3RVUD

Structure of 4c1 fab in c2221 space group
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
221
structure length
221
Chain Sequence
VQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISYSGTTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCGRTGVYRYPERAPYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 4C1 Fab - light chain
total genus 45
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvuD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvuD01
1DQJA 3VDAA 4U1GC 2AVGA 5DEGB 3QUYC 4ZUUA 3CX5J 4U0QB 5F7HA 3L3IB 4IDLA 3S36H 4P2QE 5FHAH 4L8SC 2P5EB 5L9DH 1IEBB 5JDSB 5SX4I 4TNWK 1SJHA 4LRIC 5IKCB 1JE6A 1A6UL 1NMBL 3AS2A 2QHLA 3DURA 3LZFL 2ILLA 3O11B 4JDZA 5CGYC 4LASH 1ZS8A 5GRUL 4PJ8B 1A9EA 4TUJA 2YWZA 5DMGD 5EZJA 4NO5B 2G2RB 4KMTL 1NSNL 5ISZD 3TJHD 3TBSB 5D7KE 4YBQC 1XIWD 1AR1C 1VGKB 4NN6B 1RJYA 5ALCL 4R4NC 3GBNH 4AMKL 1SEBB 3MNZB 2IANB 1PD6A 5D6DC 1I7UB 3HPJB 4XRCA 3ESVF 2AERT 1CICC 2Z31C 1MCSA 5T1KD 3ET9F 4PY8I 1U8MA 4HS8L 4M02A 3T08A 1JNNH 1A7RL 1YEDB 4M7KL 1E4XI 4UDUB 5KANG 2XN9D 1JF1A 1QRND 4NNYB 3O4LA 5L2KD 3UP1A 2FIKB 3NA9H 2ARWA 5ABDE 2I60L 4KKLD 1T7VA 4BA8A 4OIIL 4KTDH 4OLZH 1XGTB 2VXUH 3EHBD 4JM2C 3JWDL 1YMMB 3FAXA 2BVEA 5IB2B 1HOCA 1XAUA 4S2SA 5KS9F 4HSQA 5J9PB 4YHYC 3UTTB 4LASL 4BK4A 5GS0C 2H3NB 3F58H 1DQDH 3LS5H 3SKMB 5C2BH 3UO1H 2AJZA 4AIXA 2CK0H 2VRAA 4M1DH 1P9MA 4LSUH 4WJ5A 1XGQB 2GUOB 1T1YA 4JFYB 5FYJE 5LAXB 1JWSB 1OTUD 2DQCL 3V52L 3ZYJA 1G7MB 4PJ5E 3TNMB 3P9WB 1UEMA 3IJSA 2D9QB 5ICZA 4RZCA 1A0QH 2NY3D 1CQKA 3VJ6B 1GGIL 3PHOA 4Z95L 4XP4L 3BQUD 2P8MB 1JRHI 3MUGA 4YLQT 3TC9A 1P7HL 3B9DA 5E2WL 1ORQB 4CVUA 3ES6B 4JO1L 4MA3B 3FO0H 3S6CA 5D2NE 4PJDE 1UA6L 3P4MB 4PJ8D 1OCWL 4RGND 3VRLF 4TULL 4G6JH 2P1YA 2KDGA 5DRNA 1QLFA 1B4RA 3BP5A 2EDEA 4YEFA 5CP3A 3FQUB 1B2WH 4IRJC 4MWFB 1QRNE 3HS0A 4Y5YA 2QKIA 4KTEH 1CYGA 5IG7A 2OTUA 1VFAB 1FGVL 3ELAT 3RGVC 1FZOA 1WEJL 5HXMA 3H42H 4YQXH 5AZ2L 4LL9A 3GSOB 3GMRA 2XRAH 3C09B 3TO4C 4GAJL 3O4LD 5L2KA 1RJYB 3MRQA 3BDXA 3VCLB 3NCYS 4XGZB 4GW4B 3DUHA 3SQOH 1UXSA 3M8OH 3FN9A 3N85H 3QA3A 4LMQI 1QSED 3C8DA 1UM4L 4NOBA 4GMSH 4EN3A 5IB3A 5IP4A 5KS9E 3JV4A 1RUQL 3OKDB 4KFZC 1JIBA 1D9KD 1ES0B 3KNBB 2UYLA 3X3FL 4GT7A 2OQJB 4X98B 1EEYB 1FNSH 5IFAH 4FQQA 3E2HB 5E5MA 4ZUUB 4XX1E 5BV7H 1BFVL 2MCG1 2QSQA 1S9XA 2EICA 2LVEA 4WUUD 4GMSL 1JWMB 3QXAB 4Q9QH 1G0XA 3HAEB 2E6PA 4XT1C 2EEBA 4JREB 5AYQA 3KYKL 4KKAD 3H9HB 2CK0L 2A0LD 2JJVA 4L1HA 4D0BA 4NO3A 2M2DA 1BBJB 1N8ZA 1C7TA 2EDNA 1FYTD 3L9RA 1A7OL 1C5CH 3OR7B 4HFWB 5I30H 3KYMA 4FQXD 2I9TB 5ADOH 1FBIL 3I02A 1Q9KA 3OAUH 1KYOJ 3KPQA 4O2FA 2DQTL 1W0YT 3MLVL 1A0QL 4GRMB 2GTWA 1T66C 5F7DA 3HNTH 2AEPL 5DFTA 3RGHA 5B38A 5I1KL 4CMHB 1NGWA 2WP3O 3S7GA 3LB6C 5HVGB 4WUUA 4ZTPH 3QNYB 1H9VA 1IAOB 4FXGB 5J6HA 1HSBB 1X5FA 2XZZA 3EDKA 3PDGA 2BY0A 1T03H 5HYEA 1ITBB 5CJXA 3Q48A 5L88H 3G9VA 4K9EH 2A0LC 3L3GB 3C5ZA 3ZE0F 3TH3T 3H3PH 3EO1A 2UVEA 3EYOB 5F9JA 5KSVB 5FIEA 2DB8A 1SY6L 4G8EA 5D7JC 3U1SL 2DWEB 5C0FA 1BEYL 4Y1AE 5E8EB 4PGZA 3RWGA 4UUJB 2CMRL 1KOAA 1WIOA 2XA8H 4Y4FA 1KIPA 5DJ2A 4A6YH 1MIMH 1URLA 1P6AB 1JYVA 2V17H 2BRRH 2EIBA 1KPUA 3LPWA 4GRWH 3CFEB 3NIGE 2BRQA 1CD1A 2MTPA 3QEQB 1OAYL 2I5YH 4OCRH 4ODUB 5C3TA 3TJEL 5I16B 3MRNB 5JOPE 3GSRB 3DYOA 3QWRD 3ZTJH 4X5LA 2K9UA 1MCWM 2OK0H 2JJSC 1UM6H 3LQMA 5B4MD 2JB6A 3CFJB 3BYTA 1H0DA 3OHXB 5HYFA 1CTOA 1KTDB 1F3DH 4P48A 3BD3A 5EORL 3BDYL 4DWHA 2X42A 5BV7L 1ZLWK 5MERA 4G7VL 1MCKA 1QNZL 3ARGC 1SY6H 2FECL 5GJSH 2XQBL 4IRZH 1X5GA 3CCHA 4LOUC 4OF8A 1Z3GL 2BSRA 3GI8L 4UV7H 5CZVL 4Y19B 1OW0A 1WC7B 3MLXH 3N50A 1A3LL 2O61B 4X6CA 3KYKH 2L7UA 3ULUD 4HKXA 5FO9B 3IXAB 4JZOB 2CRMA 3ISWA 4WDIA 4PYGA 3BPCA 4X6EB 1EEYA 2VDQH 2XG5A 1UFUA 4MB5A 1IAIM 5JHDB 1CLOL 2FGWH 4P0DA 3HR6A 3RY5A 1JWUB 1EO7A 5I18L 3RBGA 4NZUL 1RIUL 1JGVL 1FQ9C 4MDJA 4YUEL 4LCCA 3WE6A 5C1MB 2D7PA 5F7UA 4B0MM 4I3GA 4XXDA 5DA0B 1UG9A 5FDYA 5B21A 2LU4A 4NQVB 4LLAA 4U6TA 2XQYK 4KJWC 1NAKL 2E5EA 3QCTL 3ZTNL 3FQRA 5DJCB 4D9QD 4TVPH 3QEQE 2QLVB 3EO9L 2OJEA 4TSCH 2UY7A 4ZUTB 4Z77B 3EDDA 5DJ2B 2HTLC 2OZ4A 1NDGA 4LPWA 5DFWH 3I75A 4JR9L 3GBNL 1OB1A 3EYSL 4XVJL 1KT2A 3U7YL 5EBWA 4AMKH 5FYKH 2BOCB 4ODUA 3BEVA 1IBGH 5J8OA 2YD2A 1QLFB 3TVMC 4LP5A 5GGVL 4Z8FH 4Z7UA 4Q74A 2WUBL 2J1KA 3I9GH 1N4XH 1I8LA 1Z9LA 1QPPA 4KTDL 4X6CB 4XPFL 2EXYD 4KC3B 3BN3B 5J12B 3M8OL 2BSRB 3A67H 4KWUA 4MAYC 1I85A 4H1LB 4Q9RL 5KZCD 5DQDH 4NC0B 3F58L 1MCLA 3O3EA 4FXKB 3STLB 1FCGA 5C7XH 4DAGH 1C16A 2BSED 3VXME 4HJJH 4OQTH 2DQGL 1DQLL 3AFLA 5EBGA 4HIJA 4MJ2A 3KJ4C 2C3VB 3NA9L 1ZGLB 2I60H 4JKMA 5B38B 1EMTH 3SKOB 2A6IA 4ERSL 1Q9WA 2OMNA 1KCRL 4HG4J 1K8IA 4BFIB 4MA1B 3DSFL 1AIFA 5J6GA 1A6ZA 4ACPA 1VHPA 1RFDH 1DQML 4YDLC 4HKZA 2EDQA 4NNXA 1P4IH 5C0JA 5LJYH 1N2RB 2FX7H 2Q76B 3TBWA 4FQ1H 2FDBP 4YDKL 3GDBA 1R3KB 1WGOA 1J0JA 1KBGH 3VRIB 2XXCB 2FD6L 2EC9T 4G6MH 3QYCA 2C5DC 3PDOA 4XBEH 4KI1A 1G7QA 5FA3A 2R9HC 2WV3A 1EXUA 2YPVL 1NCAH 1ZT7B 5KSAB 3BQUA 3SDCC 3RVVD 4ZO8A 5GGRA 3ZTNH 1N3NA 3DX6B 3KYNA 4KV5E 4QXGH 1JGDB 2X4TA 3MROB 3BGMA 2Q7YB 4E41D 5AUMA 4U1KA 1HWHB 4X7FC 4XNQA 4FQ1L 3U6RB 3EFDL 1W8NA 4JO4L 3RNQB 1H3TA 2CIKB 2R2HA 1T0PB 3MV8D 3P73A 4MX7B 4B50A 3OKEA 3C08H 5CWSB 4OAWA 4ZSOA 2Q7NA 4LK4A 1O7SA 1WBXA 2F58L 2Q8BH 2KH2B 1IBGL 2WP3T 4IIQA 3IXTB 3P77A 5EN2A 4F7MA 2X5PA 4JFFA 3B5TA 5DDHB 3U2SA 4OZIA 3IGAB 3JWNC 3DVFA 4H20L 4MWFA 4XMLH 2D0FA 3QQNA 1JJUA 3B4NA 2BNQB 1G84A 5GGRY 3OKNB 3WS6A 1I9JH 1FZOB 2HFEB 3OJMB 1SYSB 4YGVA 3QUXC 4ODWA 1KF9B 4OBSA 3MRLB 3RWCA 1IGTB 3MYZA 4MA3A 4FZEL 3ILPA 1R5WB 4R96B 4O4YL 3HPJA 1Z5LA 2A6JA 5T1LA 1CIUA 1FRGL 3BH8A 4IEFB 4P3CL 4D9QE 1OP3H 1HHKA 4WHCA 4XVJH 4RFOH 2ORBL 1BHGA 2YA2A 1K8DA 2OBGA 4CADA 4Z7WB 1DFBL 3EJYD 5KSBF 4ZOBA 2G2RA 3QAZC 1W0VA 1BD2D 3LY6A 3I2CH 5DJ8B 2VL4A 4XVSH 4OM1H 4S1RH 4FNLL 4E41E 1PEWA 5IVNA 4RCAA 4M7LL 3BN9D 2P5EA 4N0UB 2R23B 4K8RL 3DHMA 4QHNB 4NN6C 3GK8H 3T2NL 1UVQB 3DI2B 1KNOB 1C12A 1OD9A 4DQOH 1KPRB 2MHAA 1NL0L 3TWCH 2JK5B 2AJUL 4OF3A 3MLSL 2GUOA 4OI9A 1JHKL 1AP2B 2WANA 1J5OH 2AK4B 1IGIH 2I9TA 4IBLT 2XZCL 5KW9H 2QHRL 2ID5A 5EOCH 4ODWB 5JOEA 3JTTA 4IRJD 2Z91A 3SY0A 4HZLB 5EG6C 1F90H 4MLSA 3OKNA 4GRLB 3O3BA 2JK5A 3I3EA 3W9EB 1G7IB 2E9IA 3DSNA 3FT3A 4HH9B 1GIGH 1S7RA 4PFEA 5EN2B 4F7MB 4GFTB 3BE1L 3IVKB 2ZUQB 9CGTA 4OIBA 1U8MB 4P2OC 4LSDA 5EO9B 2X1OA 3FL7A 4OCXH 2HRPL 3T3PE 4HBCH 4JCMA 1YC7A 4YXKH 3JTSA 2Q8BL 5DHYB 4G43A 4X6BA 1ZVHA 1L9MA 4G6FB 3F5WA 3QHZH 2VABA 5DTFB 1UEYA 5GIRA 1FFNA 1F97A 5GGSY 3GIZH 3LPGA 4ODTL 3E8UH 2X2YA 3LMJH 2B7DT 1S5IL 2J2ZA 5I74C 4QCIB 1SVCP 1FL6B 2XI9A 4NN5C 3MGOA 4MJIA 3W0WE 2FBOJ 2IPUK 1FE8H 4AM0B 2V17L 3K8LA 4Y2DA 1CDIA 4WU5A 4YXKL 1ZSDA 3SDXB 3GI9H 4J7RA 2CR6A 4QO1A 3WSQH 1QO3A 1W72B 2GK0B 5I1DA 4H88H 4HUKB 1SEQL 3RHWK 2PTVA 3G5VB 3MLTB 4OZIE 4LP4A 4NNYA 3T04D 2UWEB 1A6ZB 3QUKB 1FIEA 3EYVA 3VXOA 4CMMB 1ED3A 2ARJA 1DQQA 3NH7L 4LEOA 3HAEG 5E56A 1N64H 4R0LA 1T03L 3QIWC 4OAWB 5DJ0B 3TT3H 4KJPD 4AEIH 4APQC 5EO0A 1U8HA 5C0BA 4HLZH 5C07D 1ZA3A 5D7KD 5HGAA 2FWOB 5DJDB 5IJVA 4RFNC 2O5XH 1D5IL 1AGFA 2CMRH 4C83B 1QR1B 3VFNA 2VE6B 2GHWB 4PBVC 2Q7YA 5KOMC 4HK3N 4HJGA 4G7YL 5JIIA 1LE5A 4ETQA 3MNVA 3LS4H 5DJYB 4LFHG 1N2RA 1BBDL 1ADQA 4IJ3C 3O6LL 3D85B 1PG7W 1Y6MR 1AE6L 4NWUH 4TTDD 1U3HB 1E4KA 4NIKB 1DVFD 4G80A 1S7UA 4KRLB 1G0YR 2NY2D 4ELME 3QQ3A 2PYEA 3IJHB 5KSAC 1SYVB 1FG2A 4M6MH 1DANT 1OTTC 3KGRA 4J3TA 1Z9MA 3AVEA 4LF3A 2VDKH 4G7YH 1SBBA 2BSTB 3LD8C 2EH8L 3JV5A 3HMWH 4Y2DD 3MLZH 4U1JB 4JFEB 3Q5YA 3QRFM 3NCEB 2VZOA 1HSAB 2CLZB 1QA9A 3E2HC 4R7NB 5FM5O 1P5UA 3UCRA 2IALB 3OX8A 3EOBA 4YAQB 1XIWC 3O4OC 5B39A 1KPRA 4GKSA 3GIZL 4GXUN 1H8NA 3U30B 5D9SA 4OLYL 4V1DB 1C1EL 3IXTA 3MBXH 3W5NA 2H26B 2GT9B 1H5BB 1QFWI 5I1EH 1V5JA 2YK1L 4YHIB 5EFIB 4H0GA 3L1OL 4OFVA 2IAMA 1FV1A 3UDWA 1OTUC 4PJAB 3WFHA 4R7DA 1DDHA 2A73B 35C8H 2XNAA 3RWEB 4OLXL 5C07A 3LKRB 3ARXA 1OSPH 4PP2A 4GKZB 4DTGL 5F7KC 1CCZA 2FJHA 4YIQB 4M6ML 3FB5A 3T0EC 3TN0C 1AY1H 4O2EA 5CINL 1FLRL 1TQBC 1OD7A 5TF1H 3BH8B 1MCPL 2OYPA 4LPUA 5DT1H 4NRYB 1MJ7H 2HLAA 3X14A 1PKQE 4DKAA 1YEIH 3RUGA 1CFSA 3NFPB 1OSZA 3QNZB 3F62A 4D0CA 5KVFH 4NKDB 5JPNB 1KB5B 3AM8A 2QQLH 1KBGL 4JJHA 1UM5L 2EDLA 2PXYB 4Q9BA 3CFBA 1VERA 3SPVA 3IDGA 3U0PA 5I75C 4JCLA 3S37H 3SKNA 1XGRB 3BMVA 5GZND 4PJDF 3G6AA 5JOFB 1EAPB 4MD5A 5C0DB 1R0AH 4QRPE 5FKPA 4ZOCA 2IQAA 1OAUL 5IK3B 4HCRL 1GOHA 4HIIB 1AO7B 2CRZA 3QDHA 2ZUWA 1KEGL 3WV0A 5F7NC 2WK2A 1CBVL 5D93C 2FR4B 5DEFA 1K85A 3GSWA 2GK0A 5I1DB 3U4AA 1MFNA 2OP4H 5D7LA 5HJ3B 4YXHL 3VD5A 3KDMA 2FX9H 4JQXC 3P4LA 4ODHL 1T1XB 3PWLA 5FO9A 4AK1A 4X4MA 2XYCA 2NW3A 1IM9D 1D5IH 1U2CA 4I2XB 3PWPD 2NPLX 4LSRL 5C0AE 3VH8G 2W07A 2W0LA 5DQJB 1AJ7H 2LV4A 2QEJA 4IHOB 1AGEA 3MV8A 4KMTH 5C09B 3T8XA 4XP5H 4R2GC 5GSRA 5C71A 4ISVA 1DN0A 5TH2A 4RNRB 3REWA 3VFWB 4JZOA 2NY7L 3FQNA 1HKFA 4XNUL 4F9LA 1M7DB 1J1PH 4HXAH 4X6DA 4PRPE 3GO1L 4Y19A 3RVUD 5C70A 1LDSA 3IDIA 3PHQB 2FJFB 4OTXL 4R4ND 1NGZA 3DJ9A 1RURH 4MMZC 5EZIL 5IFHL 1JRHL 3MV11 4U2ZA 2C1OA 3LSOA 2YD3A 3V8OA 1L7IL 1D5XB 3ARWA 1P4IL 1EO5A 5D1ZB 2XZAL 1MI5A 3EAKA 3CIQA 1RVFL 3MRKA 1NC2D 3SDCD 1KTKE 3P0YL 2YMXL 2ZUVA 4OLZL 3OKOB 5ID1A 2RIKA 1J10A 2VZTA 3L3HB 3C6LC 2PO6B 4KGLA 4K8RH 2A83A 4WHTA 1EFXB 5JA8B 3PQYB 3EGSB 4S1QL 3CC5A 3KJ6L 3MMEB 1A7OH 2H6PA 3I6LD 5F3BA 1T80A 2FCBA 3D85A 4YH6A 2VISB 2LU3A 5GSRB 2HT4D 1K2DB 4OIIH 1UT9A 3BYYA 3RWGB 3IDYB 5FXCH 1X5AA 3PGDA 2I9LB 3EO0A 1YMME 5T5NF 2NW3B 1RU9H 3UTSD 3DUSB 4MJ5B 2WUCH 3ZHKA 4M48H 1NCTA 5J1SC 2CSPA 4MNHA 1EPFA 1MVFA 4FXGA 5J6HB 1UXSB 1CGVA 3N06B 4U1IB 1YNLH 4X7SH 1IEAA 4FQXB 3N85L 1LVEA 4L1DA 1KTDA 4PRAA 5TE7L 2I07B 5DMKA 5HGGS 5GRYA 2GEEA 2JIXD 4RMQA 4L4TB 2R2BA 4RGNC 2VXVL 2WUCL 5IG7B 3D85D 1U6AH 4M62L 3E0GA 1L0QA 5HGHB 5F7EH 2HJKA 3SJVB 4JN2A 4J6RL 3BE1H 4O51B 3VH8A 4KKBD 2D0GA 1MI5D 1KEGH 1IGMH 3E3QE 4YHPB 1FO0H 4RMTA 5IMLA 2AEWA 2HJLB 4ZPVA 3T2OA 4MGXA 5AZEL 1ROWA 3S5LA 4LRNH 4LHQB 1KELL 3UTPD 2VR4A 2UZXB 3M07A 4LOUD 5DI8A 4NRYA 2BZDA 1XF3B 1J0HA 1I3VA 4XPGL 1JZ2A 3P11L 3OF6D 5C0EA 3TA3D 4X7TA 1QEWB 4OCSL 4HPYL 4M00A 3TCLB 2ARJQ 1PQZA 2NXZC 1IEHA 2R0LL 1K4CA 3ARPA 4HW6A 4QLRA 1L6XA 2F54E 1ZVSA 3BQUB 3V6FA 3OHXA 4POYA 3EJZC 3VRJA 2VDML 4DTGH 5F72S 4M61A 4R90L 4PJBE 1A1MA 4MJ4A 2VITB 3B8YA 3C5JB 3MOAL 3L3DA 2NR6C 4YEEA 5DLMH 2P8PB 3ARYA 3TO4A 5BRZE 5J57B 4D9LH 2D0HA 4URTB 4PLJC 5C0NC 4O00A 2X4OA 1ZHKA 1INEH 5FK9B 2F53B 4P5KB 4TUOA 1ZLVH 2H2SC 4Q6IC 1NBZB 3QSKB 1FAIL 1CD8A 1UCBL 3HNVH 3OAYH 4NQDD 4HK0B 1INDL 3NGBC 5K9QG 4KUZH 4PR5A 5TDPB 3CDGB 5IIEA 2HTLD 2ZOKB 2H32H 3C8KA 2HT2C 2NX5B 4XB7A 1NCUA 1NQBA 1Y0LA 3BKJL 3FRPG 4WWKA 3TPKA 1P1ZA 2F53E 1LHZA 1LEKB 1QBAA 3HMWL 2NY6D 5AG9A 3VU2A 1FN4A 3U79A 2VXQL 4JY4B 3G5YB 3FO2B 1PY9A 3QBTB 4HIXH 1CGSL 4FQIL 4P9MH 1FNLA 3CXDL 1WT5A 1ZGLM 3VJ6A 4OLXH 1RZ7H 2DICA 3O9WC 3VGDA 3HRZB 4PB0H 4ZDHA 4NQDA 1XF5B 2B4CH 4M6OH 2VLMD 3D5OF 1MAML 4O5LL 4OT1H 4PGDA 2H45A 3U9PL 4I5BB 2DD8L 1K8DB 4GW4A 3CSYA 3WS6C 4GLRH 2HJLA 4Z7UB 5F97E 1MEXH 1UADC 4OGXH 2QQLL 3CJJA 4OV6F 4RMUA 1KB5H 3SE3A 1Z2KA 4OLEA 1NCCH 2XN9B 3ZDYF 5AEAA 3QCVH 2KUTA 2MPAH 1HQ4A 2P5ED 3BESR 4JDTH 4U6HA 5DD5H 4A2MA 1BQLH 5MI0B 1FLRH 1PKOA 1BD2E 4PJBF 2XA3A 3QP3A 2YR3A 5EU6D 3MJ9L 2EH7H 4FQHB 1HHIB 3NGBB 3BRDA 1WICA 5ERWA 5C0CA 2F54B 3BSZL 3KPOB 4XZUB 4LVNB 4NQXA 3RHWF 3P77B 2ICWA 1XF4A 1FL5B 2HTKC 1WBXB 4NGHH 2VC2H 3CDFA 4NQDB 1Q9LB 1R5IB 5E1HB 3LKNB 1WJ3A 2VLKB 1IC7L 1FIGL 5K9QI 3KJ4B 1OL0A 2ICCA 3GBLA 4PJGB 1DL7H 2QSTA 2IPUG 2YBRB 1IRAY 3B2UC 5BVJA 1RK0A 5E08H 2BP3A 1AGDA 2CQVA 3DX6A 2HH0L 1U3JA 3D18B 3F5WB 3K7UA 1YYML 3GJFA 4PJ8A 4LLMA 4TOYL 2EIZA 3TN0D 2FJGB 1ZK9A 1XF2A 3TZVC 4YDJB 1WBZA 2MPAL 3TBYB 2X89D 1WLHA 2KZWA 2IMNA 4NYLB 5C9JA 1UM5H 1Y0LB 2AJZB 1E6JH 5JDSA 4MXQD 2QR0A 3NZHH 2DF3A 4Q0XL 1HXYB 1DN2A 4PJ7B 4PB9L 3RTQC 4IOSD 1G9NC 3VH8B 3K1KC 5CBAA 5ID0B 4AH2A 1KACB 4K7FB 5BXFB 5CEZL 5HHXH 5J6GB 5LCVH 3VFVA 3G04A 5EBLB 5T3ZH 1MRFL 2BK8A 1UQSB 1YN7A 1CS6A 4L3EB 4XNMA 5EUOB 4QRUB 4IRSC 4ZFZB 5MEQB 2Q1EA 5IGXH 5FOBA 3O9WD 4Y16A 2XY2A 4X8JB 1U8IA 3KLHC 3RWIB 3KPSA 4JKPH 4OLUL 5BV7B 5F6HI 1HXMA 4HD9A 5JUEH 3WXWL 3SDDA 3F6IA 1KPUB 2ENYA 3ETBF 3ZT5A 4NM4L 5GGUB 1ZVSB 2J7LA 1YA5A 4QHUB 4JPKL 2CIIB 1JZ5A 5IWLC 4O9HL 1YJDC 1KJ3L 2D7TH 1F02I 1CFTA 3TV3H 1NMCB 2EDRA 2ZUTA 4BZ1L 1QLRB 5T3XL 5C0EB 3BZFB 5F7MC 4HF5H 3VMOA 1IM3B 3V7AG 5TDOA 2YPKB 2EXYC 1EBAA 4PB0L 4WW2F 5GS1C 4JM2D 5DD0H 3SCMB 1A1NB 2JELH 4MJ6A 1CR9L 3RX7A 1F8TL 5ACMA 2AP2A 5D1QB 3MO1A 5F7LB 1H8SA 4MQ7B 2E27L 3NFNA 4YK4B 5ESVA 3FO1B 3S36L 4NHUB 1JK8B 4LCUB 2WWMC 1RHHA 3RTQD 3GSNL 4MCZB 1CU4H 4OZFH 2DMCA 4EUPG 1VFOA 4K7PH 4OZGF 3TIDB 1BZ9A 3BIKA 2F5AH 1H3UA 1KEMH 4UU9A 3VI4E 2MQCA 3B3IB 4Z7WF 1F5WA 5EH1A 4LVOB 4XAKE 3CX2A 5FB8A 3IU4L 3DTXB 4KZEH 4U7SA 5IEKA 3TBVB 4FQLH 4LCCB 1MY7A 1LNUB 3VXPA 4Z78A 3NABL 43C9A 2FBJL 4XPBL 4FABL 2PO6C 4OFKA 2ADJA 3ECBB 5C0AB 3O41B 4MXVF 3MLVH 3M17B 2NNAB 1A1OA 3T2NH 1F90L 1WSST 4KROC 4WW2B 5HDQL 2AJ3A 5E9DB 1MREH 4XMLL 2BVUA 4XP1L 4Y4HC 5CP7A 1N6QL 1RIVH 1L6ZA 5D1QA 2VDLH 2WW8A 1N3NB 5EOCJ 4GKZA 1YEJH 4NZRH 4PJFF 3UYRL 1F2QA 4DK6A 3WFDL 5T1DL 1IFHL 1NGPL 3U0TB 3RA7L 4NQEE 4GS7B 2G60L 4F37F 5CP3H 5EOCL 1WF5A 4KUCD 4BSJA 1CFTB 1MNUL 2FJHB 4DJMA 4XCFL 3V9FA 4U31A 1M71B 3MRGA 2D31A 2XTLA 2CIIA 2Z92A 4JFPA 2NY0B 4XP4H 4P3CH 2EDKA 4V1DA 4ODVL 1U8KB 1CICB 1DDHB 1PX4A 1B0RB 1AHWC 3QHTC 4WW1A 4KQ3L 3VI3F 3PWPB 1T3FA 5CKGA 4PJAE 4ZAKC 2FATH 5DC9B 3V0VB 4WI4A 3ZSTA 5F9WC 2QHRH 2FO4B 1FZKA 2IH1A 1JPGB 2UVFA 1EGJL 1P7KA 4WFHD 1ZLSL 5DFVC 2A74A 3BXNA 4RISH 4R3SA 3O8XB 1FRGH 1D6VL 3KG5A 2F58H 4N8CL 2I27N 4G80B 1I1FB 3BIBX 1IC1A 3QI9A 3W39B 4DQOL 5CEYB 3BRGC 4HWNA 4TUKL 4X8XA 5IB4B 1TZIA 3BJLA 1NBVH 4Z7WE 1GH7A 1FBIH 1T22A 5C09A 1DUYB 3ZO0A 2X4PB 1OGAB 4GAGL 1BVZA 1BWWA 3IJHA 2PXYD 3SQOL 5I2IA 1MQKH 1EJOH 2BMKA 3VE0A 3QUYA 1QFPA 4LLVA 4MXVE 3L3GA 3KR3H 5TQ2L 1H15B 4L8SA 4X6FA 1ZT1A 4MAUH 3VG9B 3LEYH 4F15B 4F2MA 4FP8H 1WV7T 2B4CL 4LVHB 3WJLC 3FB8B 1CG9B 2ORBH 3BW9B 1CZ8L 4LU5L 3V4VL 3IDMA 2BNQE 4HC1L 4XCCH 2VZUA 2HFFA 5C8JB 4F80A 5HHNA 3LB6D 1CGSH 1Q72H 3D0VB 2NYYC 5FM8A 3RVUC 3V6ZB 1AO7A 4FNLH 2VXQH 1NPUA 1S78D 4HKBB 2NY2B 5I0ZA 1EK3A 4N8CH 2VDRL 1HSAA 2CLZA 2E9JA 2RBLA 3D2UB 3WHE0 1Q9OA 2VTFA 4K7FA 1GGYA 4KMQA 2NZ9C 4WW1B 5IR1B 1X5ZA 3U46A 5C08D 4HJ0C 5FYLE 4JFPB 3HG1E 3AY4C 1FPTH 4LARH 3OJVC 4QGTA 3UTTE 3NFPA 5I9QC 3D69B 1KG0A 2P5EE 4ZUSA 5I1LB 4WI6A 4K71C 1FAIH 4F7TB 4EUPH 4E41A 3T0WA 3QEQD 3IFOB 1S9XB 4G8GB 3HNSH 3INUL 4ODVH 4PP2B 4G5ZH 3VXMB 3IAPA 3G5XB 4Y8AA 4WFGE 4ZFOA 1J0ZA 5SX5H 2XWBB 3D25A 5C07B 5DMYA 5BQ7B 3MTRA 3OKDA 5IHUH 1TTUA 3WFHB 4I4WB 5EZJB 1GGUA 3K4DA 4J4PC 1ND0B 4LAJH 4KHTL 1A4KB 2DL2A 1QLRA 2AABH 1LO0L 3FFCB 1NAMA 3EYFB 3RIFK 1EGJH 1HH9B 3CVIH 3QUXB 2H26A 3BSZH 4A6YA 3TV3L 3KXFB 1NCWH 3V5DB 3X12A 5C2UB 3SGJC 1SJHB 1MLCA 5EA0H 3WKNA 2P7TA 4M1CC 3WL9A 2EYRA 3CMOH 4HWBA 1QFHA 4BFGA 3D39D 1QPXA 1J8HB 4M7KH 5FUCE 5D93B 5FYLL 3QUZD 3S35H 2JCCA 1IARB 4P2OA 2E27H 4H1LH 3JVGA 12E8H 2ESVA 4D9RD 2X4SB 5FGCB 3GSXA 3MCLH 3MUJA 3KXFE 2ICEA 3RAJH 5IOPB 3W0WB 2JCCF 3INUH 4MQ7A 2HT2D 3RVWC 2CUMA 4W81A 1HNGA 3GB7B 4UAOC 1T7YA 2H41A 1SY6A 4NFCA 4LIQL 1GGCH 3QXDA 3PL6C 2HG5B 1HN1A 1ZOXA 5DQ9A 2ICWJ 1V8HA 5CIPB 2FZ3A 5FECB 1JTOA 4G8EB 5C0FB 4YFDB 1OHQA 3IFLH 4MQXC 1MFDL 4I9WE 1CGWA 1ORSB 1FJ1A 3L5HA 1B90A 3ARBB 2FJGA 3QDJD 3QDAA 2J8HA 4Z7NF 3REVA 3MLYL 1D5MA 2FD6H 5I1AB 2DI9A 2YKLH 4PJDA 4RRPG 2QBWA 5B38G 4JKPL 3QEGL 43CAA 4GRLC 3MJ9A 1KB9K 5T1KA 1JPTL 4P2RB 4PRHE 5JXAL 4HWUA 3H9SB 3C87A 4WJ5B 2FZ3B 5E8OA 4OZFB 3DIFA 2DIBA 4Z6AT 4E0RA 4UQ3B 1DVFC 5E7BA 4MD4A 4FFYL 1BIHA 4XH2B 5EWIL 4Y16D 4Q9RH 3ULUC 3U30C 2JKXA 1DBBH 5E2VH 3OKLA 3NCBB 4GW5B 1Z3GH 3GI8H 4N0FB 4Z18A 4C58B 1P7QA 3EHBC 4NM8L 1BJMA 3S37X 1RHFA 5FM5M 1P84J 1OAUH 5DD0L 4LSVL 1OF2A 2A9ML 4OQTL 3PJSB 4JE4B 3DX8A 1YN6A 1J8HA 5LCVL 2NLJA 1JMXA 1HH6A 5LQBH 3HI5H 3NIDE 3NCYP 1BD2B 1MWAL 2ITCB 4JGUA 5F9DC 1F2XK 3U6RA 5JTWA 2A6DA 2JCCE 4UOW1 4QTHA 3DX9B 3F8UB 5LBSH 3RU8L 2L4OA 1ZLUK 2NZ9D 5IMMA 2YZ1A 1X5LA 1GC1L 1D5MB 1OAZL 2XN9E 4V2BA 5I1AA 4HWEH 1BWMA 4UAOB 5IFHH 5DMIL 3GZKA 1KJ2A 5HYJE 5LGHL 3RDTC 4Z7UE 3DUSA 2M1KA 3MA7A 3PL6B 1Y18A 5DJZB 4RWYL 3HUJE 1XF4B 1JGDA 4XGZA 4KVNL 4ORGA 3PE9A 4OKVA 4P23D 4BUHA 4FFVC 1HWGB 3ARUA 4MXQC 4OF6A 4I0PA 4JG1H 2V7HA 3LEYL 5CEZE 4QRQB 2Y4SA 4JN1L 4J23A 3RWCB 3I6LE 4K2UL 1E4JA 2B1AL 4FMFA 5CUSH 4DGYH 1YDPA 1NGQL 2H32A 2WINA 3OB0K 4EIZC 3WBDA 3QDJE 1UACH 1VPOL 2HFEA 1AY1L 1IQDB 2EDJA 1UH4A 1NAKH 3UYRH 4Z76A 2YUVA 5TDPA 3FQTA 1V3LA 4Z7QF 3D2UA 5CGMA 4PJEA 5C6PB 4RAHA 4G7VH 4OCLC 4LSPL 1VENA 4K8RD 5A2FA 2F53D 1MNUH 1JV5B 1CD9B 3BPNB 2APTA 2VLME 4YXLL 3UTOA 4JPWL 3TN0A 4N90E 4JG0L 4JFZL 3ZTJG 3G5ZA 1IM9A 1BZ7A 4AY0A 1HDMB 3ILQC 3TP4A 5IVZB 2DQUH 2DJSA 3KHOA 4TPRH 2I9LA 3MLWL 1EGJA 4HIHA 4LSRH 3IETA 4YHKH 4JHZA 2Q6WA 3LRHA 1U8QA 5IM7B 3T1FB 2R1XA 4NOFA 4FABH 5T5FH 4CJ0A 1HQRA 4WEMB 1HHKB 1OTSC 4JDVA 4PUBH 2PYFB 4TQEL 4U1HB 1J1OH 4Z7VE 3T65A 3BEVB 4HPYH 3RDTB 1WK0A 3VXRB 3DUUA 3PWLB 1JPSH 2R0WL 3C8KB 4KK9C 4Z7UF 4HKZB 2F19H 4X0KB 3H9YA 2YEZA 3FMGL 5IBTL 3R8BB 1U3ZA 1FE8L 2JJTA 3SDDD 3ULUF 3W2DH 1AIFB 2AI0L 4JRXE 4LRNL 4K9EL 4BFEA 5K9JH 2HLFC 3SDAB 3UBXI 2NZIA 1TPXC 1BFOB 1R5VB 4FZ8L 4XCEA 4P2OB 1MHCA 5E1AB 4M6NH 4M8QA 5FUCC 4FTVD 2ZUQC 3RWJB 5DMJB 3CK0L 2X9XA 5KVEL 5DD1L 2R4RH 5FAAA 4YFEA 4CVZB 3K4AA 1C16B 1KULA 2JIXB 4N9GA 5DMKB 3PV7A 4JM2A 3KPNB 4LGSB 4HPOH 1HHJB 3LN4A 5T3XH 3HG1D 1E6OH 4Z7QE 3GRWA 5C08E 2DYPB 3WN5B 3KYNB 4YPJA 2G5RA 1B4JH 3P30L 5D70H 4GG8B 5T33H 3MRMB 2YD7A 3LKOB 4HIEB 5JDJA 1RZGB 5TE4H 3RTQA 3VXUD 3UTPE 2AJYH 5KSBA 2VR5A 1J8KA 5TE6L 3IFLL 2HAZA 5KW9L 4EVNA 4D94A 3BPLB 3TBWB 3MXWL 2ZNXA 1OTSD 5DEZA 4KVNH 4U33A 5C6TH 4M6AA 3OL2A 4YXLH 1FL3A 1WIPA 3UX9B 4KZDH 1NDGB 4CVZA 2NYYD 2BVPA 4NQEB 4U3CA 2JJSA 8FABA 4M8QB 5GGVY 1EFXD 3VGGA 3DTXA 4K3DL 4ZXBD 3S3JA 4UU9B 4ZYKA 2DMBA 5D2LE 1O5DT 1TCRB 4J6RH 4GS7C 4RAVB 1IT9H 2H1PL 1KCKA 3GFUA 4NKIL 4XNXL 3HRPA 3WIFA 4NKOB 5BCAA 4XNYH 5IWLA 4MA8L 1B0GB 5EOTB 5GHWH 1RHHB 1OT2A 5HVHB 5D1ZD 4WV1C 5HPMA 4J8RB 4XHJD 1P2CA 3F7RA 3OAYK 3ARDB 1ZLVK 1X4ZA 4LCYB 3PGCB 2H2PD 2DQUL 2AEIT 3UXFA 2E7CA 1J05B 1A1NA 5F9JB 4W6YB 4OLVL 4X5WA 4MJ6B 3T2QA 3BVNB 4GBXA 1XF1A 2W1NA 4JEGB 1PZUB 2XFXA 1J7VR 3L1OH 2RAMA 4APQB 2R2EA 1B2WL 1NC4D 2DLEA 2JLLA 4G3YH 4EN3C 4HJGB 2DBLL 5SX5K 4U7KA 3QIWB 4HWZB 3CC5B 3MMEA 1P2CB 3BKJH 4HQQH 3QQ4A 2P8LA 4G5ZL 3Q0HA 1S7WA 4ODTH 1IM9B 2VQTA 3M17A 3MRHA 4PD4J 3UTQA 5EOQH 4CDGC 3AREC 2NY4B 2YRZA 3NCMA 3U9PH 4G6AC 2UZIH 4JANA 4PJGF 5EBMA 4EBQL 4YAQA 1NSNH 1PVHA 3WIFB 1YY8A 4OUUB 2B39A 2XTJD 5BOZG 5FV1L 4HUXB 2EKSB 3CXDH 3RWIA 3MRPB 1V3KA 4JRXA 1L7TH 2NY4C 5C0AD 5MEQA 1S9YA 4FQIH 5MEOA 3MLYH 3HE6D 1KXTB 5H94A 3V0VA 1X6LA 4KQ4L 3UPCA 1FZMA 4HS8H 3VFVB 4ZFFA 4DZBB 4L9LC 4XNZC 1P9MC 4JM4H 1I1AA 1LO4L 3PWPA 3QXTA 1DFBH 4PRPD 4DVBA 1Q0XH 4U3HA 1R3LA 4DW2L 3FAWA 4X6CE 4GAYB 5DR5H 1I7RB 5F3HB 4AZ8A 3ROLB 2XPGA 3CVHH 4NJAL 3UPRA 1HIMH 1QSFD 5KBNC 1BQUA 3SDAD 1N0XL 2CKBH 1BVKA 1XGPA 1F42A 2XTJE 5DSCB 5DUPL 3FB7A 4W6XB 4PGBA 5ESQA 2A38A 3NTCL 1NL0H 5CHNB 4LVHC 3V2AR 4PJXE 4LSVH 1F4WH 3V4UH 1N59B 4JM2B 2DD8H 4GBXD 4OZHE 3GJFH 2F8XC 2P45B 1AQDB 1FH5H 3FRUB 4M4PA 3F7VB 2CKBL 2MOVA 4EN3B 4MNQE 1MCFA 5IB3B 4ZUVA 4YGAB 1AGCB 2PCPA 4D2NA 3ULVC 4QHLB 4ZS7L 3RIFF 3FB6B 3RGVA 3KPQB 1WZMA 2DKUA 2HYMA 4HUXA 2CH8A 3MA9L 1ZTXH 2GSGA 15C8L 3K81A 3NA4A 3MRCA 4Q58C 3IFNH 1HHHB 5I1GH 1GHFL 4F58H 1A5FH 5IV2B 4NKIH 1E4XH 4FFWC 2MKLC 1JWMA 2X4NB 1KLUA 1TETL 4PJIA 3STZB 3VI4F 2P8LB 5ESVB 1WWBX 3OR6A 5I76B 3O2WL 2P44B 1EO8L 2UZYB 1XCTB 1RIHL 2YPLB 1FYTB 1NGYA 4P49A 2IFFH 3DVGB 1HYRC 3I2CL 4POUB 2ZOLA 4YZFF 3IJYA 1IZKA 4M5ZL 1WWAX 2FEDC 5C0ND 4ZD3H 4JJ5B 3G6JA 3WNMA 3SE3C 3MNVB 1YNTB 5FGRA 5I1CH 4OM0H 1G6RL 4MA7L 4XAKD 4ZNEA 1CXIA 1Z9SA 5DUMH 4P59H 4N1CA 4DUWA 5T3ZD 4XAWL 4WTXA 1FN4B 3RFZC 3DVGA 4S2SB 1N5YL 4DN3H 1KJMB 4JY6B 1OT1A 2EYSB 2AXGB 4M5ZH 1NLDL 3MZGB 2WBWB 1BF2A 3U4BH 2DMKA 2E6JA 4XCFH 4ZTOH 5DJ0A 5F1KC 4QRSA 3BO8A 4C54A 4AEIL 1KENL 3L3KB 5T1LD 4NC2B 5A40E 2BXZA 4RDQG 3TYFA 4JFXB 3KPPA 5C9JB 3WNPA 1NLBL 5HHPA 4LIQE 2F54D 3WUWB 1IFHH 2C3GA 1KJMA 3W11C 4ODXB 5MEPA 5I19H 4OF5A 2YSSA 1FNGB 1OQXA 3OPZL 3B8SA 3MUGB 3GMOA 3KNBA 4KJQC 5I1CL 3KXFA 1LE5B 5DUBB 3LEXA 4PREB 4WU5B 2OL3H 3H7BA 1I1YB 5ANMB 4F33A 5TGBB 2EDHA 3VXNA 3AU1B 2D4DA 1U36A 4I4WA 2J8UB 1LO5B 1MVUB 3DURB 3QCTH 3WFDH 2JJUA 4YDLB 2VZ1A 1NBYA 5H35B 3RVTC 2W65A 5F7YC 2VABB 4U1SB 3PWUA 1YPZF 2X4UA 1ADQH 3GBML 3WFCH 4QRRA 4ELMB 3JVGC 4P5MA 5FF6A 5I1LA 1MY5A 4KK8D 1IGCL 3W9DB 1K5NA 3VFOA 4H25A 1PLGH 1EH9A 1CIDA 4PV9A 2AXHA 2DJ4A 5IMLB 1VADA 2Z31B 3L5WA 1QBML 3L3IA 3QPXL 4N0FA 5IIEB 1A6WH 5T1DH 3BZDA 2EYTB 4I3RL 3P9LB 1VFMA 4JFFB 3QFJB 5DDHA 5TE4L 5DRNB 1OAXL 4BZYA 4N90D 2CGRH 3CVHA 4NQTA 5IW6A 3RA7H 4WGWB 1HINL 3K8MA 4MAYB 5F1IA 3BEWA 1YMMD 4QY8B 3F7VA 5HYIA 2ZUXA 1S7VB 3RI5F 1VA9A 1OGTA 4JREC 4GSDH 4LPTA 2I07A 5C0GA 2ZSWA 2QADD 4U6XB 1XR9A 5KVMC 3V8CA 5HHQA 2W60B 2PYEE 3VFSB 2FRGP 1TENA 4MB4A 2WIMA 1QBLL 2NXZB 4JZNA 1EUTA 1IGJA 3HI1A 3KPMB 5KSUA 2JELL 2C1PA 4RFEB 4QNPF 1RJLB 2IPKB 1S7QB 4RA0C 1FGVH 3HPLB 1UJ3A 1T1YB 4JFYA 5ILTL 4KK6D 2GIYA 1YJDL 2K1MA 1T89A 4P2CG 4QHKI 2PR4L 2GITB 5C08B 4NFBA 1VCAA 1YMMA 1MQ8A 4I3SL 3FT2A 4ZFGH 4R26L 5DK2A 1DE4A 4B7IA 4RX4D 1W72H 3SQBA 4WNQB 3QQ9D 4U1GB 3KLSA 2H2PC 4NCC1 1CLYL 2CUHA 5IOPA 2BNUB 4OD1H 3X3FH 2PO6A 2ESVB 2HJKB 3DO3A 1MJJA 4G8GD 5E8DH 5TDNB 1A02N 3SGDH 1HKLH 5DWUL 4UINL 5ETUA 4I0PD 3MRRA 5I8OH 4Z7VB 5FDWB 3QZWB 4DVRH 1J86A 1UM4H 4KK6C 4JKWA 1ZEAH 4MAUL 1ZHBB 1I8LC 3VWJC 1LQSR 1YY9D 5HDBF 4DKEH 1KJVB 4HAFA 4OKDA 3VFUB 3B83A 4XVSL 3LSOB 1XH3A 2F5BH 1H8OA 2LABA 5DRWB 1S7XA 1UCTA 4MNHB 3KPRB 3VXRE 1QEWA 2CRIA 3VWKD 3EYQC 5EZLA 1ZMYA 5DF0A 3WFEH 4ESKA 2PR4H 4MJ5A 5J1AB 1N6UA 3CPLA 3LN5A 5IEHB 1DR9A 2ADFL 2IH3B 3ZT6A 4TNVK 5IKCA 1NMAH 5GGVH 1D6VH 2ADGB 1JPSL 2R0WH 1YMHA 1WISA 2R69L 2DQDL 4PJFB 3O3DB 3VFGL 1ZT7A 4F9PC 5KSAA 4ZUSB 4Z7NE 4EI6A 4QNPE 1OCWH 3UTSB 3T0DA 4S1SL 3EYUH 4Q9CA 4U1NB 3S8WA 3UMTA 2CD0A 3PV6B 4Z77A 2J88H 4B7LA 3LQZA 5DHVB 5MENB 1S9YB 5IR1A 4X4ME 4P57A 1MUJB 5SV4A 1CDHA 4OCYH 1OLLA 3IGAA 2HN7B 5CSZB 3WO4C 5DMGC 1JGEA 4KHTH 1T20B 1K3IA 3FKUS 4JVUA 4HBCL 2EDWA 5B4MC 3RY6A 3Q5TA 1ZT4A 3ZL4H 1CLOH 4Z5RA 3S88L 5FO8B 1JK8A 2HFGH 3CFBB 4OJFH 5IHBA 2VJXA 4BH7A 3IDGB 3SDAA 2YN3A 3LS4L 2Q8AH 3NZ8A 1DUZA 4I3SH 3SOBH 5CILH 3VFPA 4FXKA 5HDBE 3O3DA 1XFPA 4IHOA 5JMRA 1DBKH 2P5WE 3O3AB 1KFAL 4YHYB 2Q20A 1HQRB 4LMQE 3CNKA 3A67L 2B5IB 3LN4B 5LWYH 5E24E 1MCRA 1YECH 3W39A 5A16A 1MPAL 4NN7C 2EECA 2GFBA 4PGCA 1FVDB 2G75A 3V6OE 1QBBA 3KYOA 1KIRB 1KTLA 3P0VL 2KQMA 4ETYA 1UM6L 5J1TC 1I7ZB 2BVOB 3VXUA 4WTWA 2BOCA 1TCRA 4FQCH 5FO8A 3V0AC 1BM3L 4L3CA 1FZKB 2IH1B 4JFDE 1G9EA 1JPGA 2ZZUT 4P9ML 5D1XC 2E9BA 4MXWH 1LO0H 5IFJA 5FDWA 3HNVL 3CFEA 3MODH 1INDH 3SGKC 2VAJA 5EBLA 1X5IA 1CN4A 3MBEB 2D2OA 4ZOAA 5IQ9B 4WFEE 1T7XA 5ECJE 4EKXA 3ME0A 3TBTA 2HJFB 5GS1B 5IQ7H 1TMCB 3DUUB 3N9GH 5DUML 3P11H 4BELD 4I18A 4QXTB 2Z93B 3MYJA 5FYLH 5J06A 4JDVB 4UIKL 1YDPB 1DEEA 1U91B 2DLFH 2H32B 3UZQA 4HT1H 1ZE3C 4Y5XA 2R2EB 5SWZD 3RY4A 2W91A 4NZUH 1FAKT 1KCUH 4GQ9L 3WYRA 4RAUA 3O6FD 4FTVE 2F74A 3VW3L 2O5YL 4MNQB 4V1DD 4HIHB 4AENA 1DQMH 3GJEA 3HPLA 4ZS7H 2E7BA 4JKKA 3I50H 3D1MC 1WCBA 4J8RA 1YQVH 2IFFL 3O41A 1TDQA 4D9LL 1Q9LA 4LPCA 4LSPH 4ZOEA 3ARSA 3O3UN 1HILB 4KU1A 1I1AD 3MCKB 6FABH 5JOFA 4PGEA 4LEXH 1KN4L 2AK4E 3UJTL 4BK5A 1GC1H 1EHNA 3O4LE 1JNHB 5LBSL 2IAMD 1DVFB 3QJHB 4UTBL 4HIIA 5C2BL 4R0LB 4RWHA 2WBJD 1NCNA 4D0BB 3HAEA 2XQYG 3DOSA 2NX5E 4U6HB 4I0CC 2VLJB 2CDGA 3O6FA 5IJKA 3G6AB 3VXOB 3FJTA 3VFMA 5JNYA 5CJOH 4KDTC 1RZIA 1X7QB 4O58H 5JLZB 3TFKD 2CRYA 5C8JA 5I16A 4Y0GA 3CU1A 3T0ED 3HZKB 3GMPB 1RUAH 3VXUB 4GQ9H 2EDBA 5FKAA 4CDHA 1DTUA 4LEXL 5FOJA 4X4YB 4GG6A 1GJIA 2A1WL 2OQJA 4X98A 3HE7D 4K3HA 1A7PL 1I7TA 3S34L 5EU5A 1ZSDB 3KYAA 3GO1H 1J12A 5DVNA 1RZGA 1IKNA 3HC3H 1RZ8A 3I50L 5DMIH 4DUVA 4IM8A 3JBG7 3HFML 3HN3A 4KZEL 4PRPA 1DEEB 1U91A 2W65B 3O2VH 4X5XB 4XMKL 1U3HD 5ITBH 4B53A 4TSBH 1S7TB 3LN9A 1KFAH 4K9EC 2P43B 4IJ3B 1KN4H 3PWNA 3C5ZB 2VO5A 2Z8VC 3DLQR 4LPXA 3TNMA 2JIXA 4FZEH 3NVQA 1VGEL 3GM0A 4UTBH 5D7IA 3S4SB 4NPYA 2VAAA 3T0EA 5FYJD 2P24B 5DD5L 2NCMA 4PRIE 1S78C 3NMEA 3QULA 1RU9L 5D7LE 1FNHA 3T4AA 4S1RL 3MZTA 4M1DL 3O6KH 3BI9X 1X4XA 1CE6B 1DLFL 4JO3H 3GGWA 3RPIB 1M05B 3GB7A 1PSKL 2BNRA 4X9HA 4EUPB 3ULUH 4PJIF 3MODL 4F8TA 2FSEA 4OSUH 1X6NA 5K59F 2VQ1A 2Z92B 1UWGH 1KGCE 4LCWA 4NZRL 2AV7B 3AUVA 5EZIH 1PAMA 3QDJA 4RGNE 4C56A 2WINB 1J11A 3O0RH 3PHOB 4QXGL 1LP9B 1NFIA 1QHPA 5INDA 3DXAB 4Y8DC 3GJFB 4JRYA 5JIHA 2APWA 4X99B 2Z9TA 4CUCA 2Z31D 2DI8A 4G9DB 2DAVA 4M43L 1ZANL 4IDJL 1CT8A 3K2MC 3GRWH 4KPHL 4P3DA 2A9NH 4O2CB 3AREB 4U1LB 5ISZE 1FFPA 3Q6FA 2F5AL 4RIRB 4BH7B 3PP3H 1JRHH 1OGTB 1A9EB 3BN9C 1FORH 5DD1H 2GAZB 4IS6A 4JDZB 5CJOL 4Z78B 2DTML 1Q94B 1MFBH 3DX7A 3AMKA 2MCPH 4R97B 1ED3B 1CK0L 1KUMA 4JQVA 4GRMA 4G42A 4MD0B 5IROA 4HG4K 5FGBC 3JXAA 1S7RB 2JE8A 5EO0B 4LNRA 4WEBL 4ZG1A 4LQFH 5EU6A 2A6JB 3L7EB 5L2KB 2VXTH 4M5YL 3TZVA 3NPSC 2A77H 4PJ9B 3DVNA 2ZSVA 3Q3GB 1RK1B 4NQDE 1JHLL 1MELA 4YFLI 2HLFD 4MS8C 2VSDA 2C4FT 5D70L 2VB5A 1LILA 4FS0A 4G8IA 1HQ4B 4QRSB 1NCDH 4RGMB 1JZ7A 3CFKB 3BPOC 4IMKA 3DIFB 3DVIA 2QQNL 5EU7E 3VWKA 4J3WA 1MH5B 3IDNA 1A21A 4TULH 1FIGH 1JP5A 1QSEA 1U8JA 1KNOA 5ITFA 7CGTA 5D96B 1MRDH 5TGBA 1KSRA 1VSCA 3FFDA 1RZFL 3ZKSD 3P4OA 1C1EH 3Q6FB 4JFFE 4EDWL 1G6RA 3NACH 2ZPKL 3DECA 4XWOD 2YD8A 4MJID 2XWBA 5K9OB 3BRFA 2NY3B 1IGML 1FNGA 1FNEB 5MP6H 1PKQB 1MCQA 3BH9A 5A3IC 4Y5XB 4PJXF 3AS3A 5E0QA 2X05A 5BW7C 2NY1D 1DUYA 2N56A 1EFXA 4QRPB 2ICWI 3HC4L 4ZAKB 1P7QB 2IBGA 5LGKA 4RFNB 3IKKA 2RFXB 4PG2A 1IVLA 2I25N 5FYKD 4KKLC 3ZDZE 2Y23A 3KLAA 3BP4A 4WI2A 1IT9L 3TYFB 3SE4A 5ID0A 4R97C 4UV7L 4YUEH 2FBJH 1XT5A 4XPBH 5C0BD 2J5LC 2FIKA 3W0WD 5D1ZA 2CLRB 4NP4H 4QHKJ 4LCCC 4PV9B 1T1WB 2ADFH 4CN4A 5IQ7L 4X4XB 1CZ8H 3BD5A 3NACL 1K5NB 4LCWE 2ZWLT 5SWZE 4DEPB 5J11B 1T2QH 1FNEA 4MZ3A 4QRRB 3QDMB 1S7QA 2E7MA 4WU7A 2ZOLB 3QCUH 4KHXH 1VGKA 1MEXL 4OGXL 2LTQB 2FYYB 1D6EB 1MFAH 3MLZL 4YR6A 4GH7B 2OP4L 2YPLD 1QD0A 4OFPA 1NAMB 3EYFA 1N5AB 4WTZG 1LK2A 1GGCL 2VIRB 2V5YA 4YZFE 2X1QA 4NN5B 1DBAH 3FOLA 1KLUB 3MOQA 1CR9H 1T2QL 4YBLC 4EI5D 3X3GL 1G7PB 5E08L 3Q2CA 1CL7I 1NC2B 3SDCB 1YEKH 2E3VA 1T7WA 4O51A 2NY2C 3OAUL 2AXFA 5E9DA 1PG7X 4R96A 3TH2T 3F65A 5L8LB 4XVUD 3IB4A 2AQ2A 2X4SA 2OI9C 2VC2L 5HHVH 4DVRL 2RQ8A 3C60C 1QQDA 5LKNA 1QHOA 5IK3A 4P5TC 3RZCD 5BJTA 1J87A 5D1XD 2R2BB 5F1NB 5M94B 3QHFH 3LKSB 1PYWA 5CUSL 4HLJA 5C0DA 5JW4Q 2O5XL 1UENA 1U93A 4YDIL 1M6OA 1WZLA 5HHOE 1MCPH 3MUHL 3QUMH 3ZLQC 1A6AB 4DEPC 4IOFD 4Y19E 2EO9A 1CF8L 2ED9A 1UWXK 4JY6A 2WWKT 4EXKA 4JPVL 5D2NA 3V6ZA 4EI5A 3DRQA 3QDGE 4ZPTB 3ZKNC 2P5WB 1JPFA 2OTWA 2EEAA 4PGBB 1JWUA 3H7BB 3ULSB 1M7IA 2LQRA 4LLWB 2IADA 4O2CA 4WHYG 1ERNA 3SE9H 1P4BH 4NC1E 3GMLB 3MV9B 3ZKXC 2JJWA 3LAFA 1CDYA 5LQBL 2DDQL 4OQ1A 4ODXA 4XP9H 3OMZA 1GGTA 1I1RA 4HKXB 4PTUB 1WT5C 3DRQB 4ZPTA 3SDXF 3A6CH 4HDIB 2Z0BA 2YPLA 3HB3C 3UPRB 2DYPA 4DGIH 3HE6B 1NMBH 4UQ2A 4H26A 4UT6H 1RIHH 5EIIB 3QR2A 4JAMB 4CAGA 3U46B 3WJLA 1HE7A 4HK0A 1TIUA 1AHWB 1MOEA 3QCUL 4KHXL 1BVLB 1V7ML 1U8OA 4RMVA 4R3SB 3NBNA 5ETUB 3WD5H 5E6IC 1RJZB 4MSWB 1P7KB 1KENH 2NTFB 1RUAL 4JFQA 5ICXB 5ADPL 4Y4KA 1J0IA 3NPZB 4OSUL 3K2UH 4JAMA 2AQ1A 1QG3A 4LSSL 3BKCL 4P5TB 2G5BA 4WTZA 4IIQC 5GRUH 5SWQA 1I3RB 4TN9A 1S8DB 3DMMD 5B3JF 1G7PA 2X89A 5EU4A 3RIAF 3GBMH 3QWOB 2ZCHL 3BVNA 4ZXBB 2Y36H 2X1XR 2OCFD 4GAGH 4XTRC 5C07E 4LLVB 3WXVL 3L6FA 5M95B 3DMMB 5I2IB 4X6DF 3L3OB 2WAHA 1DBBL 4XNZB 3RU8H 5KS9B 4LLQA 4ZTOL 1FDLL 3EO1B 4OZHB 2R1XB 4QGYA 3ZYOA 2C9AA 4H0HB 2VL5A 2COQA 4OD3H 4PG9A 4QXWA 4L4JA 1MLBB 4L4TE 1CE1L 1CDCA 1K4DA 4N0UE 3S98A 4JZNB 3RPKA 3QWRA 4IOFC 1DUZB 3LDBB 1U42A 3T2PA 1JN6B 1SMAA 1L0YA 3F7QA 2APBA 1G6RB 3HI6L 4JN2B 5ILTH 1YNLL 1L0XA 3WHXB 5J89A 4MVBC 5DD3H 4M7LH 4XWOC 2AS5M 5BRZB 1AGBB 4CU6A 1E4XL 3L95A 2YUXA 2DYPD 4NBZB 4UV4L 4JB9L 2FHCA 4K07A 3GMMA 3GSRA 4PRAB 3B5HA 3GUTA 3KYMB 2OJZH 4NO3B 2DBJA 1UC6A 3QIBD 1I9RH 1UYWH 3ZDXE 2ADIB 3DHJA 3E6FA 2FX7L 1JGUL 4YHNB 2G60H 2X4RA 4IRSA 4X6EA 1UZ6E 4PRBB 5CAYB 2MJWA 1IAIL 3C08L 3C6LB 3VXTB 3DROB 4J3XA 5H37H 1OARH 3SGEH 5IT2L 1A64A 3IFPA 4MNGA 4F7CB 5DS8B 1A7QH 3U0TA 2A9NL 1JFQL 5HHOD 4NUGH 2ZPKH 1NBYB 5H35A 3DMMA 3MA7B 3PL6A 5B3JE 1A7RH 4PS4H 2BOBB 5SX4H 1R3LB 4L5FL 5HBBA 1D9KC 4K3JH 1U58B 1A7NL 2GCYA 4OLVH 4EOWL 5J12C 1XH3B 3VRLE 5ALCH 3S37L 2G5BB 4E5XA 2FHFA 3G5ZB 4FOMA 4PTTB 4WHYH 2B8OT 2W0FA 5GS1A 2MQ0A 2IBZY 5CZXC 4N1HB 4KPHH 1OPGH 1DQTA 5EOTA 1H0DB 3QUMA 3QG6B 3MRRB 3SDDB 4MVBD 3JWOL 3MRKB 3SGEI 3MRDB 1KIPB 3GSVA 5D1QD 2NXZD 1N26A 3OKYA 1TLKA 4LPYA 1T5XB 2BSTA 1A7PH 4Y5XC 3IDIB 3QEQA 3FQUA 3T65B 4RMRA 1H3PH 1NMAL 5IW3A 1I8MA 2NY5C 3MJGX 3S96A 2DWEA 3LEVL 4X4ZA 5DK2B 1I8KA 5TQ0H 1YEFL 3TBYA 2J12B 4G6KL 2GYSA 5CSGA 2R29L 1M7DA 1NGPH 5I71C 3LH2H 4U6VH 4X9IA 4WI7A 5E5MB 4L5FH 4QRPD 3D3VE 1EEZA 5ESAB 4XC3H 3W81A 2OR8A 3OBAA 4XPTL 4EOWH 3TCXA 4HIXL 2YWYA 3U0WL 2IADB 3KLHD 5I75B 3KVQA 1S3KL 2BX5A 3HE7A 1LO2H 3TN0B 1FDLH 5GS3A 5IM7A 3DBXB 5T33L 3VWJB 2W38A 5IB1B 5D2NB 3MLXL 3NZ8B 1K4CB 5EC2B 4OF0A 4MB3A 4OBRA 5H37G 3MGAA 3WEXB 1DCLA 4CJ1A 5SWSD 3TO4D 4M4RA 1HXMB 1IC5L 5GGSB 4RX4A 3IDUA 1HH6B 1FPTL 1JBJA 1P7QD 3MSPA 5KG9A 3N1FC 2XWTB 4RGNB 4U7MA 1BX2B 1BIIB 3IU3A 5AG8A 2AABL 3U36A 1YEHL 2DL9A 5E99L 2VYRE 1NKRA 5GS0D 5EU5B 4EUPA 4XCEB 1RZJH 5DO2C 3MJ7A 4ZS6D 5FKAB 1XGTA 3G6JF 4N0YH 1PEZA 4L8BB 1II4E 4FZ8H 3GK8L 4NN7B 3GKWL 4K3DH 3IT8D 5CBEA 1JF1B 1UH2A 4Y1AD 3D0LB 2ZG3A 1YEGH 4PJBA 4MHHG 5F7WC 2EDFA 3RKDC 1JF6A 1E4WL 3VFOB 3TLRA 4ZUVB 1OWWA 2FH8A 2W9EH 3QG6A 3ZKMD 3MGOB 5GHWL 3FRPA 3ZE0E 3MRMA 2EIZB 5D4QA 1WUNT 1E6OL 3MBEC 3SDYH 1MFAL 4MCYB 4OKVB 3BKCH 4RIRA 5C0IA 1HILA 2B2XL 3BKYL 4OLYH 1F00I 3BD4A 1XIWA 3CFDB 1EERB 4R4BA 4RZCB 5GGTA 3O2WH 1MCJA 3VXQA 3PHSA 4Y2OA 5D5ME 4PRHA 4N9GB 3UZEA 5SWSB 2ZCHH 2J3SA 5ESQB 4G43B 5L88L 4HT1L 5DC4B 1EVUA 1WVZA 3LV3B 4XPAL 3OB0H 1FFQA 2ITDB 5DRWA 2IMMA 4EQ3A 2YZ8A 3UDWC 1R3KA 2VKWA 1QRNB 1U95A 5LWYL 3K80A 5K9JL 3CLFH 1G7IA 2NX5A 4K3GA 3CSBA 3QIUC 4CL7A 5EUOE 4NNXB 1SJVA 4X9GA 1JV5A 3QH3B 3DI3B 2B20A 4WWKB 2Z91B 3SY0B 2CDGB 3QHFL 4JFXA 1NBZA 5I1EL 2X4RB 1JVKA 5A43C 4PJEB 3CK0H 1FZJA 2Y25A 3GGWB 4BFIA 5K9KA 1TFHA 2FATL 4X0KA 2VH5L 1HCFX 5DVLA 3GNMH 1BIIA 1P4BL 3IU3B 5FYLD 1I4FB 2FSEB 3TJEH 3OF6A 1R3IH 1F11B 2JCCB 5E6ZA 5H2BB 3H3PL 3AM8C 1CU4L 5HI4D 4UT6L 5DZNA 2DQIH 5DGRA 5FV2A 5GGQH 3VDBA 2YRLA 3QH3A 2EYSA 4NUJB 1I7UA 1AGBA 1MPAH 1UVQA 5BRZA 1F4AA 4N8VA 3STLA 5C92A 4Z0BH 2DQDH 1C5BH 3IETB 3DETC 3RX5A 1JL8A 4PLOB 3BGFC 3BP6A 2WLYA 3EDFA 2IAND 5CGYD 5T3XE 1HDMA 3DARA 4DFHA 2DDQH 4XP9L 4JY4A 3IJYB 1XF3A 5DHVH 5A16B 1RZ8B 5IVXF 3HZVB 3QUZA 1A3LH 2JF1A 1FSKC 3QUYB 1KCVH 3TT1L 2WSKA 5HHVL 2FL5B 5HYSG 4F15C 1NFIB 3VFSA 3SKJL 4X5XA 1LK3L 2MNUA 4XX1G 3AGVA 1RQ5A 3IKCA 5MENE 3RKDD 4KJYA 2A83B 4WHTB 2PW1B 1DBJH 4LCWB 4M03A 3FMGH 4A6YL 3RY6C 3I75B 5D72H 3TVMD 5FUOH 1YEDA 2Y36L 3TNNA 3MRDA 3EYVB 4QRRE 2DQIL 5GGQL 5HHOB 4MXWL 1RK1A 1M7XA 3BISA 5HI3C 3QUMB 4I9WD 1QSFB 2F8OA 2AXJA 4EZMA 2P8PA 5E6ID 4P46D 1XZ0A 2OXGA 4HEPG 1DL7L 2XACC 4PTTA 3PABA 1DSFL 4E5XB 1TZGH 4JHWL 3V6OC 2N1KA 4HHAA 1EZVX 1JHTB 1U92A 1V7NL 4NM4H 4ZD3L 4GG6F 3MFFA 3IYLW 3ARVA 3D0VA 1NGXA 2WBJB 3V5KB 4OD2B 5CD5D 1ND0A 4YHLL 3FO0L 5JO5A 4CU8A 5B39G 4TOYH 4HC1A 5BQ7A 3FQXA 2XQBH 4YHMH 25C8H 3PGFL 4XHQA 1XR8A 3HMXA 3RWFA 3U1SH 3SKJH 1GGBH 4LAQH 5DRXB 3RUGF 4L4VD 1WCBB 1BVKB 4WCYH 3FB7B 3MOBH 4BQBA 2C4FU 1QUNA 4DOHE 2R4RL 1LP9A 5EO1B 5D1XA 3IFNL 3IVKA 4MZ2A 5GS2H 1LP9F 1EDQA 3SGKA 4DGVL 3ROLA 2JJTC 3QWOA 5F21B 4AEFA 5HGBB 4ZXBA 1U8LB 2AJ3B 5L0QB 3ARFA 4TTDC 5EPMB 4DKFL 5E2TL 4GRLA 5B8CA 5A3ID 4HBQA 3LD8B 1F4YH 4IOIB 2BJML 2H6PB 3HAEH 3JTTB 3LCYA 4I18C 4L3AA 2VDNH 2GT9A 4JPIB 1RULH 4BSWA 2DQHL 3QIBA 3QO0A 1MHHB 5IESH 1JPST 5AWNL 3W82A 3GNML 1W72L 3SPVB 4M43H 4LQFL 4P5TD 1XEDA 4XP6H 4R7NA 5DVMA 5F1NA 2BY1A 3DNKA 5F8RC 1PLGL 2P24A 2W92A 4NO2A 4O02H 1QTYT 1QFWL 2Q3AA 1P4LB 4F2MB 1B0RA 4JANB 2R23A 4NKQB 4QHNA 1H15A 2BVQA 2QQKH 4KJQD 3VMPA 3GSQB 4KTEL 3MO1B 1JGLH 2W9DH 4NT6B 3BW9A 1I1AC 2SEBB 2CJUL 1U3HA 4QT5A 4J2XA 5BVPL 3VD3A 1LDPL 2XFXB 2VR9A 5FYJH 1ZT1B 4APQA 3ULUL 3LOWA 2XNAB 4H8WL 3S3SA 3SO3B 4PRNA 3HA0A 1H3PL 3PQYD 1LO2L 1U8QB 4ZFOB 1XCTA 2YA0A 4PY7B 3BKYH 4JQIL 4ZQKB 3B9EA 3C60A 1DSFH 2Z93A 3MYJB 4LLWA 2A74B 3BXNB 3CZJA 1NUFA 1LK3H 3MRJA 2K7PA 4WIQA 3QDGD 3QDMA 2MCPL 4U6VL 2V5SA 4HJJL 1F3JA 2DM7A 5D7LB 4RGOH 4YK4C 1U8OB 1OY3B 2HMID 3BUTA 3FQRB 1B3JA 3MREB 2E7HA 4KVCL 1YYLH 5HYSB 3I02B 5A1AA 5D2NC 4Y4KB 3U2SB 1JI2A 2P5WD 5E2VL 1KLFA 2DBLH 1GYAA 2X1PA 4APQD 5JW4R 4F7PA 2YXMA 3DWTA 3WE6B 3AXLB 5GSVA 4BSWB 3G04B 4CRPA 4D0CB 1EIBA 1I9JL 4KI5F 1A6VH 1S7UB 4K94L 2UWEA 1E27B 1AQDA 4AYFA 3QJFA 3M1BB 2AXFB 5L2JB 1ADQL 1R3IL 3IDMB 2PW2B 1ZHLB 5MEND 1MCIA 4ORGB 4PJ5B 3U7AA 3MLRL 5BS0D 1QBMH 3QPXH 3RTQB 3GRWL 4JLRB 3QXVA 5KSBB 3DV6A 3FOLB 4YJZL 1PKQA 4CVWA 3ROOB 3CPLB 3RVWD 3MLSH 3CZFB 1KJ2B 2B4CC 4S1QH 3R4DA 3TEUA 5JIKA 1IJ9A 4YR6B 4XVTH 1H5BA 2OX5A 1YEGL 1R24B 5GRJH 4LLDA 5CP7B 1FO0B 4WU7B 2A6DB 1UZ8B 4KVCH 3UAJC 3P0YH 2OTWB 1KCVL 3OX8B 3VXUE 2AV1B 3CMOL 4U05A 4F7EA 3MNWA 1CL7L 4X9FA 32C2B 3O2DL 3LEVH 1JHTA 1U92B 4HGMA 1JGEB 3VD9A 4XB8A 4L9LA 1ITCA 2R0LH 5IHUL 4RMWA 5MEPB 4OCSH 3MREA 5GRWA 2MMXA 3OPZH 5BZWB 4DCQB 5HHMB 5AYUH 5J13B 2VDMH 1EJOL 4GO6B 3W9DA 4N5EC 2BXYA 5TE7H 2AAVA 4WVRA 4D0DB 1QKZH 2Y07H 3LMJL 4XVUC 1FVCA 5I73C 5I66B 1N5AA 4TVPE 3D48R 2GW5A 2WQRA 4KK5D 2VH5H 4LU5H 3V4VH 3ILQD 1IGIL 3ARGB 5C0BE 5JORA 1UJ3B 1A7NH 1C08B 1V05A 1UCBH 2ZKHH 1AFVH 3GMLA 1INEL 1EAJA 4RFEA 5EC1B 4XBPA 2W9EL 1FV1B 2N4IA 2Q8AL 2P49B 4I0PC 1F6AA 1S8DA 3OZ9L 4JQXA 1H3GA 5GGTH 1FYTE 3B9KB 1J1XH 5L2KE 1SBSL 3WUZA 2ZSWB 4U6XA 4NQCD 3BZ4A 3O9WB 3G08B 2R0KL 4NWTL 2IPKA 1CFQA 4GOSA 3FONB 1C08A 2RGSA 2GTWB 5F7EL 1N4XL 1F58L 5F7DB 2KPNA 4NQXB 3VWKC 1KLGA 2WLZA 3CVHB 4LCWD 3GMQA 2APXA 3PWVB 2CUIA 4D8PB 3F12A 3KPPB 5FHBH 5J0BA 2FGWL 4KROB 1I4FA 4K71B 5FYKU 3QRGL 4Q97A 4ZS6C 3T0VA 1L9NA 3TA3C 3SDYL 1F4XL 5EA0L 5GRXG 1AE6H 4NWUL 3SE8L 2FEEI 2GJ6E 4BJLA 3H9HA 2C7UB 4HDIA 1VESA 1U8PA 2AXGA 5HI4C 2H8PB 5ENWB 5F9OH 3DMMC 3EUUA 3MGTA 1A6VL 5ICYB 5EU6B 2AJXH 4FQ2L 4HFUH 5DA4A 2X4UB 4JHBA 4NQCA 3KS0J 4U1MA 4XHJC 1YEKL 4NYLA 5L6YL 3HUJB 5GISH 2BHZA 4WV1A 3MNWB 1IC4L 4KGJA 5B22A 2YPVH 1QP1A 1WZ1L 4WW2A 3K46A 4HKJB 1KYOK 1A1OB 5I1HH 4OV5A 1MFCL 3H9SE 2R56H 3OXRB 4JY5L 4JHWH 4ODHH 3WNLA 3B5GA 5JORB 5ADOL 4ELMF 1XCQA 3R1GL 4M1GH 4KDWA 3RWHA 4OLWL 2J8UA 1KJVA 4JFFD 2QSVA 5D7IE 5I66A 1N64L 2ITCA 5JW4N 4HMDA 1UJ3C 3OWEA 3W9EA 3D39E 3DX8B 4OI8A 1EBPA 4XPFH 3ZE2F 4L8CB 3BEWB 3GHEL 3VWJD 2CDEA 3VFTA 3ARED 1U8PB 1RZKC 3ARDC 4PRBA 4J1UA 1X4YA 1T89C 25C8L 3PGFH 1ZLUH 4WUKL 3N9GL 1LO3L 4JHAL 4X4YA 5TF1L 5FO7B 1REIA 3HS0B 4Y5YB 5M7QA 4E9LA 3TPUB 3M1BA 5L2JA 2V5TA 3PWJA 3VA2C 5IESL 2AK4A 4YDIH 2H8PA 5C0CD 3RZWA 1C8PA 2HA1A 2IC2A 3T77A 2DQTH 2XZAH 3J8F7 3U36B 3GSNH 2J6EL 1INQB 2Z8RA 3QXUA 4XNYL 5INCB 3L3DB 3TZVB 1FYHB 1ZGLA 2PYFA 1FL6A 4PB9H 2ATPB 4U1HA 2QQKL 4KROD 4P2RA 5CINH 3ALXA 1G1YA 3H9SA 5DJ6B 5IBLD 3P0VH 4NRXA 1MIML 2RCSL 5D7IB 5IB1A 3VWJA 3WIIH 3V95A 2R8SH 2XTJC 2IQ9H 3ULVL 1DBJL 2GAZA 3QEHB 5DHYA 3UTSE 4UBDC 3JWOC 4HKJA 4JGMA 4QXUH 3CLFL 4N0CD 1ORSA 2V2TA 2YBRA 1CTNA 1RY7B 3GMNB 3MRBA 2WIIB 4GRLD 4K7PL 4N0RA 1J18A 2VOTA 5T1LB 2QADC 4IRJB 3DXAA 2AJYL 2ICWB 2XA8L 1CDUA 4LKCA 3BP4B 1MAJA 3KPOA 4XZUA 4TPRL 5DK3A 2YD4A 4Y4HB 4NCC2 1GOGA 4HFWA 5MI0C 2A6KB 2DLFL 4M1CD 2WM0A 1OB1B 3C09C 3TO4B 2VLKE 4BZ1H 4HWBL 4JFDA 1YYLL 3IRZA 2UUDK 1G1CA 3V79C 1T5XA 1OP3K 4O9HH 1Q38A 5IQ9A 3ZE2E 1Q1JL 4JVPA 3MLPA 5DFVD 3EKCA 5DRZA 1R0AL 4HF5L 4K23L 3C6LD 5FYJU 3SJVE 1Z0MA 1AR1D 4LCIH 1YEIL 2E8ZA 1R3JA 2K3TA 3D18A 4GRWB 2H1PH 1V3JA 4OZIF 3S35X 4RA3A 3V0WH 1U9KA 2EDOA 5AWNH 3QISA 3TCLA 2VKXA 2PF6A 3VD4A 3BGFB 3WD5L 1A14H 1A47A 4ODSL 3T0AA 4L4TD 3FRUA 1A2YB 4ONGH 2AEQH 4P4KA 3SDAC 3P30H 1UB5B 1OOAA 5DSCA 4OF7A 3C60D 5IMMB 5BRZD 1VB9A 1NAML 3D25B 4I3RH 2B0SH 1QFOA 4CBPA 4WI5A 3RL1B 1I7RA 1H3VA 5HSFA 1FVCB 1QOKA 4LDOB 5JLZA 5CCKL 5D2LB 1LD9B 1XGUA 3CCHB 1MSPA 3WMSA 3U9UA 2GQHA 3STBA 2XPGB 4PJ5D 4GSDL 5DVOA 1HHJA 3AROA 3KXFD 3QDME 5DJCA 3GSUB 4LCIL 3TBTB 1MHPL 3MACL 4PR5B 3ORJA 4Z95H 2QSCH 1I8IB 2FH6A 4AEEA 1I1AB 3L5XH 3CFJA 5F9AC 2BRRL 3PQYE 4TUOB 4XH2A 1EHLH 1FFOA 5ALBL 1Q9WB 3PP4L 1GVIA 2F19L 3NFSH 3FONA 5CJ5A 3G6JE 1IGCH 1CFQB 2YC1B 1XZ0B 4OM0L 5CLTA 2VXSH 2EDXA 2PETA 1FG9C 4GXVH 3QQ4B 1BAFH 1MI5E 2BVOA 2R0ZH 2VLRA 3MBED 3OGCB 4FQJL 3FB8A 4Q6IB 1MHPH 1FVEA 3MACH 5HHOA 3MLUH 2VAAB 3JUZA 2YUZA 2Q87A 2R2CA 1OSZB 1FVDA 2G75B 4LKXB 3PWNB 3ZT7A 2YPKA 2FEEL 3PDOB 1ACYL 1J05A 4O2EB 1WC7A 5LXGH 4O4YH 4PRPB 5GISL 1CXEA 3OKMB 2NY0D 4HPOL 2F74B 3EFFB 1A6TA 3FQXB 4HGKC 1KXVC 1EZVY 5EU4B 3ARZA 5I17A 1K6QL 3LIZL 2LFGA 5KAQF 2Q6WB 5FM4A 2SEBA 1ONQB 2Q86A 4P23C 1QZ1A 4J3VA 1WWWX 1S5IH 4PJ8C 3MRCB 1FO0L 5EUOF 5ICXA 3QRGH 3JSSA 4WFFD 4GXVL 1IAIH 2VN4A 2EKSA 1IMHC 1Z0NA 4OZ4A 1JNLL 1UQSA 3ZHDA 1Z9OA 4NO2B 4HUMB 2V9QA 5F6HJ 5IHZB 2DIAA 5C3LD 4XRCB 5KZCB 3VGBA 2LVCA 3S4SA 4LRIA 1PJ9A 5I1IL 4K23H 1T66D 2YS4A 3VG9C 1BQHA 4BSVA 1TJIL 4ISVB 3CFCH 4QRPA 3MXVH 4KUCF 5C09D 4PRIB 1SYVA 4FQ2H 5K9KB 4H8WC 2D31B 4OD1L 2IWGA 5CEXA 4KKAC 1AKJD 5CEZD 5EPMA 3WNKA 4X7CC 4AIZB 5CJ8A 3O11A 3RZCB 4TRPH 4PRNB 2FB4L 3ZZ1A 2WBKA 1E0OB 3EFFA 5D6DA 5DK0A 4AENB 3ARFC 5IVOA 4XI5C 1T83A 1DLHA 4PJXA 4YBLB 5C0RH 3GHBH 4GXUM 1CGYA 1AGDB 2BDNL 1U0QA 5GZOC 4RAUB 2IH3A 1JHKH 1OQOA 3R0NA 5DHXB 5IVXE 3H7LA 4HFUL 2FLBT 4EI5B 1F58H 3QIBC 2YC1A 4B5EA 4FTVA 4N9OB 4L29B 5ITFB 1E4WH 2BSSA 5E00A 1B0GA 1HYSD 1KELH 3VXPB 4HHAB 4NQED 3UROR 3PQYA 3L5IA 5DEFB 3JZ7A 1U8HB 3K1DA 4BUGA 1F4XH 3OB8A 4PJCE 4F37K 1J1XL 4ZYKB 4JRWA 3QQ9C 3OKOA 1M6OB 3JV6B 5MENA 1RZFH 2W59A 1VACA 2JB6B 4M62H 3SN6N 3TF7C 4TNWF 2OTUB 1BJ1H 2A2QT 1TXKA 3C2AL 4YBQD 4FTVB 3CFIC 1U3HC 3P9LA 5GZOD 1CFVH 4ZUWB 4JO2H 4PJ9A 4KJYB 3HE7C 4LSTH 4AT6A 2X70B 4JFED 2PN5A 6FABL 1NEZA 1BOGA 4NM8H 4YNYB 4L3ED 1K2DA 1KB9J 5DK0B 3RUGB 5F1SA 4AM0A 2HKHL 4UQ3A 3QWQB 5F3BB 2LU7A 1IQWH 3OKMA 3MA9H 2IG2H 2EC8A 1CFVL 3BDYH 5HYJB 5F1OB 4MYWB 4OM1L 3PG2A 5DTFA 3C5SB 3RWEA 2BVTA 3NCJL 3RUGE 1I75A 1CT8B 4LSQH 4UOJA 3VXNB 4N68A 5DZOA 3RNKB 3O2DH 4PJAA 3L3HA 2NY3C 5IJVB 4EDXA 2IALA 4OCWL 4F9PA 3JV0A 2R8SL 4WUUE 2NY6C 2Z35A 1Q9KB 2QKIB 5BS0E 2ESVD 4YHOL 15C8H 1Q0XL 2CLRA 2HG5A 4FN0A 3RVVC 4WY7H 1CDGA 12E8L 1RJZA 1MHHA 4MSWA 2C1OB 4CGTA 1QVOA 1WIUA 4JZJB 4P46C 4NSKA 3SCMD 5HHPB 2CR3A 2BVPB 4NQEA 1S9VA 2J6EH 5KSBE 1N0XH 3N1QC 4MAYD 1CE6A 1BJ8A 5B8CB 4DAGL 3BO8B 1O7VA 2PXYA 1BLNB 2QSCL 4ZAKA 4MLIA 3OQ3B 1JPTH 3QUYD 2DQGH 4X7DC 5JXAH 4ETQB 1HI6B 4NCDA 1WBZB 1WFTA 3BOVA 3QFJD 3UTSA 5ICZB 5TF0A 4O02L 1YMHB 4BH8B 2FWOA 3GMNA 4UILL 5KVDL 2R0KH 4NQSB 1X5YA 4NWTH 2BFVH 4XC1H 2QADB 1RK0B 3LS5L 4R90H 5C0BB 3LN5B 5IEHA 4JJ5A 4CN6A 3TZVD 3WHE1 4CW1B 4W4OC 2FGZA 1ZGLP 1BFTA 5JIPA 5GRZA 5HTSA 3V4PH 3LEXB 5KANI 3QA3B 1S5HB 1OAKL 4ODSH 1PZ5B 1ZHNA 4ELKB 2ESVE 1YUHA 1EHAA 1CBVH 3G5VA 3OR6B 5I76A 4ERSH 1S7VA 2NLJB 1ZANH 2Y5TB 3FZUD 4L8BA 3OGOE 4PYHA 3CFKA 1J9CT 2W0PA 1MCOL 4OFDA 3DSFH 1NCAL 1MCBA 3MOBL 2DQHH 3RKPA 4POZC 2NY6B 2E7LA 4PJBB 3QFDB 4P23B 1LDPH 2VDOH 3ES6A 2XIDA 2BNUA 3QUML 1D9KB 2XICA 2EYRB 2NXYB 4ODBD 3K4ZA 1YUHB 1OWRM 3PWUB 4QHLA 4BQCA 1G0DA 2GJ6B 4WI8A 3SE4C 2X7LB 1KLGB 5IBUG 1ZAGA 4KI5E 1F4YL 5D1ZC 2GSIA 5D7JA 4PGDB 3IJSB 3REVB 4Z0XB 5JQHC 2BOBA 2X6MA 1YNKH 4YDVB 1PG7L 4YHIA 2NXYD 1S7XB 4Y4FC 2HVKA 3KPTA 5DD3L 1DBKL 3I3BA 3DGGB 4NRZA 5IGXL 2Z8WC 5IB5B 3GEWB 3OJDB 4NDMA 3UTTA 4HUWA 1TJHH 1FGNL 5FCUL 5B39B 4F7TA 3VXTA 4FXLA 4U4BA 5B3NA 4JDTL 3WUWA 4DKFH 4OD3L 4I77L 2F15A 3UEZA 5J3HC 3RJDA 4XCNB 1T1WA 2I24N 5E8NA 4OZGE 1YNKL 2UWEF 5TPWH 1M1SA 5DQ9B 4LHUB 5TE6H 2CXGA 5HI5D 3LRSB 5LVEA 2CKBA 2OM5A 4WNQA 1CGXA 3UBXG 3EBAA 3H9SD 5L0QC 1SJEA 2OXHA 2X4OB 2X44D 5EU7C 5DWUH 4UINH 3MLTA 2F53A 4P5KA 4E42B 1X44A 3P9MA 1K6QH 2IANA 4Z8FL 5L8JB 1P5VA 3UAJD 4CNIB 2EE6A 3G08A 4OZGB 2IBBA 4LNVA 5JW3L 3CSGA 5D6CA 5IJKC 3F12B 1J1OL 2HWZL 3HZMB 5I1JL 1CE1H 1XF2B 4GW1B 1MIEH 3S9DB 4ONFL 5EC1A 3MPCA 3ARRA 4LGRB 1R3HA 4WGVB 2H9GA 3D6GA 3DGGA 4NRZB 4HGWB 5C09E 3C5SA 5CS7A 1YJDH 3H0TB 5AAWA 3DX9A 1ZEAL 1F3DJ 4YDVA 4D9RE 2V9TA 2DIJA 3AU1A 2GKIA 4OFIA 1Z5LB 3AS0A 2JTDA 3CDYA 3BUYB 3VI3E 3O2DA 2GSIB 5D7JB 3LDBC 5AD0A 2EZ0C 4CADB 2Q3ZA 3T77B 3MLWH 2HRPH 4PG2C 5F96H 1W0WB 2VZ3A 3MRIB 4U1MB 2F54A 1GSMA 4KTYA 1BFVH 4PV8B 1ZLSH 3GSWB 1J88A 2X4QB 4F7CA 2AGJL 2EYTA 2V7NB 3UBXB 1WBYB 1JF5A 4HK3J 1XGYL 2VDLL 4Y88A 4QRTA 2VLJA 3O6FB 5T5FL 3VFMB 4LHUG 1A4JA 3FZUC 2PCPB 3F6LA 5CJQL 5IBUB 3O0RL 4M6NL 3WNNA 4ONFH 4KRPB 3HC4H 3WHXA 1SEBA 1AR2A 3ZKXB 4ZO7A 1B6UA 1WAAA 2GTZB 2AGJH 2C3XA 1CGTA 2OSLA 4XXDB 1FNSL 5IFAL 1BEYH 4WO4B 4A6YB 5BS0A 3CUPA 3VXMD 4U1NA 4OQTA 1CVRA 1JNLH 2N7BA 4OFYD 4K55A 4GLRI