZIE 1FFNB 3L3DB 3VXUD 2QHRH 5C8JB 2B1HL 2BXYA 2J5LB 3QZWB 1T03H 4JDTL 3C60B 5I1CH 1NMAL 2E6JA 1OP3H 3VU2A 1HHIB 2F9BT 3QUMA 1ZLVK 5D2NC 2PO6A 1HYRC 3QXUA 1G7QB 4S1SL 4GG6E 2K7PA 5ANMA 5CSZA 1IGIL 1NBYB 2LU4A 3FQTB 4YHOL 4AT6A 1UM6H 3HMXH 2XY2A 4P9HH 3V4PH 5F93C 2DLEA 4H8WC 1BWMA 3FB6B 3LKPA 3SGDI 1TVHB 4ZFZB 5DJXB 1ZLSH 3FOMB 4PP2B 5D7IB 2DJSA 4MJIA 5IR1B 1ITBB 2EC9T 1RIHL 3LDBB 5DFTA 1BP3B 4R4BB 5E1AB 1C5DB 3U30B 4OGYL 2C1PA 1NC4A 5BMFH 1WBXB 1S7WA 1CICB 4K7PX 5EIVA 1KYOK 1UKQA 4QGYA 1NKOA 2EC9U 1XGYL 5B4MD 1C7TA 3R06A 3VXMB 5I8EA 2Z31A 4AQOA 1LK2A 1TVDA 4JFPB 2CMRH 4ZS6D 3VFOB 1UFUA 5EUKB 1RZIA 1T0PB 2XXMB 1S7QA 1Y0LB 1BEYH 1K8DA 1ZLWK 3FHAA 4Z95H 3IU4L 3MLVH 3VXUA 1CD0A 4CL7A 1OWWA 3RPIB 4HQQL 2BCKA 2BDNL 4Y4KC 5CWSB 1W0VA 3K2MC 1CGVA 1RZKC 4PGCA 1HEZA 4PJEB 5KSBA 3WFDL 3D9AL 2DQGL 4PJCB 5HI4C 2NTFA 3RNQB 4MMXC 3MRLB 3TNNA 2CUIA 3V6BR 1QRNB 4JGMA 4ODTH 3MRBB 1JZ2A 1V3MA 1OP3K 4BH7A 1T21A 1G9MC 4P5KB 1R3LA 3EW3B 1VSCA 1BF8A 1WAAA 3PP4L 5J1AA 3MRRA 1FFRA 2R4RL 2G2RA 3IXAA 4KK5C 4KPHH 5JHDD 4IRJB 3CDGA 4NQVA 1EAPB 5BO1L 3ORJA 2I60L 4M5YH 2FRGP 3CVIL 4XX1E 5TE4H 5J9PA 1OTSD 1D5XB 4U4BA 3EOTH 1Q38A 3L3DA 2VLKB 1Z2KA 3IU3B 4AK1A 2C1OA 1FC2D 5JZ7C 1FSKB 4HK0B 3RGVA 4QCIB 4MA8H 4YH6A 5FYLH 4NN5B 3X3GL 4HZLA 4KMLB 3NCBB 2NR6C 5MHSE 1I75A 1IARB 2X4OA 4CW1A 3G5XB 3WBDA 3W11C 1B0GA 4KKLD 1RHHB 3OXSB 4WEBL 3S5LA 3HZYB 4JKPH 2FYYB 5FYJH 3MC0A 1T2JA 3PQYA 1QSFD 5I17A 1FYTD 5J7CC 1HKFA 5D5ME 4WW1A 2EDOA 4R4BA 3HAEH 5E1AA 3BISA 4AG4L 4BH8A 2DMCA 4X7TB 5HGBB 2X4PB 4I3RL 2HRPH 1RUPH 3PV6B 2XWJB 1HSAB 4FQQA 4PTTB 1YC8A 3VI4F 2HFEB 5H94B 4M6NH 4NZTH 3ZKMC 2E27L 4CN4A 4J3WA 1JZ6A 1P7KB 5JMRA 2A1WL 4DQOH 1RUAL 2YZ8A 2X89D 1RJCA 3X11A 1DTUA 1HNGA 4YPGA 1X5HA 2BVPA 2FBJL 3QXWA 4Z77B 3RPIA 4G8GD 3FFCA 3QWRA 2QADB 3JTSB 1WF5A 5A2IH 3UTPE 4P5MA 3OG4B 2AAVA 3DIFA 5I75B 2N7AA 4Y5VA 1WFOA 1ZS8A 1JGUL 1KPUB 4C83A 4XH2B 4OF3A 3QA3A 1ETZB 1TZGH 4EKXA 4MX7A 1DVFD 4WIQA 3DJ9A 1G84A 1ZGLP 3MV9D 4GBXA 4KPHL 1K85A 3DX8B 1WT5A 3KXFA 1JPTH 4XBEL 5K9JH 1YMMB 4U0RC 1JNHB 3RBGA 3ILPA 3REWB 4RAVA 4N8CL 5IMLA 5J11C 3DUUB 4PRDB 3RIAF 5EBLA 1T5XB 3U36B 4MHHI 5EU5A 2HJFB 4C58B 3P0YH 1WITA 1I8KB 1G7IA 5BV7C 3C5SB 3QEQD 5CFHA 1S5IL 3WLWC 1JF6A 1JHKH 5FA4A 3GSRA 4NQDB 4MS8D 4MXWH 1OGAA 4JY5L 1F8TL 4P23A 4OI8A 3QDMB 3FONA 3S5LG 5I76B 3ZTNH 3JUYA 1XGUB 4JR9L 5J12C 2VZTA 1MH5B 3TBVA 5JHLL 4H5SB 2QQKH 2IGFH 1GOGA 5TFSL 1BIIA 5MP6L 2P24B 1JNLL 4P9MH 3DVGA 5SWSA 5GZNC 1B3JA 4JREB 1FO0H 2G60H 1UJTA 3ARFC 5AUMB 5KVEL 4HV8A 3RKDC 3MRMB 5BOZG 4K3HA 3DSNA 2YD5A 3C6SA 1CT8A 5CSZB 2Y36H 5I16A 5ELIA 2GAZB 2NW3A 3KGRA 5C09A 5MEND 1Q0YH 4HUVA 3TNMB 1AKJB 4IOIA 5DD5L 3DX6B 1I9RH 3ARBC 5F1KC 1SYVA 1KB5H 2XIDA 3VFVB 4P2QE 1HHGA 4FZ8L 4RBPH 1Z9SA 3LQMA 1HHKA 4YDLC 3VH8B 4H25B 4U05A 1J0KA 3KYOB 5DJYB 1CBVL 2V7NB 1MHHA 2VZ1A 3P9LB 3O4OC 3ARUA 2R0KL 4POUB 3N50A 2H9GB 4X9BA 2X4QA 3PWVA 3KPQB 4RGMC 5FUOH 2GJ6A 3HRZA 1MQKH 2GSGA 3F6IA 4Y4KA 2NZ9C 3ARDB 4WU5A 2CLZB 4JFXA 2ED7A 5SX4I 1I85A 4IRJA 1Q9KB 4XC1H 3PNWB 1OARH 1PJ9A 3O2VH 4TNWK 1XEDA 4PLKD 3G5VB 3BQUA 1J0ZA 1Z9LA 5C70A 3LEVH 3BT2L 4JQXC 5JORB 1A3LL 3IKCA 5E00A 2CIKB 2VXSH 2ZCKL 3O3AB 5KS9E 3QWOB 4NZRH 4OBRA 5I6XC 2KKQA 4LLWB 2IH1A 3KJ4B 5T1KD 2V2TB 2JF1A 3JV4B 4PRHD 5GHWH 1F90L 4K7FA 4M1CD 4RNRB 1E4XH 1IGMH 1MIML 2H3NB 3MR9A 4D8PB 4C54A 7CGTA 3RL1A 3EYVA 4PG2A 1HKLH 1OF2A 5TFSH 2N4IA 5EN2B 5CS7A 1HIMH 5DJ0A 3QZWG 5EC2B 1MCFA 4UZGA 4XNUH 5L2KA 3V6OC 1G6RB 3VGBA 1XIWA 3PP3K 4QNPE 1BPVA 3OGCA 3AU1A 5EA0L 1D5MB 2ENSA 3W82A 2V5MA 1M05A 4FQJH 4YE4H 4OTXL 3TNMA 2DB8A 4BM7A 2DQCH 2EDHA 1MFDH 1OD7A 4LIQH 4X6FB 2GW5A 5IKCA 1D9KD 2EZ0C 5EIIA 3DMMC 3HE7A 1PZ5A 3DVNA 4YDKL 2YD6A 4G3YH 1NBQA 4HKBA 3LEXB 3RWJA 5F97E 5IT2H 4BSVB 1NH6A 1PG7H 5INDB 4D9QE 3RWFA 2DQJH 1NMCB 2OJZH 15C8H 4YAQA 3BE1L 1EFXA 4HUUB 1EJOL 2FX9H 2QHRL 3FO2A 1U8HB 1R3JA 2P5EB 4NQDE 3NIFE 1NC2D 2FJFA 2HT4D 4IJ3C 3RJDA 3UZEA 1WFTA 1EEZB 2P7TA 4H0HB 2CIIA 4BFIA 4UOW1 2R15A 3CK0L 1F3RB 2YBRB 2WUBH 4HIIB 5JW4M 4NJAH 3KYKL 3MV7D 3KXFE 4MLIA 3L3KA 3TH4T 3U4BL 1UZ6E 4UAOC 2QEJA 4ZYKA 4LBEB 3CSYB 4Y5YC 3BXNB 5CIPH 3D0LB 5DC9B 3S4SB 4XVUD 3SDXB 5EZOH 4K8RL 2BVTA 3KLHD 3V7AE 3KPRA 5C0IA 3WYRA 3I9GH 1UA6H 3N1GC 3S96B 1H8OA 4NBYB 1RQ5A 3CXHK 2FBOJ 5CEXA 1T0MA 4NNPH 3IU3A 4CU7A 3WIIH 2FO1A 5D8JL 1OCWH 1JTTA 4PLNC 2G9HA 4LDEB 4D8PA 3ESUF 4X6CF 4P4KC 1KB9J 4QNPF 4OI7A 2CKBB 1UCBL 2DI8A 2WUBL 1BQUA 4LVOC 3T3MF 3IU4H 3MLVL 4PGBA 2OK0L 4NQCA 3UTTA 3TO4C 2AS5M 3BH9A 4PJEF 1NL0L 1FVDB 3BO8A 3E6FB 5BJTB 1AQDA 4LSUL 5ESAA 4XXCC 4Z7WB 4I0PC 2CKBL 1RVFH 4NWUL 1NCTA 3QUXC 1MH5A 5CWSA 3RUGE 1JMXA 3IS0X 4XB8A 2F54A 5GGQH 5C0FB 4U6YA 1U93B 1A9EA 2VLRE 3H3BC 4YDKH 4GXUM 3JWOC 3QCUL 4NT6B 1FLRH 1GGBL 1OAKL 5E8OB 4K2UH 4JM2D 1KUMA 4ORZC 3SBWC 4XP1H 1LE9A 2VXUL 3LKRA 3CH8A 1KCLA 5BOPA 1J1PL 3B2VH 4ALAL 3SEPA 2W9LA 1CGYA 4F7TA 2P5WB 4W68A 5T1DL 3OWEA 4IS6B 5GISH 4P5TB 4X80L 3FB8A 4HK0A 3WL9B 4S0SD 2QJDA 4O02L 4IRZL 4E41D 2JB5L 4BZ1H 1LP9E 1I85C 4IRJC 2ZG2A 1FORL 1P2CA 1EBPA 2H2SD 3PG2A 3NZHL 3TO2B 4YHLL 4RNRA 2DBJA 1VFOA 4O5LL 1S9XB 2BC4B 4NNPL 1C7SA 2UUDK 3IJSA 3MJ9A 2JELL 3VA2C 3VXOB 1A6UH 3EAKA 3U1SH 5A2JH 4QF1B 3BPNC 3TBWB 5FF6A 3OPZH 3QPQC 1RIUL 5T5FL 1B6UA 1F6AA 3OSKA 3SKJL 2R2HA 4I3GA 1GH7A 2B0SL 1NC2B 3PWPB 2M26A 2VOTA 3PV6A 2DQIH 4JHWH 2QQNL 4JANB 2BSSB 3VI3E 3FONB 5I76A 2X42A 4G8GB 2NY1C 3QPXL 4PJDB 4X80H 1DBJL 3ULVC 1KIPB 1T20B 3NGBC 3CCHA 1NLBH 4P2OD 4GRWB 2JJWA 4NWTL 5GRVL 4C4KO 2X4SA 2YUVA 1CF8L 3IDGA 5EO1A 4ORGA 2X1QA 4MJIB 1AGDA 5IMKB 1NFIA 3QEUA 4IIQB 1PY4A 2W91A 1J88A 1VDGA 4NO5A 2HMIC 3EYUH 1XIWC 2RCSL 5IW1A 2APTA 5BZDA 5D6DC 4PRHE 1K4CA 1AE6H 4CVXA 2EICA 1F97A 4AEEA 2L4OA 4K3DH 3FT4B 4UAOB 1J10A 3NA9H 3SE3A 2AI0H 1BWWA 4U1LB 3VG0H 3UYPA 2ED8A 2H32A 2VZOA 5D8JH 4PJHA 1QHPA 3UTZA 3V79C 1IGJB 4NN6C 5F7DB 1FBIL 1DR9A 3NFPB 3UZVB 2HP4A 4HBCH 2VDPL 1HQ4A 1NGWA 4ACPA 5J13C 3MLZL 3OF6A 2ORBH 3DSFH 3TVMC 2HJLA 3QDGA 2HKHH 1CFBA 4OB5H 4C57C 2J5LC 5EO0B 1QRNA 1FORH 1I1FA 3ZDXF 4BZ1L 3O2WL 4RISL 3SHSA 1B9ZA 4GRLB 3EGSA 1MOEA 3DETC 4RWYL 4TOYL 5JQ6H 4X7CC 1P2CB 1R3HB 4PJDF 4LPWA 5C0CE 5D2LE 4YDVA 1I1YA 2YMXL 1LP9B 2CGRL 3ARWA 1IQWL 1FIGH 3OZ9L 5E8EA 1I1AC 4YHNA 1VFBA 1KJ2H 2HTKD 3BHBA 5BVPL 1FLTX 3HI1B 4ONFH 4PV8A 5FXCH 2GTWA 3EDJA 5JUEH 3L3HB 4HGWB 3RY4A 4L5FL 5KOMC 1ZAGA 5IHZA 2E5EA 4U1MB 2AJ3A 4JCMA 4A6YH 3VRJB 3LEYL 2NY1D 3PGDB 4Y19D 2YD3A 4LIQE 5E70A 2VDLH 3VFTB 3QRFM 4P2QA 3TCLB 1MI5D 2XKSA 4H0GA 2AQ3A 4KUZL 5GHWL 3T4YA 1X44A 1RAMA 2Y4SA 3MACL 2Z35A 1DL7L 1TFHA 1C5BL 4L3ED 4OSUH 4D3CH 2UYLA 2A6KA 3ZHDA 2NYYC 3LS4H 3T3PF 2NY5H 4YHPB 3FO0L 5D5MA 1JNNH 2NY0D 4QRTA 4LOUC 5TF1L 5BW7A 1JZ5A 4QWWD 4E41E 4F7MB 5SX5K 5F9AC 3MOQA 3L5XH 4N5UA 3WLWD 1DEEB 4XXCA 2AJSH 4OZHE 4I0PA 5EOQL 1DQMH 2VR9A 1KBGH 5SV4A 3MFFB 4ZPVA 4MNHA 4MCYB 5DRXA 3CFJB 1AQDB 2Z4QB 3ZDZF 3UTSE 3ULVH 2APBA 2CSPA 1X4ZA 5CEYB 4Y4FA 2KDGA 3L3GB 1MFDL 2DM4A 2EYTB 1OHQA 2VLJB 2VQTA 1OAZH 4CADB 1WV7T 5D2NA 5HVWA 1UB5B 2R0LL 4O51B 3ES6B 2D03L 2E8ZA 2AP2A 5C3LD 1IGFH 4MNQA 1N3NA 1U8MB 5BRZD 4ONOA 4KWUA 4GBXD 2OTUB 4MCZA 4RGOL 1PX4A 3HC3L 4JFPA 4Q9RH 4KDWA 4OZFH 1F45A 3KPLB 1QFWM 2E9JA 3NCYP 1I7UB 2ICES 1Y0LA 2VC2H 4N1EA 4Y1AB 3GSOB 5DGRA 2OI9C 2R1XB 1KTRL 3H9ZA 2FR4A 3B2UD 1F4AA 1Q0YL 4FQIL 5K59E 2VISA 1DJSA 3KHQA 4YXLL 2F15A 4JO4H 5L2KE 4OFYA 2J6EH 4YDVB 4J7RA 3UYRL 2RFXB 3EOYG 3EYVB 5J1SC 5MHSD 3A6BL 5CBAA 1T83A 3OB0H 5I2IA 3TN0C 5IJKC 1CVRA 1C1EH 1IKFH 2AV1A 3QQ3B 2D7TH 4QHNA 5INCA 3CFDA 1I3RA 1ZSDB 1SJXA 4Q2ZA 5D7LD 3P4OA 1U58B 3C5ZA 1DE4A 4IRSB 4S1DD 2IAMC 3G6JE 3QDJD 3UO1H 1QO3B 1IEAA 3FRUB 1LHZA 2XZAL 4G43B 3QUXB 4AT6B 2RHEA 4LSSL 5C86A 2ESVA 4FFZH 5EUOA 5ALCL 3LB6D 3SE4A 3UTQB 4GG6B 3GMLB 4WTWA 1VERA 3CLEH 1U8NA 4M7JL 3QUMB 4LASH 4R97B 4QRQB 4TYUA 3LKOA 4TVPD 1ZGLB 5DR5L 2DQGH 1BGXH 3JVGC 1CDCA 2R1WB 5BZDB 5L9DH 2NXZC 3QB7C 2BNQA 4B0MM 1I3UA 4I77L 3MRGB 3QFJE 2W65A 3BH8B 4EQ2A 3FKUS 3ETBF 2IBBA 3O3EB 5KVGH 2G75A 1P6FA 4OV5B 1BBJA 3P4LA 4XBEH 5K9JL 1T89C 1YEEL 5IBTL 2C3VA 4M3JA 4M7ZC 1S9YB 2MCG1 1S7SB 3DX6A 3B3IA 1ZHKB 1I9RL 1JZ4A 4P3WA 1E4XL 2NY5C 4IDLA 1T2QH 5IJVA 3VFOA 1AGEA 1LO4H 4UT6H 4KRPB 4PJCA 1DQTA 2SEBB 1UXWA 2HYMA 3PGFH 1KV3A 1NDMB 2L7JA 4NUJA 3LKSA 5H94A 3MRBA 4AIOA 3MYZA 4N0RA 1CLCA 3IJYA 5LAXA 1CGSL 3RWDB 2AEPH 4BA8A 2EYRA 3AREC 2UUDH 1DLHB 3V52L 3WSQL 3VCLA 1FZOA 4P9ML 5IQ7H 4M7KH 1X6NA 2GIYA 2J1KA 3JWNC 1BAFL 2I27N 2Y72A 3GSNL 3WNLA 2V2WB 1A9BB 4MNGB 4S1SH 5DQ9A 4OCYH 2KPNA 1M6OB 2N1KA 3V0WL 2HWZH 1LVEA 1NGWB 3ZDYF 2X1PA 3LN5A 2XKNA 3MRDA 1KGCD 2ATKB 4OCWL 5EBWB 3PWJB 4KJQC 4YIQA 5L8JB 1MRDH 3E6FA 5F7MC 2WQ8A 3BRGC 2DS4A 1F58H 3S3JA 1JK8A 3NCFB 1N59A 4M5YL 4KK9D 1G7JB 4FTVA 3REWA 1A7PH 3KWWB 3HE6B 1JWSA 5C08D 5GS1B 3X3GH 4HMDA 1T1ZB 3QNYA 1T5XA 3U36A 2BVYA 2VC2L 2KQNA 4OLYH 4UT7L 5I8KL 3GRWH 1N4XL 1GC1H 2B4CC 1QSED 3WFEH 3ULUE 4GW1A 3MUGB 4MSWB 4M6NL 4JO3L 3AS0A 2PR4L 2BVQB 4R90H 4N68A 3ZT5A 5DZNA 1WUNT 3FT2A 3F62A 5F7KC 4PLJC 3UAJC 3ZMRA 1NAMH 3MGAA 4P2RB 5HDBE 4S1QL 4FQJL 3TFKC 4GMSL 4ELMB 4TQEL 1L9NA 5LCVL 4NN7B 2BNUB 3VWKD 1K5NA 1JF1B 3D87B 4LLAA 2IQAA 5K93A 1RJYA 3TIDB 3MA7B 1N7ML 1PEZA 2FX8L 1T2QL 4ODTL 2HG5A 3LPFA 4PJ7F 4FQXD 2FGWH 1MLBA 4QHKJ 4OF6A 4IEFB 3L1OH 1N0LA 2WQRA 2ZG3A 4BH7B 1ZS8B 3DARA 1E4WL 5HPMB 3NZHH 3VD5A 4A2MA 4HFWA 2MSPA 3I84A 5EU6B 1GSMA 2Z8WC 4KQ4H 4WI4A 1T0NB 3H0TA 5CEYA 3KPMA 4W4OC 4LU5H 3MJ9L 1U8KB 3REVB 1MFNA 3H42L 1SBSL 4HIHB 4JFDB 3FOLA 3NACH 2AK4B 4AJ0A 4RRPG 4XCNB 4NQEA 4Q58C 1MAML 1S9VB 5FM4A 3NCEB 3HUJE 5DD3H 5KVFL 3GBNH 2Y5TA 3QH3A 5FK9A 5ESVA 1Q72H 4ELKB 3WCYA 1WZ1H 2BHYA 2BSSA 3L3OB 4JZNA 3QWRD 5I0DA 1J1OL 3HMWH 1V7NH 3MRHA 3LDBC 3B43A 4XAKD 1CGWA 3LV3A 3FT3B 4Y1AA 1HILA 1NEZG 3O4LA 3BW9B 4LSQL 4OLXL 2F5BL 4XPTL 2M8XA 2FYYA 1KJMA 3VD9A 2DQFA 4DKFL 2IQ9L 4FFVC 3L7FB 3LS5H 1WZKA 3P11H 4D2NA 3PGDA 1VHPA 1Q8MA 3LPWA 3MV8D 3HC0A 2EEAA 4JREC 1QRNE 2F58L 3UBXI 2O5YL 3TT3L 3DXAA 1XGUA 2Q86B 1N0XL 3MRCB 3BIKB 5J0BA 3RVXC 4POZD 4MNGE 2VDPH 2OL3B 2NMSA 3ULVE 4KJPD 4U33A 3LVEA 5EFIA 4D3CL 3JVGA 2F74B 5HHQB 1ZLVH 4JO4L 32C2A 1FO0A 3SO3B 4CBPA 3PP3H 4KROD 4IIQC 4ZUVB 3TP4A 1VFAB 3BPLB 2G60L 3IAQA 4M1DL 5BV7B 1HHKB 2OR8A 4M1GH 4HUXB 4NT6A 3LY6A 3HE7D 2AK1L 1G6RA 1NANI 3PXJA 3QEHA 5FFLA 4QRPB 2IMNA 5DQJB 5GPRA 3QCVL 2WW8A 1CL7H 1EZVX 5D72L 4YNYA 3O3DA 1X5LA 3KYNB 4PJ5E 3V95A 4Y16B 3L3JA 1U91A 1HHGB 2Q87A 1JV5B 5DJ8A 1FG2B 1OAZL 3K46A 4HLJA 5A43C 1JHKL 4OCNC 3BUYA 5JR1H 2Q7YB 3WNKA 2FJGB 4NHCL 4OZ4A 4PRID 4L1DA 4ZUTA 2GTWB 4O00A 4U2ZA 2MHAA 4U49A 1RSFA 5JORA 2NY4C 3HMXL 3VRJA 5FOBA 2EIEA 2JB6A 2R0ZL 4S2SB 2BJMH 3U46A 4QXGL 1I1RA 1PKOA 2I9LA 3TBSA 2VLME 4WI7A 4GW4B 4LPTA 4UIKL 3ZL4L 5FDWA 1HH6A 2YUXA 4PGEB 2EYRB 4M6OH 1HILB 1A7BA 4BFIB 4K2UL 2DTSA 3DMMA 3HE7C 3MXVH 4X6DB 4R4FL 1RIVH 4CKVX 4PFEA 1T2XA 1NUDA 4KMQA 3RAJH 4Z7VB 3A6BH 1X5YA 1OB1B 1OTUD 4AIZA 1DBML 2Y07H 1QNZL 5HHME 5C6TH 5I66B 3CSYA 1JE6A 2Q8AH 2J12B 1KIRA 1CDIA 4OGXL 3HG1D 2XZCH 4LP4A 4MNQE 2NLJB 3O9WD 2AEQH 1FCCA 5DMIH 4FXKA 3QJHB 3DECA 3QQ4A 1A3RL 2DL9A 1NLBL 4LAQL 5E0QA 5F8QC 3U9PL 4R4ND 3ZE2F 4JZJB 4OI9A 1N3NB 5IVOA 2GUOA 2NX5A 2WIMA 4RZCA 3MV8A 3D85D 5KN5B 5DHXB 3LHPL 3DVNB 3V6ZA 2G75B 3W2DL 1YUHB 3IFLH 4LCWA 3ILQC 1AFVH 3BP5A 4JPVH 2CDFA 43CAB 3U7WL 3RAJL 1FJ1A 5IEKA 3HFML 5AZ2L 4QO1A 5IG7B 3FQNA 2J2ZA 4CVWA 4X5WB 1R5IB 4JGJA 3VXPA 3P0VL 3U9UA 5I73C 2BHUA 2DMBA 4K8RD 1MUJB 4POYA 1T22B 3I02A 1URLA 1FBIH 4F9PA 4IM8A 2EDFA 5MENA 5DUBB 1IGTA 2W38A 1UJ3C 3IJHB 3SDAB 4P4KA 2DLGA 4RIRA 5EBMA 4HAFA 5INDA 5MEQA 5KSAA 2DYPB 4N90D 5HDOA 3VMNA 1EVTC 4GG8B 3PWPD 1PVHA 5CHNB 1PSKH 2CLRB 1PY9A 1I8IB 3QIBC 4G42B 4GAGH 4NGHL 5KSVB 1DLHA 4JM2C 4UQ3A 2NY6D 4DKEL 5I30H 3QI9C 2AJYH 4HXBL 2IPTL 1AFVL 3QUXA 2HLFD 4NQCD 3HAEG 2GT9A 2C9AA 5HYEA 1W0VB 4G9DA 5ABDE 3V0WH 1G7PB 1J8HD 4HC1H 3MR9B 5DURB 2XWBA 3TJEL 3BEVB 3QDJE 4GFTB 5TH2A 5EN2A 3MRDB 3V7MA 1KULA 1PYWA 5DJAA 1F3DJ 1B0WA 4XI5D 5HHNA 3GI8H 3TYFA 1E4KC 1HHIA 3FRPG 4DVBA 2VDNL 4WFED 5CKGA 1CLOH 2VIRB 1TJIL 4HJJH 5DK2B 1YQVL 3GNML 5E7BA 2IG2H 3ZZ1A 3D18B 4L8DA 1N8ZA 4P46B 1TJHL 3T2PA 1A3RH 5LKNA 1NMCC 3F5WB 4LHUB 4NKOB 2WZPD 4ONGL 5MERB 4K23H 3VWJC 1KXVC 1ZV5A 1KCRL 1G9NL 2W9EL 1BFOA 5MP6H 1NL0H 3DYMA 5DHVA 3WLBB 4F15B 5DTFB 5GRJH 3IDMA 2WLZA 4Q0XH 2DWEB 1HWGB 3C60C 3VRIB 3IRPX 2W9DL 1GXEA 12E8H 2YSSA 2EH8H 2YPVL 3O6ML 3T0EA 5C0AB 2DJUA 3D2UD 5D6CA 4ZOCA 5EU7C 3VGAB 1P7HL 3FO9A 4XPGL 1LO3L 4GMSH 4R4NC 2ADIA 1QBMH 2ADFL 3ARZA 5E94B 3MOAH 1EEYB 1AGDB 5IMKA 2IALB 3WUWA 1WIUA 4NZUH 2X2YA 1H3GA 2CO6B 2CRIA 4ZMAT 5SWQB 1MREH 3TGXA 1N6VA 3LN5B 3RBSA 4QYOB 1NCWH 3SOBL 4XP1L 2ZUXA 4YK4B 3VXMD 2MJWA 3DUSB 5DYOA 2R2EB 5IQ9A 4Z7QF 3WE6B 4DVRH 4NKIH 4L8CB 1X5XA 1PDKA 5GRUH 1IILE 1YEJL 5C0AE 2H45A 4GAGL 5J1AB 1P4LB 4GQPH 1LE5B 4NBZB 1Z3GL 4QT5B 3FN0H 5J1TC 3PJSA 1IC5L 5E99H 3F12A 3ARRA 2BXZA 3CDGB 3AXLB 3FQWB 2DQEL 4H26B 4Y5VB 2PO6B 4Y4HB 4RFNC 4UV4H 4LPVA 1NMBH 3DX7A 1OL0A 2QR0A 4NZRL 3O6LL 1NBYA 3IFNL 4QTHB 3BH9B 4DUVA 5T33L 5FHBL 1GOHA 4JLRA 1ZHLA 3FB6A 4CNIB 5C6WH 4IHOA 5B22A 3QUKA 3E3QC 3NABL 1U8OB 5ITFB 4YDIL 4G43A 5GS0D 1T5WB 2H26B 4JFFE 4R0LA 4H1LH 4ZUSA 5J8OA 3SKMA 3P11L 4Z6AT 2IQAB 1IAIL 4YO0B 3BGFC 3OKKB 2Q76A 2OP4L 5CGTA 3QFDA 2H2PD 1KIQB 4NQEE 5IHUH 2C3WA 1E4XI 5CLTA 5T5NF 2EDJA 1DEDA 3VRLF 1QBLH 4KKBC 1JMZA 1A0QL 2WP3T 1J9CT 3NFSL 2OL3A 2VZUA 4KVCL 4RA0C 3WFHA 3GJEB 1RZKL 1G0DA 1U8PA 5EB9A 5D93B 1RJLB 4MA8L 5FYLL 2R2BA 4XCCH 5JDSB 1VEMA 2E8YA 4TTDC 1Y18A 4PJ8C 2YOCA 1UWGL 5MEQB 2BVPB 1RK0A 1QSFB 1JI2A 4JN1L 1TIUA 4HUXA 1G6RL 3NH7H 4XBGA 5FO7B 2R69L 3UP1A 1FHGA 4YQXL 3RWFB 2ED9A 2RGSA 1JPSH 5DS8B 3V6FA 4TULH 2Y25A 5I8KH 2P5EA 1NANH 3BE1H 4U1NB 5HYJE 3GK8H 3X12B 4I0PB 4M48H 5T1KB 5LGJA 3E0GA 4X6EA 4PREB 4RFOH 3CLEL 4RMVA 3HI6H 1UWEL 5IWLC 4BQ6A 4KVNL 3IGAB 4GOSA 4DW2H 3NOIA 4L4VE 4TSCH 2BVEA 1MY5A 4R96B 3CSPA 3NFSH 5HDBF 3TPUA 1A1MB 4P4KB 5E08H 4DCQA 1P84J 5CJQL 1X5KA 3NIGF 2BMKA 2EDKA 4KDTC 4L3EA 5CMAA 2PW1A 1A02N 1IFHL 2Q8BH 1EV2E 5A16B 3D0LA 1BFSA 1P5VA 3GMPA 3VI3F 4CVZB 5MI0C 4OCXH 4XHJC 3QYCA 1J0JA 3I9GL 3BN9C 4OZIF 1RHHA 1I1YB 1MCIA 1WBYA 2I07B 3NABH 2ICWJ 4WO4A 4TVPL 5F3HA 5I1DB 2C4FT 2VAAB 3V5DA 4A6YB 1UENA 1J1XL 1OW0C 5JXED 3O3BB 4OKDA 1U6AL 2B39A 2Z92A 3IDIB 4MNQD 3VRLE 4LCWD 4OCSH 4QWWC 1F90H 1KJ2B 3TFKD 3PABA 3MRKA 4C4KT 1IC4L 3MJ8B 4ODVL 3UTPD 5H35A 4JO3H 3RTQC 4K94C 1DQQB 4OD1L 2ZPKH 1JRHL 4JPIB 5KG9B 3T0WA 4LEXH 1GC1L 4LRNH 3UBXG 4BYHA 3AAZA 2YSSB 1VEPA 3O9WC 1RURH 3CXDH 5DQDL 4OQ1A 1L6ZA 1CD1B 3CFKA 4X83A 5HYJA 3X11B 1NCCL 2NW3B 4PD4J 3GMMA 5ADPH 4GLRH 1UWXK 2ZG1A 3ALWA 3P4NB 4KHXL 3CFJA 4YR6B 1A3QA 3HG1A 2FO4A 3MOBH 5I1AA 4IRSC 5TE7H 1CICD 4IOIB 1U8NB 4PB0H 3NFPA 2G5BB 1BX2A 1MJ7L 2NX5B 4RZCB 3MREA 3UX9B 1K2DB 2W1NA 7FABH 4MXWL 1LK2B 5E6ZA 3VXRB 5I9QC 4NQCE 5E4EC 5ALBL 4ZQKB 4YHIA 2EDQA 3SKOB 5CEZE 1FAKT 5EU3B 3MJGX 1G7LB 1CXHA 1P69B 2C7UA 3W9EA 4G8EB 3ARGA 1KJ3L 4NO0A 1QSEA 1A1OA 1DVFC 3PHQA 3WE6A 5HVGB 3SDXE 4OD1H 3MBED 5IB1A 1MPAL 3MPCA 4JDVA 3FHQA 2J88H 5A3IC 4LKCB 4YFLF 1TLKA 5HDLA 4Z7UE 5C0BE 3CUPB 5KZCD 3CH1A 2P5WD 3ZYZA 2ZCHL 3HE6D 5HGHA 5E5UB 4J8RA 3B3IB 4LSPH 4PJ5D 3PDOA 3UJTL 3HI5L 3RZCD 1L0YA 1V7MH 3EJZC 1SBSH 5FYKH 2RFXA 4B41A 3HC3H 3GIVA 1S9VA 1RUML 4M62H 5C07B 2DIBA 5CMAB 2Q20A 3UDWC 4RMRA 5E4IA 4QRPE 5KVGL 1T1WA 2OTPA 5EZLA 2JIXB 4AH2B 3R4DA 3CSBA 4G9DB 3KJ4C 1TJHH 1MCHA 3T65A 2B5IB 4YXLH 3EHBC 5BO1H 1PZUB 1BLNB 1FL5A 1DVFB 4ISVA 5CBAB 5EOCL 2P42B 3QFDB 1Q9WA 3L6FB 2VDMH 2EYSA 2VXSL 4PY7A 1NC2A 1ED3B 1TJGH 2ZCHH 5E4EB 2AJSL 1JHTB 4ODUA 1UWEH 4P2YA 1P84K 3B2VL 1I8LA 1J1PH 5IROC 3VFMB 4M8QB 2VL4A 3RWGB 3V5HA 4L4VB 3D18A 4P46A 4TRPH 1AGBB 4P2OC 5IEKB 5J3HC 3AAZB 1K4DA 1Q9LB 2D0GA 5T5NG 1VESA 4NKOA 4JPWH 4XGZA 4L4TD 4NFBA 2R2BB 1M05B 2DBLL 2FDBP 4L3CA 5CJ5A 2R0KH 2C3VB 5C08E 4NQDD 2GTZB 4YFDB 4K7PL 4PRPD 2X4PA 4Y8AA 5DTFA 4P5TD 3PV7A 3P77A 4DN3L 5FKPB 1I1AB 2NNAA 5HHPB 3MNZA 5CHNA 4JJ5B 1CT8B 5SX4H 1F11B 4ODHL 3BD4A 3VXQA 5JO5B 3QIUA 3PHQB 1OAUL 4OLZL 4CUCA 5E94A 1BD2A 5C6PB 3B8SA 3BWUC 5TE6H 2FJFB 3DURA 5D1ZD 4P5MB 5GS3A 2V5RA 2E7MA 1CD8A 2Z0BA 3I6GB 5AZEL 4OF5A 3GMQA 2VDNH 4L1HA 1E4JA 1S3KH 5H2BA 5FO7A 3O2WH 3O3AA 4UU9A 1BM3H 4JAMB 4NZJA 2GSIB 4OB5L 1ZSDA 2R9HC 4YBQD 3G6JF 3EGSB 2HTLD 1LO5B 1AR1D 2XN9B 1CD9B 1U8JB 5IW6A 2EE3A 2J8UB 5LGJB 3S7GA 3RY6A 1DQML 4YHYB 5EUOB 1KJVA 4LLDA 5B4MC 4PYHA 5DT1H 5JQHC 1CYGA 2ITDB 5EBLB 1MCCA 4QRUA 4BUGA 4PS4L 1YEDA 4TUOA 4XWOD 1PGRB 1KCUH 2AK4A 3P0YL 1LEGA 3QZWA 1YPZB 5GS1A 3ZHLA 5JW3L 4P4RB 4YWGH 3ROOA 4BK4A 3LH2H 3QRGL 3AB0C 3HC4H 1AR2A 4CU8A 1TETL 4GRWF 1N2RA 1SY6L 3HPLA 3PF2A 3UCRA 3V0VB 5K9QG 1YA5A 1LD9B 4M93B 3SDCD 1YECH 1OTTD 3QEGH 1V05A 4TVSa 4UNUA 1UQSB 1S7XB 2NW2A 3HAEA 1CDUA 4OJFH 1FDLL 4JFYB 3RPKA 3LS4L 4NKMB 4K7FB 4A2LA 3PGCA 3FFDA 1MJ8L 1J05A 1UEMA 4HUWB 3EYOB 4TUKL 4MQSB 3ROLB 4JFZL 2X6MA 4HV8B 2JTDA 3E6HA 1H3VA 1CDJA 5IOPA 1DEEA 2C7UB 3FRPA 5B39A 5SWZB 4Z7WE 2Z31B 2F53A 3FO2B 4TOYH 1L0QA 3OX8A 3RA7H 2Q86A 3OB8A 4WI8A 3FMGL 1LO0L 1VENA 5DMGC 4OFVA 4OQTA 5I0ZA 1T20A 1CD1A 1DFBL 4ZOAA 2EDWA 1YJDL 3DXAE 3GSNA 3WO4C 2YK1H 3VXQB 1RVFL 4NWUH 4MA7L 3BMVA 4HKXB 3T04D 3WN5C 2DQTH 4O58H 5D2LF 1WC7B 2D2OA 4O4YH 1NFDE 4N0FA 5D2NE 5HI5D 3RFZC 2HN7B 2MQ3A 2W60B 3MJ7A 4QHMA 5CD3A 3FQWA 1MIMH 1U8LB 4L4VD 1CFTB 5CUSL 5E9DA 1QNZH 2VRAA 4UOJA 3U0TA 2C4FU 1B6DA 3P9LA 4P5TC 4HIHA 3BDYH 2DIAA 2PN5A 4FQ2H 1F4HA 3RGHA 4KTEH 4XPAL 3DETD 3U2SA 2FWOB 4YDIH 3UXFA 5EU6D 1ONQA 2BRRH 1D6VL 3DV6A 3WL9A 2JIXA 1CN4A 1SM3H 2CLZA 4JFXB 4X6DF 4O2EB 4HUMB 4NYLB 3TVMD 2OBGA 4C59B 1WZLA 1JPST 1QP1A 1U8QA 3T8XA 5IMMB 2FIKB 1QLFA 1QR4A 1RZGA 5CZKA 1XCTB 2P7TB 2BOCB 3FT3A 4V2BA 5EORH 1EBAA 5BS0E 3GKWH 3ZKQD 2BY2A 4LCCB 1HXMA 3TJEH 5KJRL 4QF1A 5FK9B 1MCSA 5CJXC 5AG9A 1Z0NA 3IKKA 2R2CA 2A73A 1H8NA 3RWGA 1A7RH 3EUUA 2Y9RT 1YEKL 2UZYB 4HD9A 4OLEA 1FCGA 1WWCA 5C3TA 3S88H 4I48A 4R2GD 3KLDA 4YUEL 4F15C 1R3HA 1INEH 1KTDB 4LP5A 4GG6A 2RJMA 1XF1A 3FQRB 2H6PA 2IH3A 3QSKB 3T77B 5T1LA 4EOWL 1TENA 3D0VA 3E3QE 1BLNA 5D7KE 2VQ1A 5IB2B 3QUZD 5E8NB 3SE8L 3MUJA 1A4KA 2EIDA 1D9KA 2X89A 3EJZD 1LMKA 4DAGH 4X0KB 1KTKE 1VFMA 3EYOA 3G6DL 1GZQB 3GZKA 4JPIA 4K3JL 4P46C 4HWZB 5KG9A 4Y5XB 3ULVD 2QQNH 5IBUG 4O5LH 3F58H 3AUVA 4XNMA 1SVCP 1YEIL 1D5IH 1D5MA 3CFKB 4FQQB 4M1CC 3LKRB 3H9SD 1UYWH 1ES0A 4W70A 1MVUB 1REIA 3LRSA 4KKNA 4KV5E 4GQ9H 2K3TA 5ESAB 3UBXB 3WFBL 2P5WA 2Z35B 4DEPB 3H9SA 1B4JH 5KSBB 4Y16A 3IVKB 3IDJB 2CUHA 3TV3H 1LDPL 3QISA 1DBAH 1H3UA 3QNXA 4M9PA 4NJ9H 5FUCC 3FOLB 3LN9A 4K9EL 5EOTB 3QRGH 5DMYA 3MUY1 1OAQH 2ADGB 3NA4A 4H8WL 4S0TD 4E42A 2IF7A 3L9RB 4OGYH 2DQDH 5SWQA 3O3DB 1RIHH 3IFPB 1CE6A 3QUML 2YUZA 1U3JA 5E03A 1FP5A 4MDIB 5JQ6L 1QTYT 5J6HA 4UTAL 2NZ9D 4GBXB 5JZ7D 3CK0H 3FCTA 3O45B 4PY8I 2P48B 2IPKA 3IJSB 1RZ7L 3C8DA 4NOBA 4HIIA 5J4MA 1VKXA 4S10A 2OQJA 2WNGA 3W39A 3K0WA 2EXYD 5D2NB 1LP9A 3VMPA 1RPQA 4PJCE 4MA3B 4WUUD 1B4JL 4AZ8A 5F7FA 2XACC 3O41A 4LKXA 4XC3H 3RUGB 4FFVD 4QEGA 3ZL4H 4ZAKA 4CN6A 4LVEA 5C7XH 5DJ2B 3RVUD 4FXGB 3MO1A 4D0DB 3MLTB 1MFEH 3BMWA 3ALXA 3ELAT 3VFTA 4LIQL 3GSVB 1F58L 3BN9D 5HYIA 3ZTJG 3HE6A 4KQ4L 5E56A 2ERJB 4K3EL 1IVLA 5F1NA 3VXME 1JPFA 5EOCJ 1EDQA 2I25N 5HVHB 2D4FA 3NPSB 1EGJL 3JZ7A 1XR9B 3QJFB 3AY4A 1IT9L 1MI5E 4TSBL 3GHEL 4GRMB 3MLYL 1K4CB 4GW1B 3HUJB 1I7RB 4XVJL 3IXTB 4TPRL 4F2MB 4JM2A 3LIZL 4ZS7L 5D7IE 3QI9A 3V0VA 2YC1B 5C0JB 4XNMB 5D2LB 1L7TH 2HKFH 4YNYB 5F1SA 5LCVH 5IR1A 5KVDH 4MNHB 1I8MB 5C0FA 3B6SB 4MS8C 2RQ8A 1CICA 5ENWA 4XI5C 4NNYA 3U4BH 1N5YH 4ZPTA 3HCVA 4PJFB 3EO0B 4ODXB 4IMKC 2EEDA 4N0UA 3PHOB 4XZUA 5GJTH 4PJAA 4F33A 5H8DA 3QIWC 4KGJA 4MJ5A 4AMKL 1HYSC 4NRYA 4LARL 3L5IA 5SWZA 1WAAF 3DO7A 2WM0A 4V1DE 2ICEB 1GPOH 1CZ8H 1P9MA 3TT3H 3DRTA 5D7JC 2EIZA 2IGFL 3LH2L 1T0NA 4DUWA 4PLJD 4PREA 5MENB 2OJZL 2ARJB 3BEWB 4RAVB 1DSFL 2NCMA 3U0PB 5HXMA 1IE5A 4M03A 5C8JA 4P5TA 1PFCA 4X6BB 1OTTC 2APVA 1MNUL 4K9EC 3T2OA 4KRPC 1ULVA 5HD8D 3C5SA 3BEVA 2DM7A 5E08L 1X5ZA 3PHSA 4JPKL 4QOKE 3INUH 4I18C 4M3KB 4MJIE 2PYEE 3G5YA 4P3CH 5BRZB 5IGXH 1IAII 2RBLA 3VXNB 1V7NL 2QLVB 2XZQH 3DHMA 2ZKHH 3CPLB 1FPTL 4EDXB 1NDGA 2IH1B 3MX0A 1YEHL 5D71H 5IB4A 4KJQD 2E7LA 4TNWF 1K3IA 5HPOA 1I9EA 5E2VH 2C26A 3D39E 1GGBH 2H1PL 2VXQH 1AXTH 1FLRL 5EC1A 1IBGL 5CZVL 4OFDA 4P4RA 5CZXC 5E5MB 3IDIA 3ARFB 2NQCA 2Z93A 1IKFL 4X9GA 1GZQA 1H5BB 2MPAH 4HQQH 3WD5L 3OR7A 4NOFA 3CDFA 2HJKB 5GIRB 5I16B 3NCJH 3WLBA 3A67L 1YECL 1F11A 4J4PA 4QTIH 2APXA 2GK0A 5I1HH 1HINL 3BD5A 3QUKB 4U6VL 4JN2B 1NCCH 4PB9H 3QXDB 4Y4FB 3KYAA 2CK0H 2GITA 4H1LG 4OBSA 5KS9B 4ONHB 4U3HA 1C12A 3CVHH 1D9KC 1MFBH 2EZ0D 4LRIC 2ZSWB 1A3LH 4F9LA 5JHDE 3V8CA 1ADQH 5D4QA 1OAYH 1WAAE 3HB3D 1OAXL 1G9NC 5DDHB 3R8QA 3TF7C 1BJ1J 1FYTA 3HMXA 4GSDL 1TTUA 2FL5B 4NO3B 5T3XL 1ZGLM 2YWYA 1MHPH 1AGEB 4RMWA 1R3IH 3PWNB 2GSGB 5JPNB 2GEEA 4JEGB 3KYNA 4P59H 4KGLA 4LASL 4NO0B 4Q9QL 2JKXA 4QOKD 1XZ0B 4QRSB 2AJUH 3F8UB 3LEVL 4WUKH 2H32B 4PJFF 4M7KL 5DJ8B 4QKXB 4YFLI 3UMTA 3MGOB 1F4WL 1CDGA 2ZSVA 4XVJH 2V9RA 4ZXBB 4MB5A 4Y88A 2WWKO 1IT9H 3QXAA 5FHAL 4G5ZL 3ES6A 3H9SE 1YPZA 5D96C 4G7YL 3QWOA 3KPTA 5DQDH 1N2RB 4KRPD 1KFAH 2W07A 5DJ2A 4JHAL 1RZJH 3GMOB 2VE6B 4XPFL 1YNLL 2YD1A 5GRUL 4ODSL 1RU9L 4JRYA 5EWIL 3T0ED 2H1PH 2VXQL 2W0KA 4JFEA 1CE1H 1HQRB 3BKMH 4PJ8A 4OZIA 5A2KH 2DQJL 3CMGA 3MYJA 2PO6C 4J1UB 2VITB 4PJIE 5CCKL 3C8HA 4CMMB 2HJFA 3W39B 3LKOB 4HKZA 1J05B 5F9DC 3N85H 1XF5B 2MPAL 1YN6A 2K9UA 2CIKA 1QHOA 2ESVE 2B2XL 5CJOL 3RZCA 2X4TB 1YNTB 1XGRA 1TQBB 3MROB 2GYSA 1S5HA 3OKDA 1OGAB 3LN4A 4YE4L 5CAYB 2QADD 1CFVH 4BUHA 1LO3H 2FEEI 2ZUQC 3DGGA 3TBVB 4H1LA 3W5MA 4M6AA 3HZMA 4FXKB 3R0NA 2F8OA 5C0DA 4YDJB 4WI9A 1ACYH 4HCRA 1AO7B 5BS0A 5D7IA 3U0WL 1AXSB 3O3BA 5IVXA 5JXAL 4KDTA 5CP3H 2X70B 2C1PB 4UDUA 3MNWB 4X8XA 3GMNA 1NAKH 5AYUL 2P1YA 2UV3A 3HNTH 3C6SB 1WTLA 3GSUA 3M45A 4J3VA 5FEBA 4E0RB 4N90E 5TDNB 2EKSA 3DYOA 3GK8L 2A83A 5TQ0L 2AJVL 4D9RE 4JRXD 4WO4C 3BKJL 1CICC 4XHJD 1UM4H 1OW0A 4IMKA 3MLUH 5EPMB 1X7QA 4MXQC 3VGAC 5EZIH 1KYOJ 5M95B 2YPLE 1IC7H 2HH0H 4RFEB 4X6BA 3JWDL 4ZFOB 3IFNH 4P9HL 5C2UB 4M7JH 5EU5B 3RTQA 2OTWA 4RGOH 1FZJB 3VWKA 2HLAA 1IZJA 4NSKA 2LTQC 4BSVA 5B39G 3GGWA 4NC0B 2NYYD 3C9NA 5C0CD 4JHAH 1MCPH 4OAWB 4B53A 2FR4B 2JCCE 3MLWL 2UWEE 4IHOB 4JRWA 1IGYA 4WHDA 1FNFA 2YKLH 2YRZA 2F19L 5IMOB 3TBTA 5FM5M 1YMHA 1DZBA 2BMKB 2Q76B 1N26A 3V5KA 1PYWB 1CS6A 2B4CH 3FB7A 5F3BB 1U95B 3ARGC 4HK3N 1LEGB 3MBXH 3V4VL 5DJZA 3EOBB 2EDTA 3SQOL 5HBBA 1F6LL 3UTTD 1DDHA 4HXAH 2ICWB 4GT7A 4U0RB 1INDL 4XNZC 5DUML 4ESKA 3UAJD 3FT2B 5I1GL 2JELH 2GAZA 4H0IA 4Z7WA 1YYMH 4XB7A 5HYSG 2X40A 2FH8A 5MEOA 1RZJC 1AKJA 1ZHBA 3VD3A 4JN1H 2Q3AA 4XHQA 4OT1H 4HIJA 3QCTL 3QHTC 1ZWIA 1ORQA 1YDPA 3TJHC 3FN0L 1RK0B 3QIBB 5J56B 3HG1B 1BEYL 1PKQB 5GSRA 5EU6E 3D25B 4MB4A 4TN9A 2NXZB 2DRUA 3CIQA 5DVOA 3G6JA 3PL6A 3VFGH 1S7VB 1CFQB 2N7BA 1KCRH 5GS0C 4NKDA 1ZVHA 4MJ6B 1W72H 2HVJA 4GXVH 5EU3A 4Z7OE 5ERWB 3GMMB 4JDTH 3FMGH 1UZ8B 4LRIA 3QUYC 4ZFZA 4NNYB 1KCKA 3MZGB 3RA7L 1BX2B 2R0WH 4PTUA 1TZIB 4XVTL 3WUWB 1EA9C 3FQXA 3ZO0A 3ZYJA 4FMFA 3QIWB 4HJJL 4P9HC 3ARYA 5E8PB 3BJLA 3PP4H 3O2DL 4EBQL 5E9DE 4I2XB 1I8LC 3H3KA 5IROA 2HKHL 4ZODA 5T3ZE 5IFAL 3BOVA 2DQUL 4OJFL 1Z5LA 4OZGB 1RZIB 5I18H 3MO1B 4D0DA 1NEZA 3S6CA 1JGLH 1WBYB 2I07A 3RVXD 4OFYD 1YEFH 3SY0A 4HIEB 3RWIA 4F7TB 4LHUD 3H0TB 5C0NC 1OP5H 1IGCH 4RX4D 5DRNA 5E99L 4YXHH 3MRQA 4F7EB 1XF5A 1NGQL 4GJTB 5CZXD 3WNPA 3UPCA 4YHNB 5FV2A 5HVHC 3CX2A 4F58L 2VDKL 3DXAD 1U3HD 4HUKB 1IJ9A 4GS7C 3NMEA 1P7QB 3VGDA 2C5DC 4R7DA 4D9RD 4J12A 4LCWE 3MFGB 2PYFA 2EDYA 3AS1A 3V2AR 3OB0K 5I66A 3WXVH 3TBYA 4YUEH 2E9IA 4PBWD 3HS0A 5D7SL 3LKPB 3L6FA 3V4UL 2VL5A 5DXWA 1CL7I 3ARFA 3KDMB 5T1LB 3RZCC 5IKCB 1JHTA 5FUZH 4P0DA 3HZVA 4YHPA 4MJ5B 1WBXA 3V4PL 5DA0B 1G7HA 1X4YA 3OKNA 5C71A 4HIXL 1IGIH 5HGDA 5CEZH 3H9HA 3LKNB 4WI5A 2VIRA 4X7SL 5EU7E 1RIUH 2E9WA 4XPHH 5T5FH 1KG0B 1F3JB 4UB0H 2AEQL 2PXYD 2W59A 5CSBA 1MFAH 4HLZG 5GGQL 2IPUG 1EO8L 2A9ML 5GRJL 4YK4C 5FCUL 5C09B 2BY0A 1C5DA 4PJHF 3NPSC 2EIBA 4I4WA 5F9JB 2IBZY 2N56A 1J12A 2Y06L 1SYVB 5HGAA 3RVVC 1EH9A 3D39D 3S35H 3U30C 4I2XA 1YEKH 4DEPC 1IC1A 2EH7L 5DFWH 2IBGA 2EE6A 4PRAB 2OR9H 3Q5TA 3I3BA 3OX8B 4C56D 3ARXA 3S37X 1LO5A 5FDWB 3WDIA 5D1ZB 1T7XA 5JW4Q 5D1QD 3QDGE 4G9FE 3RTQD 1UH2A 3B9KD 3MRRB 4JQXA 4NKQB 3RQ3A 3BD3A 1CGTA 1XR8B 1Q9KA 1BZ7B 3B9DA 1SMAA 5L6YL 3KXFD 1FH5H 3GSWB 1M4KA 4OIIH 5T3ZL 3FB8B 1EAPA 1P7QD 4HJGA 5F44A 4JFZH 4AL8H 3THMH 5F8RC 2J8UA 4PGBB 2AJYL 4F8TA 4K8RC 1SY6H 3OAZK 4G9FD 4BK5A 2VE6A 2AJXH 4QHNB 5INCB 3WKMH 4OD3L 4K55A 5GGVH 3VFNB 5GGUA 4MA1C 1TQCC 3TBSB 4OLVH 3SE9H 4WO4B 2PTVA 3D1MC 1ZHBB 5C08A 3ILQD 5SWSD 2B1AH 4ETQA 3ULUC 1HE7A 4WUUA 1NFKA 1QSFE 3DSFL 4H20H 1TVBB 1NCAH 1B0GB 1GZPA 1KPRB 1ORQB 2ZCLL 1TNMA 1KELL 3L7FA 4EI5B 1G7MB 1ND0B 2OS7A 5I8OH 3PGCB 2BFVL 2VABA 1IM9D 3PABB 3PWPA 4L3EE 4ZOBA 4PV8B 2IAND 1KT2B 4Q6YA 5ETUA 1UG9A 1MI5A 4UDTB 2R9HD 3R06B 3ALPA 4U7SA 3SGKA 1NAMA 5AZ2H 4ALAH 2VDRL 1MRCL 2BRQA 1QLRA 3DGGB 3SGJC 3GNMH 3OMZA 3DVFA 2DWEA 2D7MA 1R5WA 2HT4C 2IEPA 4WHCA 4P2OB 1T4KB 3NVQA 5BV7H 5C0AA 1SEBB 1A7OL 3TA3B 2EYTA 1U3HB 2WWMD 1MJ8H 3P9WB 2DLFH 4N0YL 4UV7H 4YHZH 3CFCL 1T66D 1QSVA 1CU4L 3I6GA 1HHJA 4W81A 5GSRB 2VERN 2Z91A 5TF0A 4KK8C 3CLFH 2CKBH 3SQBA 4ETYA 2XZZA 4PD4K 4HKBB 1CL7L 1E28B 2OR9L 2IPTH 3RGVD 3D69B 4XWGL 8FABB 1A8JH 2J8UE 3T4AA 4MGXA 2VO5A 4Z0XA 4GS7B 1IGML 1U91B 4OF8A 4HWBA 4OM0L 3C6LD 2FATH 4I9WD 2XTJB 4OFPA 3TZVD 1MUJA 5CEZL 1GOFA 3WHXB 1IC4H 2P5WE 4O2CB 1XCQA 4D0BB 3WIHH 3BFOA 1JZ3A 3F7YA 1CDBA 3AXLA 1ZT4B 2X4NA 3QEGL 1EO8H 4J3OC 1ZEAL 4HPYL 4LCYA 4OAWA 4GUPA 2RB8A 3SQOH 1N0XH 1D6VH 1BVLA 3DX8A 1R24B 2X1OA 5C07D 3IDNA 4PRBA 2B1AL 4HKJA 4JPVL 3T8XB 5IMMA 5JXAH 1UB6A 1A6AA 1YY8B 4F7CB 4PV9B 3SE9L 5EOCH 1CG9B 3VI4E 2OSLB 2VNCA 4R26H 3RRQA 2J7LA 2JJSC 2P46B 2WBJC 4AEHH 1B0RA 2IMMA 1OB1A 2LV4A 2XN9E 3BAEL 1I3VA 1DFBH 2NY4D 2VDML 1OD9A 5KSUB 4PRIA 3FJTA 5D72H 5GS0L 1TMCB 2ADJA 3V0AC 3C5ZB 4R7NB 1SJEB 5GRXG 5CGYD 2DD8L 3WXWL 5JIPA 1T7ZA 5I1HL 3T2NH 4XGZB 4OQTH 3D6GA 1PKQE 4TQEH 3A67H 1W8NA 4X6CA 4KAQH 1N8ZB 3PXHA 3HS0B 4LHQB 1I7ZA 4FG6C 2VZVA 3ULUH 2KH2B 4XRCA 4Z7UF 1OT2A 2FZ3B 4BSWA 2UZXB 4LNRA 4EIZC 1G6RH 3NH7L 3O2DH 1KCVH 1JBJA 4XNYL 4ZAKC 1WCBA 1NBVL 2VKWA 4M6OL 4WNQA 3TLRA 4M93C 5AAWA 4XCEB 4AQ1B 2MQ0A 1BFTA 3LKNA 5L7XL 2P45B 4UIKH 3BQUD 3TIEA 5C0JA 2DWDA 3NCMA 1BVKB 4X5WA 4X5XA 2VYRE 4ZO7A 3IF1B 3EJYD 5GRYA 4L8CA 4GKOA 4JVPA 4KMTL 4XNUL 2XZAH 5D6CB 4F37K 4FFWC 4OKVB 4D0CA 4L4JA 2P43B 3AY4C 3BESR 3U7YH 3KPMB 4PJXE 1U8MA 3Q5OA 1WTGT 1IAKB 3TPUB 1H8SA 4LOUD 3RL2B 4YHIB 1NAML 2DOCA 1IZKA 5I75C 3UPRA 1U8IB 4HDIA 4N5EC 5LXGH 3P4MA 3SDCA 1A1OB 4JLRB 5CINL 2PW1B 2OXHA 1AHWB 4IDJH 1OAYL 3MV9E 4FQIH 5I8CB 5FYKL 3L3OA 5DZOA 2IAMB 5CLWA 3VFUA 4NQVB 2CXGA 3BQUB 1F4XH 5FYJD 1W0YT 3KG5A 2YUWA 2P8MB 1WICA 5E00B 2LTQB 3FAWA 3AMLA 1VGKB 3GSWA 3PDOB 5CP7B 3QQ3A 1BJ8A 3KR3H 4F58H 2F5AH 1DN0A 1VEOA 5AUMA 4ZG1A 5TDOB 1CFQA 1OF2B 2O61A 1I1AD 5HY9B 4FQHB 5TJWK 2Q8BL 4QXUL 1M7IB 2IFGA 3SDAD 2ATKA 3AM8A 1R5WB 1BOGA 5FHAH 3SDXA 1KPVA 3U82B 2X7LA 4U7KA 5KAQF 4YBQC 4EN3D 4NUGL 1WWWX 3KJ6H 3W5NA 1MHCB 3LSOA 3MV7A 5D6DA 3OKKA 2BNQB 2X10A 3SGKC 1EGJH 3ARVA 2G5BA 3IXTA 4MNQB 3VFSA 4F2MA 4FQXA 4I18A 4HW6A 1CFSB 2ZUQB 1XGTA 3SGJA 3N1PC 3U4EA 1AD9B 4R3SB 4M61A 1NBVH 1XGQA 2F5BH 4XPTH 5JPMB 5E2UL 1JTOA 3SE3C 1XH3B 2CDGB 1FFPA 2CLVB 3D85A 3PWLA 3MCLL 2GK0B 5HYSA 3BKJH 2E7LC 2FHBA 1FPTH 5FGBC 3C87A 4WU5B 2XQBH 3OKLB 4JY4B 1JFQL 3HN3A 3WJLA 2EIZB 4PB0L 4XC3L 2HN7A 2W60A 3MOBL 5DRNB 2BNUA 4UIMA 3UTZB 1YN7B 1RFDL 5EZIL 3WNOA 5C0BD 1Q0XH 3ULVF 3RDTD 1KC5L 4NRYB 1HQ4B 4PIRF 5HHOA 4UUJB 4PRAA 4WHYG 1FZJA 3VWKB 4MJ4A 2ICEA 3P4OB 1ACYL 3WD5H 4XP5H 1FGNH 5I15H 4RWHA 1FYHB 3UPRB 1BQLH 3EOAA 5D1ZA 4NYLA 3ZYIA 3CFBB 3ZLQC 4FTVD 5D5MF 3O4OB 3BW9A 3W11D 3L7EB 4JO2L 1XCTA 3RX7A 5E2UH 5EZLB 5GS2D 4XVSH 4WFHE 4YDLB 1J86A 1P4BH 3NN8B 4LSPL 3C08L 3REVA 3GO1H 4EI6A 4Y4HA 5E6YA 4PJ9D 1HZHH 4ZS7H 4K07A 3G5YB 4NQEB 3QPQD 3VD4A 2AV7B 1NMAH 5DK3A 5FYKE 2QV2A 3H9HB 2R56L 4MA1B 3OJMB 5DD1H 3QH3B 1OGTA 1NDGB 5HHVL 2P8PA 2NY2D 4TULL 1TITA 1IM3B 4KI5F 1FE8H 3HR6A 3SDDC 5I9QB 2D7TL 3SPVA 1BOYA 5C0EB 1LO4L 2NTSP 2XWTB 3HUJF 2WBJA 2D9CA 4OM0H 4YX2H 4KKCD 3ARED