3RVUD

Structure of 4c1 fab in c2221 space group
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
221
structure length
221
Chain Sequence
b'VQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISYSGTTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCGRTGVYRYPERAPYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4C1 Fab - light chain
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 45
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvuD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvuD01
1VACA 3OKNB 4LMQE 5JOEA 3IDJB 4PJFF 2XOTA 4NO3B 5JXAL 5D1QA 2ZOKA 3HZMA 5L7XL 1CT8A 5BZWB 3VXTA 1UB5B 2EIDA 5E8EA 2CIKB 3MBXH 4LCWD 1KJVA 2XACC 3E8UH 4E41B 2CD0A 5J89A 4JFQA 1OGAA 5BRZE 2AJXH 5I8KL 4MNQD 2DJ4A 4N90D 5FKAB 2IAMD 5C8JB 1P1ZB 3K74B 3LS4H 2W0KA 4GH7B 3WMSA 4PJEA 1T1WA 3B6SB 3LZFL 4HH8A 2QHRL 4GQ9H 5T3ZH 3O4LB 3PL6B 1HCFX 3V8OA 3M1BB 3S35X 3ULUC 3F8UB 1A6UL 3UDWA 3U0WH 3ROOA 3PWPA 2Y9RT 4WTXA 2P8LA 2FHFA 5SWQB 1FN4A 4YK4B 1U41A 5TJWK 4Z7VA 1BBJB 2NLJA 4WDIB 1FPTL 4YR6B 3SQOL 4WUUB 4HX1A 4XCEB 3QDAA 3U30C 3EGSB 4Y4FD 4M6OL 1KSRA 3OJVC 3WUWA 2IH3A 4KI5F 1KCRH 5IB3B 2XPGB 3CX5J 5KSBE 4LPUA 2P1YA 5FYKL 4PB0L 4RAUB 4R97B 3KS0H 4K9EH 2KUTA 3VXQB 4YQXL 4W4OA 1VGEH 3ARGB 1YC7A 3FRUA 1HHGA 5TDNB 5HY9B 3VI3E 5GJSH 1UWGL 5E9DD 4KJYB 2OL3L 4DKDC 5GGSA 1A4KA 5FHAL 3SPVA 3HHRB 5IJVA 3FQWA 1QACA 1MJUH 2R56H 3TFKC 3QIBD 3A6BH 1BJ8A 2HA1A 3Q6FB 4G7YH 4NM4H 1GHFL 2FBOJ 1G9ML 4HUVB 3Q0HA 3HR5B 1BF8A 4G6MH 2YA2A 4D8PB 4ZS6C 1G7QA 1S5IH 2EYSA 4QHLA 5J9PB 1U8NA 1I1YA 1NGZB 4Z0BL 1C5CL 1R3KB 5ITBH 3PHQB 1R6VA 1T2QL 4LHUA 1JYVA 3MJ9H 3JV4A 2ED8A 3LH2H 5D2NC 5GGVL 1FFNA 1FNEA 3CVIH 2VR9A 2NY4D 4IMKC 4ZD3H 5HPOA 4OGXH 3RPIB 3RP1A 2DYPA 2R4RL 1WZ1H 1B9ZA 2HH0H 2GSIB 2NXZB 2X4TA 5KVFL 3CFCL 3T2NL 4HSQA 1S9VB 1I1AB 3QEUA 5GS1A 5FFLA 3BGMA 3VW3L 3EYQD 5FGCE 4U1GB 3T8XA 1DP0A 3L3JA 4FS0A 4I5BB 3KPSA 3I6LE 4E42A 5L2KE 4OZHB 1Z3GL 3WIIH 3LB6C 2DQCH 1CBVH 3OPZL 4GRLA 2O5XL 4M5ZL 4QRRE 2DQGH 4E5XA 2XTLA 4I77H 3KYOA 2L7JA 4BQBA 3ESUF 3MLRL 5CKAA 3CDCA 5AYUL 2ENSA 5F88B 2I07B 1T0NB 3L5XH 5ID0A 2K3TA 2LTQC 5TPWH 1YMMB 4L8CA 4ELKA 1K9TA 1TCRA 2W91A 3MV7D 4NP4L 3FONB 4K71B 4JR9L 4OQTL 1KTDB 3QIUA 3B9EA 4FQCL 4LEXH 4W68A 1JWUB 1CXEA 5GQBA 4CMMA 3DV6B 3WJJA 5IKCB 1A2YA 1HIMH 1W0VB 3OB8A 4F7TB 2Y5TA 5DUBB 1B2WL 3QO1A 2R8SH 1SM3H 4XH2A 3O9WC 5INDB 5FOBB 1JGEA 2VXQH 2XN9E 1INQB 3T3MF 4EDXA 4PJDE 1PLGL 4AG4L 5JW4Q 3LQAH 1JHTA 4U6HB 4EQ2A 4L4TE 1OP3H 4XHJD 5H8DA 1S9XB 3NGBC 2BC4B 1BQUA 1AGDA 4M1GH 5IMLA 3LN4A 2FGZA 4MQSB 3W11D 3AUVA 1XGQB 4PY8I 3HC3H 1QYGH 3HUJB 4JZJB 5TE6L 3GHEL 5EFIA 3GFUA 3IS0X 4HC1H 1ZS8A 4PD4J 3NCYP 4GXVL 5L88H 4FXKB 1WC7B 3K2UL 4HKBB 2H32A 1BMGA 3D69B 3DOSA 1HHKB 3WLBB 1WTLA 2HKFL 4LLWB 5A43C 3X14B 2R39A 4ZAKB 2ZOLA 3G5VB 4NZTH 5CSZB 4WRLA 5SX5H 1RULL 3O6FD 4RBPH 2EDXA 4XP9H 4U6VL 4RFNB 1JFQH 4YGVB 5CAYB 2F15A 2H26B 3QHZH 3MLZL 2IBBA 3TO4A 3LKRB 2XY1A 4B0MM 4APQD 2R1YA 3QNYB 2V2XB 3TT1L 4P2QE 3JWDL 3RJQB 1A1NA 1NLBL 5D8JL 5FKPB 4L29B 4YDLC 2CRYA 5D1XB 1Q38A 1AQDA 4L9LA 3D18B 3SOBH 4JPVL 4GG8A 4GUPB 2A73A 1FLRH 3RTQA 2PTTB 5SWSE 3UBXI 5JOFA 3RDTC 1MCOH 5J57B 1YEKL 4QTIL 1IGMH 1FZJB 4DUWA 4J7RA 3DVIA 4O5LH 5DMGD 1I7UA 5A40E 4WW2B 1UJ3A 2VOTA 4Y8AA 1KG0A 2VQTA 1UXWB 4NO0A 4NNYB 3QQ3B 1FDLL 2M26A 5FEBA 4X80H 1S3KH 4UT9H 1KUMA 4BH8B 4UNTA 5GGUA 4G9DB 1BX2B 4PJGE 2EDNA 2PR4L 4WV1A 1OT1A 1QVOA 2GI7A 1FNFA 3BN3B 4Z7VF 3CXHJ 3CFDA 4XGZB 4S1QL 5DJ2A 4KZEH 2CIIA 3MJGX 4Y4HC 4U2YA 4N0UB 4RGOH 4JHWH 3EYUH 1F3JA 3LV3A 5EIQA 5ISZA 2DQEH 4KWUA 2V6HA 3FQXA 1S7VA 2W59A 2XZQH 3GSNA 3U30B 2MKLC 1IFHH 3VWJB 2AXGA 4HT1L 4QXUH 3WLWD 2ZCLL 1T3FA 1F00I 2CDGB 3ALWA 3LCYA 4N9GA 1JGVH 2C3WA 3TBTA 2DI9A 3UJTH 1WLHA 4ZUTB 1KBGH 4ZDHA 1S7QA 1YDPA 5HHOE 3GJFH 3BW9B 2G2RB 3V6FA 2DKUA 2EYRA 3C5ZC 4TVSa 4FNLL 2BRRL 4OZFG 1RJYA 2A2QT 2RAMA 2A6JA 5SX5K 4I18A 4RBPK 3WBDA 3QA3B 1R3JA 5T5NF 5E08L 3S34H 3BX7C 2R0KH 4BSJA 3V5KB 3CFBA 1DLFH 1UH2A 1DL7H 1HDMB 2XA8H 4PJHE 3TNNA 5ESQB 2Z93A 5I1HL 3ARVA 3PWNA 1M1SA 3MTRA 5IBLC 3H2WA 5AEAA 3EHBC 1QRNA 1Q9LB 4MCYA 4LRIA 1CFVL 5C9JA 4C59B 2E9BA 4QYOA 1P7QD 4NFCA 2XWJB 2VE6B 4YH6A 1ZOXA 1JWMA 3CSPA 1XGPB 4PRHE 1CN4A 2XTJD 3U4BH 3SE9L 1XZ0A 1E27A 4ELMA 5IVXE 5HJ3A 4QRTB 4F7EB 1CDUA 1XH3B 1T21B 4POZC 3HC4L 3HFMH 2PO6C 3L5IA 3WFCL 3S9DB 3B9KD 3MV8D 4URTB 1SJHB 4LVNC 4ZUUB 5BS0B 3KXFE 2OM5A 4LGRB 4PGEB 2CUIA 4MNHB 3ET9F 3KPOB 2AEQH 2OR9L 4PG9A 2YK1H 4JY5L 1A6ZB 4OFKA 5ICYA 1LILA 1I9RL 3RVVD 3U83A 4E41E 3BEVA 1JYXA 2FB4L 1M7IA 4L4VA 5KOVC 3OX8A 5MENB 1MHCA 2FD6L 4LASH 3S37H 4OF6A 2EEAA 1CL7I 2CDEA 4NPYA 3RAJH 3MXVH 4NN6B 1C7SA 5C9KA 1MI5D 4S2SB 5ID1B 3O3DA 1CDHA 1EFXA 4LNRA 1IKFH 3C6LC 4HXAL 2BXYA 3U9UA 5JDSA 3VGGA 1B0WA 3BO8A 3CSBA 5C0JB 4KK9D 2EYTA 5CJ5A 1HWGB 1J8HE 3O2WH 1G9NH 3P9LB 4MSWA 3O9WB 4WUUE 3UZQA 3TYFB 4I9WD 4CVWA 3VXMB 1MELA 4AENB 3GJFK 4YGAB 5DLMH 3BIAX 1LVEA 12E8L 1DBMH 5J1TC 4KK5C 1NGWA 4ODBD 5D71L 2Y4SA 5E1AB 3TWCL 2XZCL 1KTLA 1P5VA 2GTWB 4U05A 4B50A 3LN5B 2JKXA 5IQ7L 2FGWL 3U0PA 3MV9E 1RZGB 1A7OH 1F4XL 1IEAA 2DLTA 4WO4D 4OD2A 1J1PH 1A6AB 3MRBB 3ARFC 3PDOB 4HLJA 3WFDH 2VDOH 4G6FB 4D2NA 4Z76B 3RI5F 4PS4H 5F3BB 4QRSB 2EIBA 4DN4H 5EWIL 1S5HB 5JW3L 2J8UA 5KS9F 4NQUA 5DUML 4OCRL 1XGUB 4JKLA 5D2LF 5EDXA 1GVIA 3U7WL 2A9ML 5BV7C 5E6IA 3RWDB 2E27H 2D9CA 3KGRA 3ULVC 5K9JL 4PV8B 1QSEA 3HRZA 1GJIA 1IM9B 3UPAA 5EO9A 5J12B 1YUHB 1S7XA 2VLJA 5IB5A 1L7IL 1PQZA 4O9HL 4Y16B 2OJEA 4PJ9D 3OQ3B 3U1SH 1QLEH 1AGBA 2D0FA 3A6CL 4PJCA 3QO0A 1TJGL 2BVQB 2BK8A 3PP3H 5EG6C 4M7JH 3RWHA 3H0TA 2Q6WA 1J7VR 4ZTOL 2VUOA 5ADPL 5C09E 3L9RB 3NH7L 4ODSH 1XAUA 2IPUK 5D9SB 3AFLA 3V4VL 2HT2D 5I73B 4QHMB 5E5MA 1OSPH 4Y2DA 3VU2A 1ZTXL 3TP4A 3ARQA 3KPNB 4MA7H 3I84A 1KN4H 2FATH 2ZNXA 1U93A 4XWGL 3EDEA 2VLMD 2ZCKH 4ODUA 5EOCH 3QR2A 3LS5H 1CGYA 2ZUWA 3C60B 3BAEH 4IRSC 5KAQG 1TETH 1D9KA 1MCLA 3WE6A 2VISB 1TNMA 4HUMB 3FJTA 4HGMA 3V4PH 5C07D 3MNVB 1U3HA 1EAJA 5GGRA 4NQEA 4ZFZB 4KKBD 3BP4B 2PTVA 3BKYH 1NAKL 1QBLL 2YSSB 3MRPB 5LJYH 3IT8D 4O2EA 4R3SB 5EO1B 4EN3D 4XNZC 2VTFA 1N3NA 3UEZA 3QEHB 4MQXC 3GSNL 4H1LB 2ARJA 4GG6B 4AEHL 3KLHD 5L0QC 4WHCA 3FFCA 3WO3B 5FF6B 2V17H 3TO2A 4BSWB 5BW7A 1X5JA 2WBJB 3BUTA 1KNOA 2AXJA 1J5OL 2CMRH 4M7LT 4J3WA 1R24B 5IW1B 3O6LH 5M7QA 4YJZL 4JHAH 5IHZB 3ARBB 3RVUD 3DURA 1T04B 1PZUB 5AG8A 4HDIB 2GSGB 5I15L 4DKEL 2HVJB 2A6DB 5IHUH 3HUJE 1BJ1H 1RHHB 1ZLVH 4GW1A 1DQML 5JHDB 1RZIA 3TBWB 3GIZL 3VE0B 1HNFA 1MHPH 4P9HH 2AV7A 1GGIH 3PJSB 1G9EA 5GSRB 2J7LA 1HEZB 2VDLL 2OK0L 4N0CD 2J1KA 2PW2B 1H8OA 3PP3K 4KMTL 5DK2A 3RWGA 1DUYB 1MLBA 3S36X 5HGGS 2B2XH 3GM0A 4TN9A 1A6TA 4NHCH 2X2YA 4LLMB 3DYPA 4ELMF 1GSMA 1A64A 1BFOB 3DPBA 5A16B 5JUEL 1M71A 3BYYA 1Q9WA 1D6EB 4JRYA 2NZ9D 2JCCF 3EYSL 4Q2ZB 1HXMA 1JGDA 1JZ5A 4U0QB 2YXFA 5CEZE 1Q9KA 1RD6A 2IMMA 5DEGA 4YWGH 3VG0H 4OI9A 4X9HA 5BVJB 1I8MA 3MRGA 3MCLH 4FP8H 2XQYG 3O41A 3CPLB 3LQMA 3MRLB 2JB5L 5GZOD 4BQ9A 3CCHB 2QEJA 4ETQB 3ARUA 2FJHA 4XZUB 4WGVB 4N8VA 4X98B 4F37K 3ARXA 4YO0B 5LXGL 4JFFE 5DI8A 2FR4A 4HAFA 5MEQB 2VH5H 3QI9B 5I8OH 1RZJH 3D5OF 3EOAB 4YHKH 4M7KL 1KULA 3E6HA 4JM4H 4C54A 5GRJH 4P3DA 3JWDC 4LAQH 3IAGC 3AMLA 2KQNA 4DGIL 4N0FA 3DO7B 4NGHL 2JIXA 2C9AA 4E9LA 5D1QC 4KU1A 4HUWB 5ERWA 4NO2A 4K7PL 4U1JA 1CLOL 1I9IH 1RIVL 5E8DH 3EYVB 4H0GA 4JQVA 1RUKL 3LRHA 5F89A 3ZE0E 4JDTL 5I1IH 4PJFB 1LWRA 4D0DA 1U95A 3BKML 1T03L 3GMPB 4UMGA 4Y5YA 4JN2B 4P9ML 3O6KH 3V5HB 1INDL 2XG4A 3OKOB 1V3LA 1ZLVK 4LLQA 5FYJE 4ZOBA 1GZQB 3GI9L 2VLKD 4LSRH 4OLVL 4MJ5A 3NACH 1UA6H 1RURH 5EH1A 3D2UB 4X5LA 5C08B 2E9JA 1FBIH 2WINA 3TVMA 2C7UB 2IPTL 2J8UF 3L3OA 1NCTA 3QDHA 5I8EA 4JGMA 2KZ1B 1ZLSL 4PRNA 4DVRL 1PJ9A 2P8MB 3F6LA 1N7ML 1S9WA 3Q2CA 3ARTA 4FQ1H 4AH2A 1XCQB 1HI6A 1S7SA 3MA9H 5T5FL 4K3JH 3TA3D 4YXLL 5B38G 4CAGA 2AW2A 4YHML 5ACMA 3T4YB 2OXGA 1V05A 4QHUB 3L3HB 1S7UA 4HC1A 5CS7A 4KY1L 5C0CE 3IDXH 3PNWB 4IJ3B 4X6BA 3W39A 2P49B 4XNMB 1YQVL 5FHBH 5DVNA 3TIDB 4W4OC 5I76B 4WFHE 5ICZB 1BEYH 1GC1L 2CLRA 1DSFL 4OF3A 1OTUC 2B1HL 3LEXB 3MRDA 2PYEE 1MRDH 2N4IA 2X42A 2EDBA 2UZIL 3NOIA 4ZXBA 5HDBF 1CDYA 1U8HA 5FUZL 1AO7E 3DI3B 1ZHNA 4R7DB 2ATPA 1RZ8B 2QTEA 1NANI 1S7RB 1AXTL 2YBRB 4CU6A 3TEUA 1MAKA 3BHBA 3CU7A 3U2SA 5C0RL 1BVZA 1A1MA 2ITCB 3JSSA 4UILL 5J06A 1ZT4A 2ADFL 2W38A 3CVHA 5BS0E 3ROLB 3SE3A 3CUPB 2DQJH 5B8CA 3MGTA 4YHIA 5GS0D 3DXAB 1NC4B 2R0WH 1NSNL 1DFBH 1YNKH 4GRMA 3MBXL 4WTZA 4BSVA 3E8UL 2AJYH 4V1DB 4JFDD 1OY3B 1YEGH 3HAEB 4U3XA 4ZFFA 5L8JB 5MENE 3HE6B 4O2CA 4MDIA 3G6AA 3S96B 3WFHA 5EA0H 1VPOL 4KC3B 3TV3H 5LQBH 4TULH 2OZ4H 3ZE1E 3VD7A 3RUGF 2K7QA 5IB4A 5ILTH 4HKXA 4PP2B 2F54D 3SCMA 1SY6H 1MHEA 4CGTA 5T3ZL 1R3LB 1K5NA 3MLTA 5HVWA 1NUNB 3P3YA 4RQQA 4GRLC 1CFQA 3VH8B 3MJ7A 3G6JA 3T4AB 1NGXA 4NO5B 2Q7YB 1TCMA 4JO4L 4Q0XH 4X4ZA 5L0QB 3EO0B 1T4KA 4YBQD 4HJGB 4I4WA 1HH6A 4LVEA 4R4BB 1IQWH 1WBYB 4G42A 4UDUB 1T66D 5B21A 1KCRL 5HI3D 4Y19D 5DRXA 4ODHH 3BGFB 3ZDZF 2IF7A 3HCVA 3AY4A 4JFYB 4Z5RA 3NCYS 4UQ3B 1VGEL 3MGOB 3WJJC 1UCTA 2D31B 3B5GA 3ZT5A 1IGTB 3KLAA 2FH6A 3J7HA 4JLRA 4JRXA 4X7DC 2JTDA 1AP2B 1MJUL 2QL1A 2R56L 3ES6B 2YD8A 2AK1L 1IM3B 1JTPA 2RCSL 5D7IA 1BQLL 3K3QA 5EULV 2OI9C 4G6ML 2YN3A 1E28A 4QOKD 3C8DA 3TN0D 1TZHB 1S5IL 1OB1B 3MRCA 3M45A 4LIQE 2GJZA 4KV5E 2QSVA 3P9MB 1GYAA 4WFED 2EE9A 4ZODA 3QEQD 4CN1A 3TZVB 4AM0B 3LH2L 5IP4A 5C0EB 4P2OA 1ES0A 1YPZE 5T3XL 4WNQA 4PRAA 1KIRB 2DN7A 2EDLA 4XBGA 5HYJA 4P46D 1WZ1L 3ECBB 1I1FB 2HH0L 3C8KB 3WJLA 4NFBA 2KPNA 1UJTA 3T0XA 1KN2H 4TSAH 4HWNA 2YRLA 4UIMB 1RUAH 5DJ0B 4F8TA 3OXSA 4IRJB 2W9LA 2HTKC 3BPLC 4M6AA 3KYAA 1KXQE 5DHVB 3TO4C 3WIIL 5ACZB 2X09A 3QUZD 2ITDB 1QEWB 1FZMB 2DQGL 4PFEA 1UZ6E 4I77L 4M8VA 5H2BB 4LKCB 5CKGA 1IE5A 3CX5K 3GBMH 5E03A 2YRPA 1CF8H 3MMEA 3L5XL 3NIGE 5JMOC 5JQ6H 1KXTB 4GMSH 1QUNA 4PLKC 4MAYD 3RTQC 3IKKA 1KCSL 1VACB 4QXGH 4XP6L 4LEXL 2ZOKB 3QRGH 3D39B 2VR4A 3W9DA 1JRHI 4XVUC 1NCWL 1HIML 1Z9MA 4BK4A 3TBSB 4AK1A 4OF7A 1KJVB 4DVBA 1UJ3C 2R8SL 3AAZA 4QNPF 2VXQL 5JR1H 3THMH 1YNLH 4EBQH 3HLAA 5KTEH 4G8GA 4LBEB 3LQAL 4P4KD 3U7AA 5DQ9A 4BKLA 4WV1C 2FLBT 3W82A 3PHSA 3WNMA 4PGCA 5KSAD 3T09A 1T1WB 4M1GL 1I7RA 2HJFA 1NCCH 3VFNA 3WDHA 1QYGL 1FO0A 4NUGL 4TOYH 3PWPB 1RV6X 1T20A 1G7IA 1FN4B 1WFTA 4HC1L 4KUZH 4TUJB 4Z7VB 2ICEA 2D7NA 4PRPE 3QDGD 1N4XH 4JEGB 5L88L 3C9NA 2GJ6A 3U0TA 4PLJD 3E0GA 5J6HA 1MFNA 1CGSL 1KENH 3GMOA 4A2MA 1NANH 4M1DH 1N0XH 4XI5C 5IFAH 3S35H 5GRWA 4LQFL 4P5TA 4XP9L 2VXSH 5IBUB 4S1DD 1VESA 4YUEL 1KB9J 1KJ2B 2VAAA 1EH9A 3VFOA 4Z7OE 4LSQL 2OP4H 3RX8A 3C09C 3V6OE 1A8JH 3QXWA 4I18C 1ZT7B 3ARDD 3BH9B 3CVHL 4M43H 3BUYB 2QKIB 1P2CB 1J0YA 5I1DA 4P4RB 4WHTA 2VRAA 3MYJA 4MJ2A 1N2RA 3SOBL 1FLTX 4WHDA 4RGNB 1X6LA 2G5BB 4K94H 2DTSA 1FLRL 4PJXA 1GRWA 2I9LB 2NY1C 2EYSB 5GXBB 5J13C 1C12A 5BVPH 2JELH 4NC1C 2Y25A 2ZKHL 1AC0A 3SQBA 1MCOL 1WCBA 4LRIC 1X3DA 4HPOH 2DM3A 4Z7NF 4LHUB 1QR4A 4NQCB 4U1SA 4R9HA 4H20L 4XP5H 3UTTD 3JV4B 4KHTH 4O5LL 1DEEA 1LO5B 4ZSOB 1FFNB 1FNEB 2BSTA 4LLYA 5INCB 1LEIA 3VRJB 3PWVB 2DYPB 1T6VN 1CD9B 2P5WA 2WM0A 3HMWL 2LFGA 5ANMA 4X80L 1S3KL 4UT9L 2XXCB 2ADIA 3PIQB 4JANB 5K59E 4ODXB 3CXDL 5GS1B 2PF6A 1H5BB 3BGMB 4ONFH 4OFDA 4PJ8B 5BZDA 3S98A 2F9BT 3TIEA 5E2UH 4JQXA 2BVUA 4JCMA 2BVYA 4PD4K 2P24B 1MAJA 2HYMA 3SO3B 1D5XA 2PXYA 2NXYD 4RGOL 4MD4A 4GBXD 1AIFB 2NY6D 3P4NA 4JHWL 4WFGE 1HILA 3EYUL 5D7JD 5LG1A 3RU8L 2A83A 2R23B 2F53E 4MQ7B 5F7HA 4EVNA 4OZFH 2R9HD 1P84K 2Q86A 2EKSA 3I50H 5J0BA 4PJFE 2XT1B 5HYSG 5ID0B 1ZGLP 2VZTA 2XZQL 1B6UA 4CJ1A 5DFWH 4DWHA 4JPWH 3ILPA 4IDLA 3VXSE 4I2XE 5CJQH 4L8CB 1C08B 4ELKB 4LCWA 3ISWA 4QXUL 2AGJH 3QIUB 4KJWD 1JGVL 3GIVA 3UJTL 2IAMA 1KBGL 1QRKA 4J12A 4CMMB 2V2TB 1A2YB 2CJUH 1JPTH 5D7IF 5M94B 2IFFH 4Z0XA 1U42A 3X3GH 1JV5A 3EUUA 3CFEA 1GGCL 1JGEB 3GMRB 3VFMA 4MXWL 4EDXB 2MQCA 4GKSA 4JM2C 4RSVA 2NY3D 1BFVL 3MRMA 2IALA 3ZKND 1JHTB 4X4YB 1HSBA 1KJMB 1NC2D 1F11B 5HVFB 1DLFL 1FNAA 5KANG 1DL7L 1AGDB 3K2MC 4CVUA 4OAWA 5FM5O 4XHQA 4KI5E 4CVZB 5C0BD 5FYKE 1LO2H 2NY2D 1ZEAH 3O2DH 1ZS8B 1SJEB 5GGTA 1KTRL 1PG7X 3U4BL 2JJTA 1A3RL 1JGUL 5E9DA 3AS3A 5E6IC 3CXHK 1HWHB 3HFML 1EO5A 3DMMC 1FVCB 2NY0D 1CI5A 3UTSE 3O4OC 4JKMA 5KS9B 3KPPB 5E8NB 1EXUA 5D2LB 2V9QA 4ESKA 1OSZA 5E8OA 2W07A 5AZ2L 5IK3A 3RVTC 1KTKE 3HAEG 1LO0H 1NMCC 4R4NC 2QV2A 2AEQL 4PV9B 4FG6D 3MREA 2R1YB 4M6MH 4NM8L 1JRHH 4IOIB 3Q5TA 4XWOC 3MOBH 4LASL 3S37L 5KZCD 1IMHC 4Q9BA 5D96B 4EI5D 1AQDB 1UACH 3G5XA 4L9LB 4AT6A 3PDDA 3NCEB 1W2KT 3MXVL 1OTSD 4OT1H 4RFEB 2VXUL 4Y2DC 3RTQB 1KEMH 4DEPC 3OAUH 1ZA6A 5JOFB 5EU3A 3DWTA 1ACYL 3NPSB 3VI4F 2RIKA 3H7LA 1UGNA 4WEUD 1CLCA 3IKCA 3I6GB 1CS6A 3E3QC 1U8MA 3KPLB 1AKJB 2Y7QA 4G80A 3QNXA 1VB9A 2L4OA 3L5WB 1D9KC 2VDQH 4NN5B 3BZEA 4XVTH 5SWZD 5TH2A 3F5WA 5DLML 1U3HC 1LEGA 1XIWB 3O8XB 4KUCF 1FO0L 5GGUB 5E1HB 1DANT 5FGBA 5B39G 3FT2B 5DJ2B 5DXWA 1KELH 1UVQA 4OV5A 3IXTB 3D3VB 1A7OL 4XNQA 1TZGH 3MV7A 5GGSY 5CCKH 1F02I 1F3JB 1J1PL 4P2CG 1IARB 5HHXH 5ISZB 1UWEL 2VDOL 3QIWD 4PS4L 5CEXA 4P2RB 4DN4L 1K2DA 3FQXB 1C8PA 3RGVB 1I9JL 3GSNB 1C16A 4YDIH 1QKZL 5C0AD 3DJ9A 5BW7C 3BWAB 1LO3H 2FH8A 4UI2A 5DURD 4H8WH 1S78C 1NCBH 3MRJA 3WN5B 2E27L 2Y06L 1T3FB 2A0LC 4N9GB 1NDMA 2IBGA 2ZCHH 4KQ4L 5GJTL 3TBTB 4FABH 2MQ0A 4ZDHB 1S7QB 3T3ME 5HYQA 1FFPA 2EXYC 1HHJA 3U1SL 4NT6A 2GCYB 2W9DH 3QFDA 5HYEA 2XNAA 3L3GA 2WP3O 1VEOA 4KROC 1MREH 4ODSL 1QR1B 1N59A 5J1AB 3QQ9D 2DKSA 4EIGB 4Z95H 1OSPL 5C0DB 5J7CC 2VLLB 4FN0A 4OUUA 1MJJA 4MA7L 1TQBC 1KN4L 3I6KB 2FATL 4MCYB 4MZ2A 1LNUB 3TF7C 3P4MA 1A9BA 4FFZH 4OGAC 5ETUA 4JFXB 4RCAA 5EOCL 3O6FA 4X6DA 3LS5L 3T0EA 1J12A 5AUMA 3BAEL 4NRZA 1TETL 4KH2A 1IRAY 1E27B 1EEYA 3CFKB 4ELMB 1NEZB 2C1PA 4BUHA 2WSKA 4S10A 3V4PL 1A7PL 4NNXA 2JCCB 1KLUA 1RPQA 4PJAE 4CDGC 1CFSB 1MIEH 3ARPA 3BKYL 2AK4E 4F37F 4XBEH 3O3EB 2ZZUT 3I2CL 2DQHH 5K9OB 1RY7B 3CJJA 3RY5A 1MCSA 5GS0H 3ZKXB 1WWCA 1E4XH 5DRNB 3BMWA 3L5HA 1YEEH 1WITA 3IRZA 1FL3A 4F7PB 2YUZA 3EJZC 3X11A 2ZWLT 2DQTH 1TTUA 2AEPH 3SDYH 3BEVB 4L4VB 2P8PA 2AQ1A 1OGAE 1MHCB 1UH3A 5JORA 4R26H 1FC2D 4P57A 1ITBB 2CMRL 4HWBH 2BMKA 1DTUA 3O6LL 1I8IB 1ZT1A 4OZIA 1PW3A 1S9KC 3EOBA 2MKWA 4JHAL 4PJEE 2YWYA 3EIFA 5JIIA 3O3DB 2OX5A 3U9UB 5JDSB 3ARED 3PWPE 4HBQA 4JQVC 1AI1L 3P0VH 2EYTB 2XWBB 1RJCA 4Z7VE 3TYGH 5JPMB 3NN8A 4MSWB 1HK6A 1MHPL 2ZNWA 1GGIL 4X99A 3DHMA 4M4PA 4Y5YC 3RVXC 5H37G 1VDGA 3PQYD 2ZSVA 3F7PC 3H3BC 2B4CL 3KPRA 1CICB 5IBUG 4WEBH 3EDJA 4ZTPH 5GGTL 2XN9D 2Q8AH 3VFUB 5DS8B 1L0QA 2B2XL 3NFSH 3NCCB 1ZLUK 4NHCL 2J4WH 3U0PB 3MC0A 4ONGH 1I3GH 1L0YA 2Q76A 4OD2B 2X70A 4L4TD 3KPMA 4PR5B 5E2WL 4FQLH 4Y89A 2GFBA 4WI8A 1T1ZB 5F97E 4MXVE 5C0FB 4MHHG 4RMWA 4IIQA 4XPGL 5DQJA 4QRRA 4XB7A 1H8SA 2J8UB 3RWJA 1O7SA 4FQ2H 3FQUA 3ILQD 2AERT 3MV11 1L9MA 1HXYA 4JO2H 1UM4L 1QSEB 5FCSH 1CE6B 3HRZB 5IW6B 2YC1A 3U6RB 4FP8L 1V8HA 4LSVH 5EO9B 2VLJB 3ZE2F 2R1XA 2W9EH 1AD0A 2OJEB 3KYNA 5TFSH 3HZYB 4IBLT 1OAUL 4ZXBC 3QO0B 5ECJE 2EDJA 4U49A 1Y6MR 2VH5L 2Q6WB 5DC9B 5I8OL 3UJIH 3GSWA 1RZJL 4YHKL 3SDDB 1MUJA 5KW9L 1U3JA 2Z91A 3CH1A 4Y5VB 5GRJL 3HZKA 4P2QD 1AR1D 1WICA 4WI4A 5E5MB 4OB5L 4PJDA 3DX9B 4KAQH 1DQQA 1WK0A 3VWKB 4ZYKA 2DLHA 3SE3C 1VGKB 1HOCA 3CDFA 3KPSE 1T5WB 2VSDA 5B8CC 1U93B 1YN6A 2QR0A 4QY8A 4TPRH 3PUCA 2MWCA 2HMIC 5E8DL 3QUYB 5DEZA 3Q5OA 3ZHDA 4L8SC 3VGAC 3TJHD 1DQTA 2EDEA 3GDBA 5I1IL 2GITA 1D9KB 2C4FU 2D9QB 2LU7A 2YUXA 1CVRA 1BHGA 2ADJB 5GGRB 4NQEB 3VMOA 1GGBH 3FO0H 4PY7A 2Z4QA 4LSRL 4Y5XA 4O2EB 3SCMC 3REVB 1UA6L 1RURL 2X4UA 2BX5A 3F65A 4QF1A 2CLZB 3IAPA 1FBIL 3N1PC 4OZGA 2ARJB 5A3ID 5A2FA 5C2UB 3RUGB 4X7CC 4Z7QF 3HB3D 2VWEC 5D7SH 4J3VA 2FEDC 4MJ6A 4WWKD 1MI5A 3BISA 4MA1B 3HE7D 2XQYK 4FQ1L 4G8IB 2VMFA 3MA9L 4WW1A 3UJJH 1EVTC 2X4QB 4H0HB 4K3JL 1KNOB 2ZUQC 4G8EA 4XCNB 5HHQA 4FQHA 3IDXL 3DIFB 2CSPA 4PPTA 5FOJA 3DURB 3RRQA 1BEYL 4BFBD 1MRDL 1LE5A 4JDVA 4F9LA 5CHNB 3SDAA 4I0KA 1RZIB 1CGVA 3BZFB 5F9WC 3D6GA 4UOW0 5HHOD 4YIQA 5IT2L 1QFUH 5DT1H 2F19H 4Z8FH 4WO4A 4PBVC 5FK9B 1J86A 3BPCA 3GO1L 1RIHH 5K93A 4YXHH 4OZ4B 4A6YH 3K0WA 3FT3B 2Z8SA 3UXFA 3IDUA 4HBCH 2XIDA 2HKHL 1MLBB 4HIIB 1A7RH 1NBYA 3HG1D 2WP3T 1PSKL 4XTRD 4F58H 2PNDA 2DQJL 5CBAA 3LKSB 1M71B 1Q9WB 4GKZA 2G9HA 3K4ZA 1DFBL 5D7LB 1T2JA 1YNKL 4R7NA 4P2OC 2AJYL 5KSUB 3WUZA 1YEGL 2D7OA 3JZ7A 1Q9KB 5IR1B 3KNBA 3RWCA 5DEGB 3TLRA 4RMRA 3UTPD 3I3EA 1S7TB 4RMUA 1UKSA 4PJ9A 4LPVA 2YZ1A 3TV3L 4QHKI 5LQBL 4TULL 2OZ4L 3ZKMD 2DQIH 5ILTL 3SGJA 1EVUA 1AR2A 3O41B 4Y4KD 5D1ZA 1SY6L 2P42B 4WEMB 5KVGL 4Z7WF 5I74B 3DX7A 4BA8A 3WO4C 2J8HA 4CADA 4R2GD 1IAIM 4ZO7A 5BO1L 3WNKA 4OZIF 2DMBA 3KXFD 5EIIB 3SDXA 4F33A 4F7CA 2AKRB 4F3FA 1XF2A 2ENYA 1QBML 2E6PA 1IQWL 4HUUB 4QRUB 3E6HB 43CAA 1KF9B 1WVZA 4LLDA 1FG2A 4OZFA 4PUBL 3VGFA 4I3SH 1MJ8H 2R1WB 4K7FA 5DMKA 4N0FB 3E1F1 3TBVB 4YBHA 1KGCE 2C5DC 4B5EA 1QD0A 4M7ZC 1BF2A 1Q94A 4HCRA 2YD1A 3PF2A 5CD3B 3HR6A 1CD1B 3BDYH 2VL5B 5DJYA 1XGTA 3GJEA 3NZ8B 1N6QH 5ISZE 3T0WA 2DKMA 4R6UA 4D0DB 1U95B 4ZUWA 5KANI 3RVWD 1CDCA 1IQDA 2E7CA 3BIKA 2I25N 3MLSH 4XP1H 1CYGA 1J8HD 5CP3A 1MEXH 4MJ5B 4ENED 5K9KB 1WEJL 5KVDH 4L3AA 3LKNA 5T1KD 3O3BA 3TVMB 2WINB 3FO9B 3L3OB 1OT2A 4JG0H 2WQRA 5I8EB 5EZOL 5A2IH 4NQSB 4NNPH 3IDJA 4TRPH 2HN7A 3OKMA 1J8KA 3LKOA 1VFOA 4NO3A 1XGRB 4AH2B 3TESA 1S7SB 3S7GA 2H6PA 5FM5M 5IFJB 1UB5A 1Q9OB 4G3YH 4XT1C 3MV9D 3QZWG 2BNQB 3D25B 2X1WL 3AS0A 2J5LB 3WEXB 4TSAL 3O2DA 4PRID 2CXKA 4D94A 1RUAL 4X6BB 3W39B 5DRZB 4P5TC 5C8JA 5I17A 1KPVA 2MHAB 1QRNE 2CLRB 5AWNH 1G7JB 3KDMB 4NN7C 2DIAA 1T89A 1KCKA 1KCVL 4KFZC 3B2UD 3B6SA 2YWZA 3O4LA 2HTLD 3QWRD 4XRCA 3SO5A 1FFQA 1QTYT 5J11C 3QUMH 1U8HB 4D9RE 4N1CA 3AU1A 4HKJA 4BQ6A 1M6OB 3GMQA 1F3RB 5C70A 2HFEB 4NWTH 4HIXH 4ELME 3BHBB 4WDIA 4GMSL 2JCCE 4JPIB 4XCEA 5CZXC 2P48B 4F8QA 3I75B 4PLNC 4QXGL 2XPGA 2EE2A 5C09D 4PIRF 5E99H 4DW2H 4RAUA 4YHIB 2HT3D 1LK3H 1OTTC 2DIBA 1F2QA 1A6WH 3ARGA 4GRMB 1KYOJ 4BSVB 5TDNA 4H0IA 4CN6A 2X6MA 5DZNA 4L4VE 4WI7A 5EU7E 3RL2B 1B0GB 3DX6A 4MDIB 1BM3H 2VDKH 3THML 4GAGH 1YNLL 4OZGF 1J05A 4EBQL 2AS5M 3B4NA 2YPVL 5ALBL 2HJLA 3DX8B 1FYTB 4HKXB 5CUSL 4XPTH 3DTXB 4HUVA 4HMDA 4JHBA 3HR5A 3PGFL 4JQXC 1OQXA 1OM3L 2PXYC 4D8PA 1ZANH 2VL4A 1U8JB 4JZNA 4FFVD 2CKBB 3MJ7B 3D85B 4LLVA 4TOYL 4HG4K 5HVHC 1NGZA 5J3HD 1B88A 2ZUUA 1R3KA 4KUZL 1T4KB 3NCBB 5F6IC 1BOGB 2NYYC 1HH6B 1C1EH 5SX4I 4ZS7H 4G42B 4OKVA 4P23D 3MROB 4OJFH 5DRXB 1N0XL 1QA9A 2GSIA 5IFAL 3S35L 3QYCA 2IAMC 3I3DA 3VMPA 1S9VA 1I1AA 2VXSL 4DAGH 3L5JA 1Q1JH 3U4EA 4MZ3A 5EZLA 4KVCH 2PTUA 4K3DL 2BOBA 6CGTA 1CLYH 3GSQA 1BZ7B 4OZHA 4X9GA 3TM6A 1OCWH 1MCBA 1U8QA 4M43L 4EIZC 2J8UE 4DN3L 3GJFB 5D7IB 4KDVA 3KHQA 3T04D 5KVMC 4YHOL 1DVFC 1CXKA 1QSEE 4K94L 3ZDXF 4HS6A 3MBED 5BVPL 1YMMA 2VLJE 3J8F7 5FO7A 3QXAA 3FONA 1F4AA 4O2FB 4XB8A 3T0AA 4HPOL 3ESVF 4G9FB 4NUJB 4XCFH 4XP5L 2B4CC 4PJCE 3HNVH 3NVQA 3W5NA 1ES0B 4WNQB 3VDBA 5IKCA 2JJTC 2C3VA 4GLRI 1V5JA 4XBGB 5HYJB 1W0VA 4XNXH 5DUBA 4IDJL 5JIKA 1FSKC 4YFEA 5FOBA 3CGTA 1INEL 4EUPG 2EDRA 1RZ7H 1INQA 1H0DB 4ONFL 3MLVH 5A2LH 3SDXF 1JGLH 3OXSB 4U6HA 2VXVL 1DBAH 2UVEA 1S9XA 4LCUB 4WHYG 3E3QE 1IZJA 5CGYC 1RUPH 4Q6YA 4LSUH 5DWUH 3I50L 3R8BB 1UCBL 4K3EH 1KCUH 2F5BH 1UKQA 4JPWL 3CZFA 5CJQL 4HCRL 4FXKA 4NQEE 3UZVB 4NQVB 1FIGL 1HZHH 1REIA 4JFFD 2AGJL 5CIPH 3OKEA 2RJMA 4X0KA 1FGVH 1IEBB 1HHKA 3WLBA 3H3PH 4LLWA 1RZJC 2FWOA 5E8PB 2P5EB 5CILH 2YD4A 3CD4A 4ZAKA 5CSZA 3G5VA 2CJUL 3NIDF 3B8YA 2IFFL 4UV4L 4FQQA 3NA9L 4YGVA 3X3GL 2F54A 2O5ZL 4K8RL 3FFCE 3AAZB 5T3ZE 3LKRA 5GRXG 5DEFB 5I1JL 2V2XA 3ULUD 3IJSA 4G8GB 4KRPB 1N5YL 1OAYL 2IG2H 2I60L 5JA8B 4BKLB 3BPNB 5FKPA 5FGBC 1ZAGA 1NPUA 5C3TA 3BYTA 5D1XA 1A7BA 1BGXH 4FQXB 2BSRA 1CK0L 3VFNB 3OKYA 1FL6B 1JHKL 4MHHI 3WHXB 1U6AH 2PTTA 3HAEH 1T20B 2IQAB 5HHVH 1ZEAL 3O2DL 3FRPG 3ZDZE 2PN5A 2WV3A 1FZJA 1RUMH 4OLYH 5T1DL 2UY6A 4WW2A 1ED3B 3S88H 3V8CA 1BAFL 1YY9C 3GMOB 2VC2H 3IS1X 1FZKB 1MCRA 3QQ3A 3ZLQC 1IGJB 5EU6D 2VDNH 4BH8A 3TFKD 4G9DA 2Z31B 5FAAA 2VAAB 2BERA 4M3JA 4NDMA 1LO0L 4JRYE 5C0CD 4XGZA 3LD8C 2EZ0C 4ZS6D 2VDMH 3TN0A 4M6ML 4PJ5B 4N0UA 1BD2B 3D0LB 1JRHL 3K46A 2PYED 5M95B 3KYMB 4WHTB 2VXTH 1UACL 1N2RB 3UBXB 5E0QA 5F8QC 4B53A 4HMEA 4OT1L 5FECB 5T3XE 3SJVB 1AO7D 3GUTA 3OAUL 3M07A 1YJDL 1OF2B 4QTHB 2V7HA 2CDGA 4WGWB 4U1SB 5DVLA 2OBGA 3GSOA 2EDWA 5AD0B 1RJLB 2HJKB 4ZUTA 5EZIH 1MIML 2BSTB 2XKSA 3T0EC 2PYFB 1KXVC 1LEIB 4YX2H 3LSOB 4WY7H 4F7MB 4EJ1C 1NLDH 1FGNH 2VDQL 5C0NC 3ALXA 3GM8A 3LB6D 5ANMB 3P73B 4XVTL 1HCVA 4UB0H 2Z92A 1J9CT 3QA3A 3O45B 5SX4H 5F7KC 5ITFA 1ACZA 4JFHE 3TIEB 5CD5C 5B38A 1KELL 1D5XB 3HI1B 1I3UA 1HDMA 3MR9B 4MAYA 5CCKL 4OD1H 1YN7B 4RWHA 1QSFD 2A83B 4M5YL 4OFYD 1Q9LA 1NKOA 3HNSH 4EVNB 1TJIH 4TQEH 5HHXL 4OLXL 2EKSB 4AEEA 2VZVA 4NJAL 4J8RB 5DD3H 4MMXC 4U7SA 2J6EA 1K3ZA 4YDIL 1JE6A 3ILPB 4OD3H 1LO3L 4H8WL 3QPXH 4LCWB 1NCBL 4N0YL 1V3MA 3D9AH 5E6ZA 5JPNA 3DYOA 4QRTA 4LAJH 1XH3A 1T21A 2ZCHL 4QCIB 1A6VH 4MNQB 4QRPD 2OTWA 4FABL 4QNPE 1CR9H 5H35B 2IAMB 1FORH 2MOVA 1KFAH 4C55A 1A0QH 2WZPD 1SJHA 5A2KH 4HS8H 2CGRL 3QFJD 1I1CA 4QLRA 4PGEA 2W9DL 3FAWA 5F96H 3CFEB 3KPOA 5KAQF 2O61A 5HHME 2FX7L 4GKSB 5C0IB 2EXWC 4GLRH 1FNGB 1HSBB 3SEPA 3QDGA 4Z95L 1TITA 1IGIH 1Y0LA 4Y4FB 3B43A 5DC0A 3SE4A 5IQ9A 5E2TL 4OAWB 2AQ3A 2MSPA 1QLRB 2AV1B 1PG7W 4YFLI 4FFZL 4S2SA 4M8QA 5TE7H 5I8CB 5IVNA 1N6UA 1U91A 5D6DA 5C0JA 1Y6KR 2BHZA 5E9DB 5EUKB 1UQSB 3P9LA 5EUOF 2F58L 2Q8BH 2R2EA 3TYFA 1AHWC 1VSCA 3BP7A 3VXMA 1SBBA 4AENA 2ZJSL 3ARDA 4WFFE 4XBEL 3QIBB 1M7DA 5TDOA 1BPVA 4HXBH 3TCLA 5GS0L 4LCYB 1E4XL 5IK3B 1OGTB 5DZLA 2H2PC 1PG7H 2GTWA 5K33A 5F1OB 5EBLA 2ZG2A 5DYOB 2QQQA 2DQTL 2AEPL 3VFPA 2VLRD 1W8OA 1SVCP 3SDYL 1RZGA 1ZLWH 5DJ8B 3RDTD 1LP9A 1A6AA 5IHBA 4R26L 1X4YA 4Z76A 4D0BA 5H37H 4Z7NE 4P3CH 3G5XB 4QRSA 4WJ5B 4LPTA 3IDIB 4AJ0A 1ZHLB 3CMOH 3JVGC 1S5HA 1FYTE 5GHWL 5JQHC 2NY4B 1XGUA 5JW4N 3GMNB 5GRUH 3T77B 3NCFB 4WVRA 3ZSTA 2CR3A 4PV8A 5F44A 1TENA 4MWFB 4F80A 4OFVA 5ALCH 4TYUA 3JBG7 5I6XC 3G6JE 1YUHA 2VWEE 5JNYA 1E6JH 3F58L 3TYGL 1J88A 1OP9A 1T7ZA 1A1OB 4Y4HD 1DANU 3BZEB 3BWUC 3ETBF 2BVQA 5DVOA 4F15B 2NW2A 1CIUA 3RVVC 2W60A 1CQKA 1FVDA 3OHXA 4K3HA 4Y5XC 3L9RA 4WEBL 2Q8AL 4ZFGH 1EMTL 1ZXQA 2GJJA 5D9SA 4XX1E 1CGWA 4DTGH 1HQ4B 1UVQB 4QHMA 2J4WL 35C8L 3FN9A 2JK5B 3V5DA 3MV7B 5BOPA 1I3GL 2FRGP 5HGBB 4DGVL 3UYRH 1T6WA 4H26B 5CEXB 4JRXE 3PWLB 4JN1H 3B8SA 4PRBB 3VFTA 3GKZA 1IAIH 2DD8H 2EDFA 5GZNC 5D7IE 3C60A 3C5ZD 5F1NB 3KR3H 3IYLW 4JO2L 2VISA 1A7QH 4M7LL 4PRPD 1RSFA 1JF5A 4LL9A 3MNVA 3AB0B 1FFPB 3QUXC 4CMHB 2HAZA 4M6NL 2YSSA 3MRPA 2W9EL 3R1GH 1HHJB 5TFSL 2WIIB 3SDAC 4KRMB 1K6QH 4QXTA 3QFDB 3I02B 4GG6A 5IBLD 3L3GB 4KKCC 3EHBD 1G7MB 5DVKA 5HYJE 3DGCR 3C08L 3UJIL 5ICXB 5FF6A 4KQ3H 5L9DL 3WYRA 1JNHB 4KTEL 4BSWA 4GS7C 1TTFA 3BKCH 2WBJA 4KAQL 4Z78B 1MRCH 4XC3H 5CJOH 3S5LG 1JPFB 3UO1H 3MRFA 1RZKH 1FHGA 1R24A 4LCIH 4POZD 4PREB 5IHZA 1B4JH 4TPRL 2PO6D 3Q3GA 3X12A 3LRGA 3M8OH 4K94C 3LMJH 4C58B 3O6FB 2ID5A 1QNZH 2HVJA 2A6DA 4NRZB 4NKDB 4RNRB 1EEYB 1RHHA 1TDQA 4JGJA 4PJ9C 5JHDA 3TBWA 3VE0A 1EJOH 5HHPA 4N5EC 3SGJC 4APQB 1GGBL 4NOBA 3FO0L 3PJSA 4OQ1A 4HAGA 3SDCC 2J2ZA 5IJKA 5HGHB 5D1ZC 1U3ZA 1MWAH 4Y1AD 3LKQA 2PW2A 1RMFH 2XKUA 1R5WA 4MGXA 2J6EL 1RK0A 1NUDA 1DUYA 3DRQB 1FL3B 5I66A 5D7SL 3X11B 2F8OA 1ND0A 3R0NA 1JUFB 3RNKA 2P8PB 5A16A 2YR3A 3ARSA 4NZUH 3UJJL 5JORB 5JZ7C 4Z7WB 4Q2ZA 3C6LD 4P57B 3U4AA 1HN1A 4WFGD 1Z9OA 4B7LA 3H9SD 4G8GE 4MB5A 4I3RL 2F53D 1HSAA 2IBZY 3RGHA 4OZIB 3EOBB 4FXGB 5T1MA 1I75A 1E6OH 1NUGA 3FB8B 3S4SG 3VXSD 1DN2A 2FX8H 3CPLA 3QCUH 4OM1H 2I9TA 1J87A 3MRLA 1K4DB 2R29L 1X4XA 3NN8B 2YOCA 1QFWI 1Z9SA 5DTFA 1F4WH 4ETQA 4DKFH 4YBLC 2GJ6E 3WDIA 4LVHC 4XZUA 5DT1L 1X5AA 4YO0A 2F19L 4Z8FL 3KLHC 2ZSVB 5MEQA 4YXHL 1RIHL 3QI9A 3ARFD 4K8RC 3EOAA 4HBCL 5F9OL 1NCDH 1U8LA 3OB0H 4YEEA 1A7RL 5C0AA 2DLEA 4F58L 2HP4A 3BPOB 3CFIC 2Q76B 4U2ZA 4YHNB 2X70B 5T1LD 3KPMB 4U6XA 3ULVD 2EDTA 3DO7A 2R2BB 1SEBB 2GFBB 1FRGL 2Y23A 4JRWA 1HKFA 4RRPA 3WXVL 5C0GB 4IIQB 5DQJB 5IV2A 3EYVA 3UBXG 5IFHL 2APVA 1VKXB 5KSVB 3MJ8B 5CZVH 5CSGA 1IGFH 3S36L 4HKZA 4PJXE 3SGKA 2YC1B 4JN2A 3UYOD 3V5HA 5HYSA 3QWQB 5EU4A 2IAND 5DSCB 3S97C 1WZKA 1LP9F 2R1XB 1T89C 3K7UA 3OAYH 2Z8VC 3KYNB 1IJ9A 5C08A 1W0WB 3UTSD 1MHHA 3P9WB 4JE4B 3O3UN 4IHOB 4YK4C 3AS2A 2P5WE 2VR5A 1MUJB 5ANME 1P7QB 3T0DA 5TGBB 2Z91B 3BSZL 3HZKB 1QLFA 5TF1H 3V7AE 1FQ9C 2XTJB 2GIYA 1C5BL 4IRSD 2D4DA 3C5JA 1MJ8L 3T4YA 3HZVB 3LIZH 1ZHBB 1HOCB 4QHUA 3L3HA 3WNOA 1PKQB 4HIEA 3WUWG 4R97C 1YN6B 2QR0B 3PNWA 1MF2H 4M4RA 5MERB 2IADB 3TIDA 3NZHH 3B9KB 4KKAC 5I76A 2O5YH 3ARGC 3MV8B 5ICZA 2WUBH 4JB9H 5CIPA 2X89A 1N6QL 2Y36H 1UT9A 5F9JB 1EHNA 1YJDC 1FNSH 1FIEA 4MQXD 1Z6JT 1MFEH 4LCWE 1RFDH 4R7DA 5MEOB 3MLSL 4EOWH 4XP1L 5J56B 2Z4QB 3SE8H 1MEXL 5KVDL 4Q9QH 3KHOA 4MNQE 2ORBH 2X4UB 4LSSH 2EO9A 4N90E 2OYPA 5DA4A 1DBJH 2QQKL 4OZGB 4JG0L 3PWJA 4GRWE 4C56D 1NBVL 4NNPL 4TRPL 1WF5A 4MJ6B 1MI5B 4LOUC 3QDJD 2YRZA 5K9QG 4YE4H 1JZ4A 5FGSA 3DXAA 4WW1B 3VXRD 4M00A 3ARZA 4G3YL 3ULUH 1TVDA 1WTGT 4V1DA 2YD9A 3HAEA 5I9QB 3SGDH 4PTUB 3HE6A 5HYFA 4FQHB 4JFPB 1Z0NA 3RL1A 2JJVA 3T3PF 1I1AC 4YHYB 5AWNL 3PQYA 4H8WC 2Y6SC 4U1GC 4PP2A 1FFOB 4NJ9L 3OTTA 3C6SB 3ZHKA 1LE5B 1NQBA 4JDVB 3GHBH 2LE9A 1R3LA 1MVFA 3HPLA 3QUML 4IM8A 4ZUSB 3BMVA 3T4AA 3CLFL 4YIQB 2Q7YA 4NO5A 3FFDA 4NWTL 4HIXL 3OAYK 4WO4B 3N1FC 5E9DE 1XGYH 4R0LB 4HJGA 4W4NA 3WKMH 4R4BA 4UIKL 1V7NH 1P7KB 4HFWA 4K71C 1PGRB 3KWWB 5E99L 2A77H 4DW2L 4RZCB 1KLFA 1LK3L 4GKZB 3ULSB 2V5TA 4UQ3A 3MGOA 1WJ3A 5EU5B 5DR5H 1Y18A 1DQJA 3KNBB 2D31A 1Z9LA 1FAIH 1BM3L 2HWZH 4PJ9B 4GAGL 1XF5B 1IGTA 3OR6B 3NPZB 5HVGB 3UC0H 1AP2A 3OV6A 3ES6A 3QAZB 4XPTL 5EORH 1EPFA 3RFZC 2VERN 1H9VA 4HK0A 2COQA 1AJ7H 3NFNA 1TZHA 1OB1A 4WI6A 5L2JB 3ZYIA 2AK4D 4J4PA 4LDLB 4X7TB 1YEHH 5A1AA 3QSKB 3SDXB 4F33B 4F7CB 5D1QD 3TZVA 1C1EL 4RISL 4AM0A 4TUKL 4F3FB 1XF2B 1MCEA 5DD1H 4ZS7L 43CAB 1KIRA 3MUGB 1QFWH 2PKDA 4MA3B 4LLDB 4OJFL 1VFBA 4OZFB 1CE1H 3ECBA 1I1FA 1EHXA 4XAWH 1OGAD 4C83B 4K7FB 4AYFA 1Q8MA 1WFOA 1DCLA 3WFEH 5I1LA 5C07B 3LDBB 1N5AB 4DGYH 4ZAKC 4DAGL 5DJ0A 4U1HB 1J18A 1Q1JL 1Q94B 3G5YB 3MV7E 4JPKL 4LSTH 4KVCL 2LQRA 4JGUA 4RFNC 1F58L 5EBMB 5DJYB 1CLYL 2APBA 4EN3B 5DHVA 1X5YA 1JNNL 3JV6B 1QEWA 1FZMA 4Q7DA 4ZUWB 1F4YL 4KK6C 4R4FH 4YBLB 3EYOB 4OCXL 2X4SB 4LKCA 2GEEA 4LRNH 4PGJA 1IQDB 4Y7MA 1QOKA 4KJQC 4EUPH 1VFUA 3CDYA 3DI2B 3F7VA 5D1XC 3OZ9H 1IT9H 3SBWC 3GMLA 3O3BB 2DOCA 4XVSH 3BOVA 8CGTA 5I1EH 5HI3C 1MLCA 4XCFL 1MH5A 4WHYH 2ZP0T 1J0ZA 2HN7B 3OKMB 3HNVL 3LKOB 3BI9X 2ZPKL 2H6PB 3BIBX 3D39A 2FDBP 2CLVA 3TBSA 2UY7A 1R5IB 4WW2C 4XNXL 4KRNA 4ZMAT 2D03H 3B3IB 1FC1A 3IB4A 3PE9A 2XZAL 2YD3A 1RZ7L 3VFGH 4XBPA 3MLVL 1N64H 4LBEA 2X41A 5I17B 5I1GH 1KPVB 3P0YH 1VFAA 1DBAL 4LCCB 4J6RL 1OWWA 4NQXB 1B3JA 1WV7T 2GT9B 5HGDB 2HRLA 2ZUTA 2CKNA 1H8NA 4XRCB 3N85L 1RUPL 1YYLH 4JO1H 3HG1A 4QKXB 4LSUL 4X6DE 3AU1B 3T0EE 4HKJB 1SHMA 1CFTA 3G5ZA 1L0XA 3GMQB 1NEUA 4HPYH 3RHWK 1ORSB 5E94A 4K3EL 1DDHB 1KCUL 2F5BL 3N9GH 3IFNH 3QHFH 4TUJA 1JNJA 1R0AH 1EEQA 4LPYA 4BQ8A 2AJUH 5C71A 1HZHL 3VWJC 3MXWH 1DQLL 4XPBL 3G9VA 3H3PL 5LVEA 4NZRH 2DQDH 2YD6A 5J6GB 3MRHB 5CILL 3LPFA 4TVPD 3BRFA 3BP5B 3A0OA 4Q9RH 1CFNA 1YEIH 2IQ9L 3B83A 3BT2H 5MI0B 1KJ2A 2I26N 3KPSD 1G6RH 1LGVA 3DX6B 3LQZA 5DMIH 2DICA 4GRLD 4Z7WE 1J05B 1J10A 1ZT7A 3BH9A 2HJLB 2IG2L 3BUYA 2QKIA 1P2CA 4Z18A 4OZIE 4P4RA 4LHJB 3MOAH 2MCG1 1MFBH 3Q1SH 2G5BA 2EIZB 2I9LA 4MAYC 1EHLL 3MGAA 4JZNB 4J2XA 1U6AL 1JVKA 3QG6B 4LLVB 5HTSA 4O51A 5HHVL 4OCMC 5I18H 2G5RA 2NMSA 4NQCA 5FO8B 1AXIB 4HUKB 4LP4A 1LO5A 1PBYA 4ZSOA 2ARJQ 5D5MA 1JF1B 5INCA 4HFUH 4OKVB 3VRJA 4HGKC 3STLA 3PWVA 3OAZH 4CBPA 1DE4A 4CJ0A 3DRTB 3KPRE 2VC2L 3W9EB 4Q6IB 1QA9B 2WLZA 1JPGA 2VDNL 3BRDA 2WBKA 3PIQA 4JANA 2E7HA 4ODXA 1H5BA 1J0IA 4GAJL 1C7TA 1RK1A 3U4EB 3ZSSA 4PJ8A 5EZLB 4MX7B 2VLKB 2BOBB 4NWUH 2P24A 5EN2B 3GSQB 4Z7UA 2VDML 1TIUA 3BGAA 1AIFA 1U8QB 2R23A 1TJHL 4MQ7A 3RX7A 4RMTA 4AEIH 5B3NA 3GSUB 3HNTH 4IRZH 4MVBC 4HS6B 3NBNA 4OCYH 4MS8C 5FO9B 3SE4C 1C08A 3TA3B 5FO7B 3QXAB 1VCAA 2BOCB 4NN6C 4D9LH 3GK8H 4OGYH 2NY5L 4PRIA 2R2HB 3O3AA 2V2TA 5CEYB 2H41A 1F5WA 2C3VB 2KQMA 3MUJA 4KHXH 4WY7L 4S0TD 2HTKD 1T83A 5JHLL 2F74B 3TO4D 1F8TH 3WNPA 4G7VH 3FTGA 3MLWH 3IFLH 1OD9A 3GMRA 1U2CA 1L9NA 2IWGA 1EO8H 2VKWA 1MQKH 4U1KA 4X4YA 1KJMA 3BKJH 5EPMA 1F11A 5EUOB 2XI9A 43C9A 3MRRB 4PLKD 1R5VA 4MD5A 3MV8E 1Q0XL 3GSXA 4FQJH 5JXEA 1D5IH 1G7HA 3HNSL 4XMKH 1AFVH 1TJIL 4TQEL 1X5ZA 1JMXA 4CVZA 4ZO9A 2YD7A 3SKJH 5DD3L 3V0WH 1SJEA 3WHE0 4OD3L 1R3HB 4PGDB 2DRUA 1H3TA 3CZFB 4HIHB 1EUUA 4XVUD 1VFMA 3QPXL 1KACB 3D9AL 1T0MB 4D3CH 4JFDB 3OKEB 4XNYH 4X0KB 1P84J 1W72H 1A6VL 2J3SA 1U92A 4NO0D 3RWFA 3DETC 3H9HA 2FWOB 1FORL 4FZEH 1KFAL 3OKKB 4OZGE 1FVCA 3MRKB 5IG7A 5J12C 5FXCH 3OAZK 5KS9A 1HINH 3KPPA 4FQQB 2XICA 1MI5E 4Y16C 2F54B 5E8NA 5D2LA 2EDDA 4EI6A 1KGCD 4UOJA 5HGAB 1E4JA 2AJ3B 4RX4A 4PV9A 4M93B 2Y1VA 3IJSB 2PW1A 3OBAA 3DYMA 5F6HI 1KEGL 4IOIA 2N1KA 2ADGA 3X17A 1IGIL 4I9WE 2ATKB 4Y0GA 2BSRB 5I73C 5F7EH 4ETYA 4RFEA 2EH7H 1FJ1A 1KC5H 2WAHA 1P6FA 4POUB 5LCVH 4Y19B 1EO7A 4XI5D 5JDJA 1XFPA 3I6GA 4R8WH 3KPLA 1AKJA 3E6FB 3ZKQD 1A9EB 3C60C 4NQDD 5DF0A 3L5WA 4P99A 2Q8BL 2QHRH 5CLTA 4S0SD 1XIWA 3O8XA 3WDJA 2CKBH 2NY3C 4HXBL 5BV7H 3CIQA 2A9NL 4TNVK 1H3WM 3ULVH 4HD9A 4NDMB 3L3KB 4QOKB 1PG7L 4PJHF 4GMTH 4UT6H 3FT2A 3TN0B 3ZDXE 2NY1D 2B39A 3IXTA 2UWEA 3D3VA 4L3ED 1QRND 3QEQB 4PB0H 4P3CL 4P2RA 4MDJA 3RGVA 4YPGA 4D9RD 5FM4A 4ZO6A 2Q20A 2WBJC 3BWAA 4JFED 2AP2A 3GUTB 3AS1A 3LOWA 1KJ2L 4P46B 5GRUL 2FLRT 1A21A 3TJEH 2NX5D 1EZVY 3WN5A 4Y2OA 3VA2C 2V7HB 1MCHA 2OL3H 1MCIA 3ARBC 3VRLF 3GSOB 1UG9A 4U33A 1E6JL 3SDXE 1GHFH 3MRQB 1IAKB 2GCYA 3QUZB 5DRWB 1GGYA 4U1MA 4LU5H 5GGQH 4YHLL 2VLME 2Z92B 3IRPX 4HJ0C 2BVEA 3BH8A 1C5CH 2AQ2A 5ITFB 2QSCH 5ADOL 1PD6A 4ZFGL 3MRIA 3BE1L 1QR1A 3QZWA 3RKDC 5B38B 5J1AA 4DTGL 4MA8H 5C0DA 3RZCD 5K9QI 3NCJH 3IDMB 1OAXH 2VLLA 5D5MF 4PG2A 2B5IB 4MAYB 4OGZA 4WU5A 3I6KA 4LGSB 1TZIB 1LNUA 2X40A 1IL1A 2R4RH 4X9IA 4JN1L 1UM5H 5MHSD 3F7RA 1E4WH 4JFXA 3V6OC 1EFXD 5AG9A 4HF5H 5HSFA 4WIQA 1IAIL 4HEPG 3NIDE 3VW3H 3PV7A 3KR3L 5JPNB 2C4XA 3CFKA 4R96A 3LEVH 1N8ZA 3AMKA 2AI0H 1XF3A 4Z7UF 1NEZA 2VZOA 2OTWB 5DJ6A 2JCCA 3GZKA 3K8LA 5E2VH 5L6YL 5CZKA 1CFSA 4L5FL 4JM2D 4P4KB 3ZO0A 3R1GL 3O3EA 5K9OA 1YC8A 4KDTA 2CXGA 5AYUH 1K6QL 5AZEL 5KSAB 2C3GA 5DRNA 3KVQA 3JWOH 4P5MA 2O61B 4F7PA 3M17A 2F8XC 4OQTH 4YDKH 3QI9C 4N8VG 4KQ3L 3I3BA 3TH3T 1F13A 5E6YA 2OQJA 3CDGA 3QDGB 2VDPL 3BN9D 3BKCL 5EBWB 5IOPA 1Y0LB 1XMWA 4XC3L 2D7QA 5IQ9B 3UO1L 1X5LA 1RZKL 1I8IA 4LCIL 5E6ID 5IEKB 4M8QB 1B4JL 4A6YB 3DMMD 3OXRA 3O4LE 3M8OL 1EGJA 2LU4A 2AEWA 3LMJL 1GPOH 5CSBA 1U91B 2RFXA 4GW4B 2XWBA 3WCYA 5D7KE 3RVTD 5JPMA 4R4ND 2FIKB 4FZ8H 1EJOL 2R2EB 3BP7B 1HHIB 3SGKC 3ARDB 1YEJH 1ZVSB 1M7DB 5TDOB 2DAVA 3VFVB 4XWOD 1MWAL 3ZL4H 2V2WB 3TCLB 2MMXA 1CICA 3GHEH 3EAKA 3VJ6B 5D2NA 4XPAH 3VFUA 5DS8A 4OBRA 1F45A 5F7DB 5EBLB 4Y2DD 4UT7H 3VFPB 3H42H 2X4OB 1IGCH 5I71B 4PJBA 4RIRA 3MUZ1 4PR5A 4NZUL 1LP9B 4WTWA 1T1ZA 5DGQA 4D0BB 3UTTB 5C0FA 1VADB 3FZUC 2APWA 3G04B 4NKMA 1D5BA 4J3SA 3MLPA 3MLZH 3DUSB 1X9QA 3QDMD 4JAMA 4F57H 3D87B 1RI8A 4IJ3C 1CE6A 4P48A 1U3HD 4RDQG 3X13B 5IW6A 3U6RA 2FX8L 3TT1H 3JWDH 4OM1L 3AM8A 5JMRA 5JNYB 4W81A 2VIRA 4KI5C 5D8JH 4YFLF 4ZNEA 1IGYA 3HZYA 3T65B 3VFSA 1F4WL 4DKFL 3JTSA 4JPVH 2WQ8A 2NXYB 4M61A 2H9GA 1MRFH 2NY6B 4GBXB 5CJBA 5D7JB 1QSFA 4ISVA 2NW2B 2OJZH 3RA7H 2W60B 3FFCD 1FVDB 3OHXB 3SDDA 1YEKH 5T3ZD 3FAXA 1NCDL 4YDVA 1OAZL 4Y5VA 1IC1A 1T7WA 2I5YH 4YHZL 3V5DB 1YYML 3DX9A 1S78D 3VWKA 4TNWK 5E4EB 2Y07L 4EUPA 1VGKA 1T5WA 2A0LD 1G9MC 4OZHE 4QRPA 1FDLH 2X4NA 3RWEA 3QUYA 2DB8A 1X7QA 1X6NA 2ZUYA 3VFTB 5C2BH 5JW4M 2EXYD 3QFJA 3WV0A 2QHLA 4WTZG 6FABH 3HE6C 4G6KH 2ADJA 2UWEF 1YMME 4GXUM 2C4FT 4KROD 2NY3B 5GRYA 3UTZB 3REVA 3K4AA 1NC2B 2FL5B 4MAUH 1OAKH 5IHLB 2HT4C 3TGXA 1UB6A 2NY7L 5EZJB 1G7LB 4QXTB 2CLZA 5IGXL 3C2AL 2ZUVA 3RUGA 5EOQL 3Q48A 4HT1H 3RZWA 2Q1EA 4P5KB 5C0BB 3IFPA 4G8IA 5DUPH 1NCAH 2NY2B 1GIGH 4JRYD 4OGAD 3SKNA 5DQDH 1ZHKA 2X4QA 3JTTB 3QUMB 5C7XH 2R0LH 3F7QA 4BM7A 2H8PA 3MRFB 4XCNA 3BGFC 5E00A 4V2CB 3DIFA 3RY6A 5KG9B 1F4HA 3Q3GB 3X12B 2O5YL 2NY0B 2CUHA 5T3XD 4JB9L 5F1IB 3CSYA 4MJID 2Y36L 2WUCH 4XX1G 5E08H 4WENB 2ESVD 2YPLD 5GSVA 3GB7A 5CHNA 4EXKA 3GRWH 4LSPL 2NY5C 1MFEL 3BZFA 5HHPB 5HI5C 1DLHB 3EJZD 2UYLB 2VLRA 3FRPA 1IAOB 4YEFA 1JYWA 1FP5A 3RDTA 1CFVH 5FK9A 1LK2B 5KZCB 1G6RA 2CPCA 2ORBL 4LSSL 3LKQB 4OZ4A 4TVPH 1P53A 3FT3A 4EI5B 1R5WB 1RK0B 3BQUD 4HIIA 1XR8A 5I66B 5FA4A 4J4PC 2L7UA 3F7YB 1ND0B 2F54E 1ZA3B 4JFHD 3RNKB 4YE4L 3LKSA 2JIXD 3TZVC 3NABH 3BRGC 3FB5A 5DHXB 1I4FB 5D7LA 3ULUL 1G0YR 3ULUF 2YD5A 3HMXH 2GK0B 5KSUA 4TSBH 5IR1A 4CU8A 1HSAB 5DK3A 1U8KB 2DL2A 1S7TA 4CN4A 5T1MB 3MJ9A 4Y4HA 5SWZB 3TNMB 3RVXD 2OR9H 4DFHA 1CL7H 3MO1B 3P77B 3EKCA 4LKXA 4EXPX 4Y19E 4IRJC 2I9TB 3GHBL 4RMVA 1RVFH 3IDYB 4XCYB 2W0LA 5DTFB 3WIFB 3L6FB 4OSUH 3MODH 2NTFB 1WGOA 1TLKA 5EIIA 1XGYL 4BELD 2BDNH 2XRAH 2AKRA 4U6TA 1BP3B 4IOSD 3QIWB 1EGJL 3WKML 4QRUA 1KJ3L 4HUUA 4PTTA 2YHGA 1U8LB 1P6AB 5HHMD 5C0AB 4MLSA 4HXAH 2BCKA 3VGBA 1AGCB 5DURB 4FA8A 5IWLA 1PAMA 3L95A 2A77L 3C5ZA 5DMYA 2R1WA 4U6XB 4LPWA 3TBVA 4UBDC 1CFBA 1NFDA 2WWKO 3H9YA 1MNUH 1WBZA 1DBBH 4N0UE 5DR5L 2YZ8A 2SEBB 4KVNH 3UAJC 5CD3A 5IV2B 1CD1A 12E8H 2NW3B 2VL5A 1FAIL 2HWZL 3NZ8A 3DBXA 5F7UA 3VGDA 4OLWL 3VRIB 5D93C 3UC0L 4ZXBD 2A38A 3V52H 4HKZB 4IOFC 2FYYB 2C26A 5IQ7H 2H32H 5DJAB 5HYSB 5EU4B 3DO3A 1F4XH 4PJBF 4JVWA 3RHWF 5I19H 2AXFA 1AJ7L 5K9KA 2LAGB 3RIFK 1WWWX 4XXDB 1NJ9B 3FO9A 5EWIH 3VGEA 5JW3H 1YEHL 3UDWC 1MHHB 1TNNA 1JCKA 5DJCA 4NQSA 5LGJA 1HNGA 4YXKH 4HIJA 1XGRA 3P4LA 1J1OH 2HMID 5IFJA 5F8RC 1H3GA 1Q9OA 4MB3A 1QLFB 2MPAH 3QEGH 3B2VH 4KJPC 2BNQA 3D25A 3QQ4A 2VABB 4XAWL 4OF8A 3C5JB 2ICWJ 3WEXA 5E7FA 4HJJL 4HIEB 5D72H 3WFEL 3A6CH 4DGYL 5I1CH 1BLNB 1TJGH 5DRZA 4TUOA 4LSTL 2ERJB 2MHAA 1G7JA 5CIPB 2FSEB 3KDMA 4ZTOH 3SCMD 1W72A 2BVOA 4Y1AA 4KPHH 3NH7H 4A2LA 3FQRA 4U1IB 4R4FL 2HRPL 3LPWA 4UQ2B 2F8VA 5FM8A 4LRNL 2A1WH 1ZTXH 5FGCB 4C4KO 1M6OA 3UTQB 2FEDD 2HFEA 2FECL 4ZOEA 4LQ1A 3UCRA 5DJZB 3OZ9L 3L1OH 1LE9A 4JPIA 4RGNC 3OF6A 3H9SA 5MEPB 5I1EL 3PWJB 3I75A 3S8WA 4NHUA 2IJ0C 1HYRC 1YNTB 1H15A 1ZGLB 2X1OA 3LVEA 4N5UA 5HHNB 4UNVA 1MY5A 3AREB 3SKOA 2A6KB 5FB8A 1J0KA 2D03L 4PJ7A 4OLUH 3VXNA 3MZTA 3CH8A 3RL2A 1B0GA 2AJXL 4CDHA 3IGAA 4JRXD 1TQCB 3B5TA 3QDGE 3RL1B 3TPUA 3VFGL 1MCJA 1N64L 5GS1C 1H5BC 3DX8A 1FYTA 4G8FA 3LS4L 3PQYB 4PJ8C 3DTXA 3ARFA 2DDQH 4GQ9L 4ENEC 2EKJA 3JUYA 3SO3C 2XN9B 3TT3H 3HPLB 4JO1L 1U8JA 3U0WL 2CKBA 4L3CB 3D85A 1J5OH 4HPYL 3BD4A 2MTPA 4NCC1 2OLDA 3FFDB 4DZ8B 3IF1B 3RBSA 3IFNL 3QHFL 4L4TB 1BOGA 1R0AL 1YPZF 4OF5A 3IU3A 2WWMC 4P2OD 3VXME 4JFOA 3MXWL 5I15H 3L3DA 4HFWB 5FA3A 3MROA 3VCLB 3IDGA 4E0RA 2DJSA 2DQDL 4NZRL 1G0DA 3QIUC 2IGFH 1DQMH 4M1CC 4K9EL 1TPXB 1S7WB 1Z0MA 3FB7B 5B39B 1Y18B 4OLEA 3MV01 1DQJB 5GJSL 2IANA 4ZPTA 2DWEB 2HFGH 1T83C 1G6RL 4NSKB 3FN0H 2VDLH 4U1NA 1LP9E 4Y88A 2OK0H 1BZ7A 3UTTE 1UZ6F 4X7EC 4AZ8A 5JOPD 1WT5A 2JE8A 3A6BL 4L1HA 3L7EA 4G7YL 3GJFA 4NM4L 3LRSA 4HK0B 5DD6B 3MOAL 1MFBL 4HMCA 3Q1SL 1F6AB 3NFNB 2JB6B 4P2QB 4AQOA 5JXEC 1JZ6A 3P4OB 4IRSA 4O2FA 5ITBL 4ZUVB 5I18L 4NUJA 4G9FA 4HV8B 2YUVA 3P30H 3MJ9L 2V5RA 4N1HB 3GEWB 3CVIL 3HS0A 4M03A 1JF6A 1S9YA 3IJHA 4HFUL 4ZD3L 4OGXL 4D0CB 4HG4J 1VFBB 1YMHA 5FYLD 1JBJA 4XAKD 2JB5H 2RBLA 4OCSH 1WBXB 5DMJB 5I1LB 4FFWC 1H0DA 3DGGB 1SMOA 1U36A 2IPKA 3QB7C 5JLZB 4NWUL 4CVXB 2DQCL 4NZDA 1CBVL 2A74A 1T2XA 2J8OA 4LCUA 2DLFH 4C56A 3MNWA 4DUXA 1EAPA 4WWKB 4AEIL 4CKVX 4BFIA 2KBGA 5L8KB 5GS2D 3HE7B 3QDJA 3F7VB 3HNTL 1NFDF 4IRZL 3QULB 5D96C 5TPWL 3VXRA 4L9LC 1J1XH 4OCYL 2GJ6D 3GMLB 1RIVH 3KJ6H 4NQVA 4KTYA 1MLCB 4W6XB 1RUKH 1IEBA 5GISH 1BQHB 1MH5B 4JDTH 5E8PA 3NPSC 2P5EA 1L4IA 5FDWB 4P5TD 4NQTA 1OQOA 5DJDA 2CLVB 5EO0A 4GG6E 1GOHA 1T7YA 4KHXL 1G1CA 1GCFA 4YC2B 1DBKH 4NBXB 1F8TL 1SM3L 4TNVF 1PVHA 4G7VL 3MLWL 4OLVH 5D93B 3EJJX 5DEFA 2WWKT 4NN5C 5JO5B 1V3JA 1I9EA 1EO8L 15C8H 4XBPB 1MQKL 1XIWC 3O8XC 4FMFA 5HHOB 2X44D 3CX2A 1VFAB 3QCVH 2BRQA 2FCBA 1D5ZA 1DN0B 4FQXA 3W0WD 5CZXD 3VXPA 1FL6A 4U3HA 1AFVL 3HG1B 3HC3L 3WHXA 1CFTB 3G5ZB 1URLA 1CLZH 1ORQA 1XR9A 5E94B 3S4SA 2IQAA 3SKJL 3V0WL 1NGQH 3HN3A 1OTTD 5JHDE 3JV0A 4PJHB 1MPAH 3RGVC 1X44A 1LHZA 4XNYL 3KJ4B 1ED3A 1DSFH 1W72L 3WN5C 2P5WD 4CU7A 1BZQK 2UZIH 1BIIB 1FZKA 3QXVA 5K59F 1IGJA 1YZZA 3CK0H 2EO1A 4NZTL 1CFNB 4UOW1 3UPCA 1HINL 3TBYB 2Z31A 2ICCA 1JFQL 4Y4KB 3E2HB 3QHZL 1AXTH 1IKNA 1IAMA 3LQZB 2PXYD 1NDGA 4PJ5A 2ADFH 4R2GB 1BD2A 3D0LA 4KGLA 3KXFB 5C1MB 4KI1A 3KYMA 4LPCA 5GGVY 3VXUD 2NYYD 2PETA 3UBXA 3VG9B 2MCPH 1KIPB 4RGMB 5SWZE 5F7EL 1NSNH 2EH7L 4PG2C 5FECA 1ZWIA 3BVNA 3SJVA 1F6FB 1KC5L 5ESAA 4C4KT 1MFAH 5LCVL 1UXSB 4PJ7F 4O51B 1OF2A 4QTHA 1XF4B 3GBLA 3FMGH 3EFFB 4TTDD 1CGUA 3PDGA 1IGML 1VPOH 4R8WL 5AD0A 1RJLA 2HJKA 2DMCA 5D5MB 1QSVA 1KPUA 2PYFA 5C3LD 3LSOA 4R90H 3STLB 4F7MA 4UUJA 1DE4B 2OMNA 1CD0A 2BNRD 3QG7H 5DFVC 3P73A 1ONQA 1JPGB 3I9GH 4QHKJ 2CKBL 5E2JA 5C0AE 3O45A 5BV7L 4NRYA 1RK1B 4JO4H 3L3IA 4MD0B 4YNYA 3W2DH 3ULVL 3ULVF 1J8HB 4KDTC 1DVFD 4GMTL 4UT6L 4PYGA 3X3FH 4Z7UB 3ZKXC 5D6CB 4KZEL 3HI1A 2EDOA 4FTVD 5T1KB 3MR9A 1YN7A 3BDXA 4ZQKB 2XFXA 2YUWA 2QADC 2DQEL 3CMGA 4RA0C 1GOGA 5EU7C 3N0PB 4J8RA 2KDGA 1EA9C 1IFHL 1BOYA 2CDFB 3QUKB 4EDWH 3MV9B 3ZMRA 2DWDA 3TJEL 5GS3A 3UTOA 4YDJA 1K8DA 1LO4H 3UMTA 4FQIH 4QCIA 4PRIB 3OKDB 4MNQA 5H35A 3MPCA 2R0ZH 5C08E 3O3AB 1WAAA 4WU7B 5KJRH 2AK1H 4KZDH 2RCSH 1UADC 3IDNB 1BQLH 5FUCC 3FHQA 4AMKH 5FUOH 3LEYH 1SYVA 5C6TH 3GSRA 4LU5L 2K9UA 3FTGB 5GGQL 1QFHA 5DO2D 1SYSB 5CGYD 5FV2A 3INUH 3QT2A 2BHYA 1OLZA 4U1KB 3S34L 5C0IA 2QSCL 4KK8C 1FNGA 2R0KL 3GRWA 1CICC 3MLXH 5EPMB 4MA8L 3NCJL 1CDIA 2XA8L 1OAXL 3PXHA 2N56A 43C9B 4X9BA 3S3JA 3U9PH 1R5VB 4Y4FA 4MD5B 5T3XH 3IETA 3GSXB 1G7HB 1JI2A 5IBTH 1QLRA 2AV1A 5C09B 3PHOB 5I8CA 3BEWB 1MWAB 1UM5L 4P2YA 1E4WL 3WS3A 2BP3A 2AEIT 4HF5L 1MVUB 5AYQA 5I2IB 3SY0B 1K4CA 4XPFH 5HI4C 3LEVL 3GGWA 2AI0L 5EUKA 3RWFB 1UQSA 1U92B 1NKRA 3H9HB 4RAVA 2DI8A 5E2VL 5HDOA 4NOFA 3HMXA 4ZPVA 5IG7B 3QIBA 4ODWA 5J8OA 1U8IB 3MNZB 3AM8C 4LCYA 4EI6B 3JWOL 4U0RC 3DXAE 1OGTA 4N0RA 1HE7A 2YK1L 3BXNB 5DYOA 4G6AC 4HHAB 4V1DE 2IC2A 2PW1B 1ULVA 4YDKL 1GC1C 1KCSH 2WK2A 3B9VA 5DJ8A 4TNWF 3U36B 3K8KA 5I30H 4XP6H 3SDDC 5JA9A 4OLZH 4S1SH 2XXMB 2ADGB 4WJ5A 1M05A 3IDIA 4Y5VC 3NFPA 3RAJL 1ZHLA 1NCWH 3BDBA 4P23B 3PQYE 5B22A 4OTXH 1WSST 3MX0A 1FJ1B 3VWKC 3FOLA 3GMNA 1U8OB 3T77A 1M7XA 1YY9D 1LD9B 4JREB 1GXEA 1TVBA 4MWFA 1IKFL 1ADQH 1GPOL 3QUYC 5EC2A 1NBZA 4HGWA 3SKMB 2HLFC 1KT2A 4ZOAA 2D7TH 4JFZH 2F5AH 3O2WL 1G9NL 4FZ8L 2EZ0D 4PGBB 1A1OA 4LEOB 2QSTA 5DK0B 3NIFF 1UH4A 1YEJL 4QXWA 1DBML 4NUGH 1PX4A 3ZL4L 3NCMA 4CL7A 3LN9A 3D0VB 5BRZD 1P4LA 1JHLH 4XPAL 5FGRA 3MBEB 5LAXB 1HQ4A 4UT7L 5HXMA 5IB1A 3O11B 2UWEB 2JK5A 3H42L 1IGCL 4DCQB 2AAVA 5HGBA 1CGSH 4N8CH 3WFBH 4MA1C 3WFDL 4H26A 3PWLA 4MDJB 4PRBA 4LQFH 4YPGB 3T0ED 3IXAB 5B4MC 1LQSR 4YUEH 2ICWI 1YQ2A 32C2A 1QHPA 5F1NA 4LVOB 4F57L 1SQ2N 5C0ND 1NL0H 4LSQH 2V5YA 1T22B 4PJAF 1T5XB 3RY6C 5E5UB 4U1LA 1G7PA 3CVHH 1RUQH 2IFGA 1D5MA 1Q0YH 2WIIA 5CD5D 1QLEL 2VITB 1U8PB 4FRWA 1OL0A 5I75B 1X5KA 3H6JA 1MRFL 3EJYD 3I02A 1F6LL 4U1MB 5DZOA 4K9EC 5I1AB 4M7JL 2OJZL 1G7MA 1LEKB 1EZVX 3RA7L 1ZLUH 3BH8B 2ZKHH 1U58B 1JK8B 3HI6H 4QT5B 5ICXA 4QWWD 3MRIB 2E6JA 2ICES 3QZWB 1JNHA 1O7VA 2AJSH 4H20H 2I5YL 3MUHL 4WI3A 4BFGA 3VDAA 3EDKA 4Z78A 4JFFB 1JPFA 4WU5B 1JZ7A 4JG1H 4PJEF 4MLIA 1IL1B 3FT4B 3BP6B 4L9DA 3HMWH 4PREA 2XKNA 5SV4A 4UV7H 3FQTA 2ZCKL 1EDQA 3CXDH 3IVKB 5C2BL 5DD5H 6FABL 4NKDA 4RNRA 4R96B 1N8ZB 1JPST 2W0PA 4HUXB 1XF3B 1ZGLM 1PYWB 4G6KL 3K1DA 5DJ6B 4APQA 1BQHG 3RU8H 2NNAB 2EXWD 3F12B 1OP3K 5HGHA 3KPRD 2VN7A 4MAUL 2E5EA 1OAKL 4ONHB 1MCNA 5HDQH 3IJYB 2OZ4A 4P5MB 5I74C 4HUNB 3D39E 3DRQA 3M17B 5IMKB 2HFFA 3U7YH 1JUFA 5DUPL 1NCAL 2QADB 1GIGL 1SY6A 2V17L 4MXVF 3I6LD 2V9TA 4PGZA 4X83A 5L2KD 5DQDL 2OQJB 3CDGB 2KZWA 4Z7WA 5C7XL 2R0LL 5IOPB 3T1FB 1WAAF 4QRRD 1SJVA 4IMLA 4PP1C 5IWLC 2CQVA 4JZOB 4NQDA 1QQDB 4FXGA 1UYWH 1TVHA 3OXRB 5CINH 5EU6B 8FABB 1GGCH 5EIVA 2GAZA 3FB8A 2NQCA 4MXWH 3HG1E 2WUCL 5IHUL 1RIUH 3UX9B 1BFVH 5IVOA 2RFXB 4QHNA 1K4DA 1QO3A 3GRWL 4XP4H 2C3XA 5C0CB 2H2PD 3W5MA 3V7MA 4P9HL 3RIFF 1QG3A 1FL5A 1JNLH 3DVNB 1WIUA 4L3EA 4JKPH 2R4SH 3EDDA 2PYEB 2E8ZA 3UTPE 3HA0A 3U46A 3BD5A 4TVPL 2E8YA 2FZ3B 2EEDA 4X5WA 2JJUA 5D2NB 3TVMC 1AO7B 1E0OB 4JFEA 1A3RH 2YA0A 3LQAC 1Z5LA 2NX5A 1JGUH 4PJBB 4YHNA 4RIRB 3NABL 1SEBA 2R2BA 4UDTA 1A3QA 2QQLH 3HMXL 3EO9H 3VRLE 3V2AR 5C0GA 4TSBL 4NKMB 3Q5YA 4YWGL 1A22B 1VKXA 1D5BB 4Y8DC 3VG0L 2EDYA 2W65B 4JHZA 5KSVA 5GRVK 3MJ8A 4K23H 2J5LC 1YEDB 4JAMB 5AZ2H 5BXFA 2Z0BA 2GUOB 4RGNE 2H2SC 3MCLL 1CL7L 3DVGB 4NM8H 3QPQC 1MCKA 1RVFL 1HYSD 5DSCA 1FCGA 2VIRB 1P69B 2IH1A 4NQCE 2VJXA 1IGYB 2LTQB 1OWRM 4U0RB 3VFSB 3RZCA 3JTSB 4OSUL 3MODL 4M61B 2H9GB 4ZSOE 3NMEA 1W0WA 5D5ME 2FEEI 2VXUH 1QSFB 3CC5A 4ISVB 5ENWB 2BDNL 2XRAL 4TTGA 5DFTA 4IHOA 5FYLH 3REWB 5D70H 2D2OA 1ACYH 3VFWB 1P7QA 3QHTC 3VDCA 4JM4L 5TGBA 4YDVB 3R06A 4WUKH 5GZND 4LAQL 3HZVA 4EUPB 1ZHBA 5F93C 1PKQA 1CDBA 4Z7UE 1IC5H 4QRPB 1MNUL 5IMMA 2X4NB 1JN6A 1DBBL 1I9IL 1WZLA 3RWEB 5MERA 4PB9H 2IADA 1UENA 3AXLA 3B9KA 4KVNL 4JM2A 3MV8A 1FO0H 3QUXD 1X7QB 1CZ8H 4L8BB 1KIQA 3QFJB 3QNZA