3RVUD

Structure of 4c1 fab in c2221 space group
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
221
structure length
221
Chain Sequence
VQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISYSGTTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCGRTGVYRYPERAPYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4C1 Fab - light chain
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 45
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvuD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvuD01
1ADQL 3NIDF 7FABH 5E5RB 5GGTH 2HG5B 2APVA 2CD0A 4R26L 1XIWB 2FL5B 4ESKA 2AXHA 1WAAA 2D7TL 3RWDA 3WJJC 3AMLA 3QDJB 4U1SA 4OZIE 2Q8AL 1UC6A 1J1XL 2HG5A 1AIFB 1XIWA 4IDLA 2APTA 4NC1C 2D03L 4UILL 3V6FB 1GZPB 1MHEA 4Z7OE 5CJOH 3BKML 1KC5L 4FS0A 1RZ7L 4M7KH 3PHSA 2FATL 2BSRB 3VW3L 4KMTL 4R2GD 2DDQL 3ZDYF 1MWAL 2NZ9C 3MRBA 1CDCA 3FFCD 4JEGB 1FFNB 5DJZB 5E9DD 1ACYL 3S35L 4XCCL 5IP4A 2ZP0T 3VGAC 4PBXA 1FFNA 5DJZA 5E6ID 3JBG7 3VXQB 2NNAB 3QXVA 1SBSL 2VL4A 1TQCC 1JWSB 1MHPH 2OM5A 3IXAB 5SX5K 5IOPA 1U3ZA 4MB5A 5DTFB 1TPXC 4K8RH 3VXQA 1IEHA 5JDSB 5IB1A 2XICA 1KEML 4ODXB 1ROWA 2WMPA 2FEDC 3KYOB 3C60B 3AM8C 3IXAA 4GUPA 4K2UL 3ZKXB 2QKIB 4PPTA 4M62H 2ADFH 3HE7B 5JDSA 4A6YH 4LVOC 2P42B 1WC7B 1JPGA 2AP2A 4ZFGH 3INUH 1E6OL 5DMKB 1BX2A 1OAZL 3SY0B 4N0RA 3BEWB 3QB7C 3BP5B 4Q9RL 2QKIA 1NANH 3HE7A 3ZSSA 1IEAB 1WC7A 3CFJB 2C26A 4MD5B 4GLRI 5DMKA 5CZXD 4HGKC 3SY0A 1P4IL 3BP5A 4JFPB 5D9SB 3SCMD 5FKPA 4PUBH 1GVIA 3VJ6A 3L7EB 2XQYK 5EBMA 3CFJA 5I6XB 1CF8H 3GSWA 4KJYA 3MRMB 3HNVL 2VZ1A 3GSNL 4OB5H 2O93L 4U1LB 3L9RB 4JFPA 3ARZA 5E70A 4ZYKB 3T0VA 1A6WH 5HGBB 4AJ0A 4E42A 3L7EA 1A7RL 4LQFL 1TCMA 4O4YH 2XA8H 1OCWL 1SMOA 5GRUH 5HGBA 2QLVB 4LQ1A 3QPXH 3IKCA 3KLHD 5GZND 4U6VH 1XZ0B 1KN2H 1MJ7H 1EO8H 3QNYB 2I26N 2J4WH 2YD5A 2YPKA 5J06A 4UTAL 3WMSA 4U6HB 5D7KE 4KZDH 2SEBB 3F6LA 3X13A 3F65A 4U0RC 4N0CC 4KVCL 1XZ0A 1KGCE 5IT2L 1R3LB 1MNUH 4S11A 3QNYA 3KJ6H 2W9LA 5JLZA 4X83A 3IU4L 2AQ3A 2A9NH 4KDTA 3MV01 4NCC1 1R3LA 3LIZH 2R8SL 3GI8H 3BIBX 4XP6L 3RDTA 1NC2A 1J8KA 3UTTB 5FECB 4P2OD 4BSJA 3UPAA 1AD0B 4ELMA 3Q5YA 5I71B 1KB5B 3D87B 4DUXA 3HHRB 1MAJA 2P44B 2UYLB 3UTTA 2FGWL 2V7NA 1MAMH 4X7SL 1T04A 5LG1A 2ZPKH 1KB5A 1WUNT 5K9JL 3IVKA 3O6FD 4PR5A 5LAXA 1A6UH 1A1MB 1JF5A 3G9AB 5HGDB 3D3VB 4HUNB 1P5UA 4NQDE 3RL1B 4JKPL 4OLZL 2NY2C 1NUFA 1UJTA 3H9HB 1MCHA 1WIOA 1CLOH 5I9QB 2YPLB 1MF2H 2DQJH 1LDPH 1SQ2N 2MKWA 5D8JL 5HGDA 5CSZB 3D3VA 4HBCL 1N3NB 3RL1A 1XGRA 2VLJE 2F53B 3PWPE 3WS6C 5IUSA 1JGLH 2YPLA 1BJ1H 1QP1A 1NFDB 1QFWH 1RUQL 1WZ1H 4HF5L 3UTZA 1JK8B 4Z7UF 1N3NA 1DQDH 2ZG3A 1Q9KB 4MCYB 5FB8B 4PG2C 2PR4L 1W0YT 5D93C 5DC9B 3BISA 1N2RB 1VB9A 1XH3B 1T0MB 4XP4L 4YDJA 4P23C 4HK3N 1G84A 3A6BH 4Y2DC 4GJTB 5A16A 4GG6B 3U0TB 4E5XB 3A6OA 3WIIL 1XH3A 5FYKU 5B38G 4BH7A 1EJOL 3PL6A 4PJ8D 3L3KB 1U8NA 1EGJA 1SBBA 3U0TA 3P77A 3X3GL 4E5XA 4L8SC 3QUYB 4MA8H 5DHVH 1HQRB 1JNLH 1NCDL 3WHE0 2CXKA 3L3KA 3ZT7A 5J8OA 4ZNCD 1CDHA 4U49A 3C2AL 3GI9H 3SDDC 3QUYA 4I3GA 1CZ8L 5GGUB 1SVCP 1UEYA 4MAYC 4Y1AD 5DD1H 4JRXA 4ODWB 1OARH 3NIFE 3LD8C 2YUZA 3U7WH 1NGQH 4M5YH 1KELL 3O0RL 2P4AB 3V5DB 4LCIL 5GGUA 2J6EH 3GJEA 1S7WB 3D2UB 5GRJH 4DGIL 3ZYOA 4S10A 5C08E 4ODWA 4LLDB 4YHYC 4JFEB 3DTXB 3RVVD 4P5KA 4G7VL 3HUJA 1S7WA 3O2WL 4BFIB 5I1HH 3V9FA 4LLDA 3VWJA 3K74B 3F62A 3BZFB 5A43C 3LS5H 3MRPB 1DJSA 4NC0B 4HH9A 3VDBA 3BH8B 3KPSA 2MJWA 4KI5E 4BFIA 5IK3A 4WY7H 5HTSA 3AVEA 1NCAH 1S5HA 1JFQL 4G8FB 2BOCA 4ZFFA 4GAGH 4QRPE 2GK2A 3ECBB 1EUTA 4OSUH 2X4NA 5HHXL 4G8FA 3K46A 3ARFC 5DO2D 4IHOA 3ECBA 5FKAA 2VXSL 5D7IA 2KL6A 2QSCL 1QRND 4NKDB 4OZFA 3SDAB 1LEGB 2P5WD 1FAIL 4ZUUA 2VOTA 1ZA3A 2DLTA 5D96C 4BZ1H 1S7XB 4LVHC 2XV6B 4X7TB 4NKDA 4OLVH 4Z7WA 4MJ2A 1UACH 2HP4A 4KTYA 3CFDA 4PJXF 4K7PY 1LEGA 4Q9CA 2VQTA 5IB3A 3RVXC 2GK0B 4UAOB 4QRQB 1QBLL 1CDUA 3I02B 1S7XA 3SKOA 1J5OH 1MFEH 4OD3L 4IS6B 3RTQB 5LGJB 4QRQA 3WSQH 3KR3L 1QRKA 3DARA 4PRIA 5IHBA 1DVFB 4I3SH 4IS6A 3SDYL 5HI3C 5LGJA 2OSLA 3IU3B 2DLGA 3C6LD 5FO8A 4DWHA 4HD9A 3I3EA 2ZZUT 2BCKB 1G7QB 3EDJA 5MENB 3F7QA 1HZHL 1PLGL 1MVUB 3B5GA 3IU3A 4GKNA 1BD2E 4UOW0 5LXGH 2IGFL 4ODUB 4RDQG 4D9LL 4RISH 2VH5L 5DQDL 2D9CA 4O2EB 2IMNA 5IMOA 4OIIL 4MXWL 5ALCL 3EYQD 4FMFA 2IWGA 1JUFA 1HXMB 1MVUA 4JQIL 4DGYL 1EH9A 1CE6B 3DROB 3VXRA 4O2EA 3QHFH 2DQUL 3RFZC 5MEOB 3QSKB 4LLWA 3KPNA 2OYPA 4OD2A 1G7HA 4LIQH 5GPRA 3DROA 1YEJH 3N50A 4ONFL 4OBRA 4ELKB 1YEDB 4EEEA 1K9TA 2NY5L 1BQHG 3LN5B 1FGVH 1SEBB 1YEDA 1BBDL 4IRSC 4H8WH 5FO9A 2HRLA 3P2TA 3S36X 4NP4L 3LN5A 1QFUH 5IROA 3V7MA 3U7YH 1SEBA 1L9NA 3R0MA 3FFDA 2ARWA 2NY1C 4QY8B 2Q3ZA 3VRLE 3TBSB 3BGAA 3GBNH 4HLZH 5E00A 1LK2B 5ADOH 3T8XB 4P5TD 3AS0A 3O6KH 2Z9TA 4QY8A 1K4DB 3D85D 4U2YA 3TBSA 1TZIA 5I1LB 4M1GL 1YEFL 3TYGH 5IMLB 3QQ4B 4ONOA 2CKNA 3ROLA 3REVA 5I1LA 4ZNEA 1OGAB 4X6BB 3P9MA 5CMAB 5HVFB 2XWTB 4L3CA 3QQ4A 4ZODA 2WQ8A 5IQ7L 4WUUB 1IAIH 4IIQA 3PG2A 4M03A 1K8IB 3KPTA 5CMAA 3WLBB 1T7YA 2OR7A 2OJZL 3BPLC 2X40A 3KNBB 5CIPH 4TQEH 3U0WL 1AKJD 3SE8L 2J7LA 5D7KD 4WUUA 3MROA 3BI9X 5FM5M 4G8GA 2R4SL 1K8IA 4LSPL 1KGCD 1Q9WB 5FYKL 3ZYZA 1NBZB 3OKNA 3KNBA 4NHCL 1T2XA 4NUJB 1CT8B 4GXUM 2B5IB 3D9AL 1MFAH 3W11C 1MRDH 4YH6A 4CADB 1Q9WA 3U1SL 1NBZA 5HDOA 4U2ZA 3CMOL 2FNBA 1CT8A 4RAVB 3WLWD 2MTPA 4NN5B 2W59A 5DURD 3C08H 2WINA 4CADA 1II4E 1J1PL 1P4BH 1AGFB 4ZO6A 4LSVL 2P5EE 4YFEA 3QI9D 1OQOA 3ARED 5M95B 2R2EA 3BIKB 5CBEA 2DOCA 4Y5XB 1RMFH 1NSNH 1ZKAA 3R1GH 5IM7B 5JHDA 2NXZB 2ZCLH 4TSBH 3FB8B 4HMCA 3ARRA 5DGRA 5KVEH 3MRCB 3BIKA 2PYFB 3RWJB 1I8LA 2JELL 4NQDD 2GIYA 3LEXA 4YHML 2B0SH 4JZOB 4HEME 5IM7A 2LABA 3KS0J 4CU6A 1XR8B 3FB8A 3MRCA 4PGCB 2PYFA 3BDXA 2X6MA 2XY2A 3RWJA 2NY4D 4GRMA 4KHTL 4Y4FB 1GH7A 1PVHA 4DN4H 4L9LC 4D94A 2VLJD 4JZOA 1G0XA 1FORL 1XR8A 2R2HB 3PWPD 2EDYA 5I8EA 3MRLA 1NMAH 2AK1H 3VGHA 1P9MC 3LKRA 4XPFL 1GCFA 5DJ8A 4N5EC 1I7RB 2R2HA 4LF3B 1WV7T 5D70L 1N5AB 2IJ0C 1KB5L 3MFFA 3GMMA 2M26A 3HG1E 4R4ND 4QXWA 3GIZH 1KEGL 3QUXB 4RFEA 1S9WA 1I1FB 4QT5B 5FAAA 2OP4L 3JWNC 2G60L 4N0UB 3X11B 4PJHE 4JANB 1W0WA 4HS3A 5LBSL 3CDYA 3TNMA 3CX5J 4NKIH 1MCEA 4QT5A 2NX5E 3SKNB 2BK8A 2CK2A 1NBVL 1CWVA 3X11A 4JANA 2VXVH 1HINH 3PP3K 1RZJC 1I8KB 1TNNA 4J4PA 2X05A 1MCQA 1HSBA 5ERWB 4OUUB 1DQJB 3SKNA 3RWCA 3MLVH 1QNZL 4TVPH 5EULV 4XC1L 1I8KA 4HS8H 2C3VA 5L6YL 3ULSA 8FABA 3RVUC 1GOFA 5ERWA 1DQJA 2EDBA 2G75B 5I1EL 3MA7A 5ELIA 1N59B 1MHCB 5C08D 4NBZB 5I1AB 1KJ3H 4WU5B 3FO0H 5CJQH 2G75A 1N59A 1N4XL 4JRWA 1CFVH 1OTSD 3QFDB 3FT3A 3TJHD 4ERSH 5I1AA 5I8KH 4P3CH 3LKSB 4RGOH 4QHUB 4WU5A 4HXAL 3U36B 2D9QB 3X12B 2EKSB 1PFCA 1WBYA 3I6LE 1HIMH 3FAXA 4KI5D 5KSBE 1KYOJ 3W2DL 1G7LB 1U2HA 3U9UB 5TPWL 4TULL 4S1SL 2CSPA 1U8HB 3PWJA 3NIGE 3U36A 5F97E 1CE1H 5D2NE 4OCRH 4QRPD 5DHYB 1G7LA 4G8EB 1WITA 2I5YL 3MLXH 1U8HA 4R2GB 4WEBL 4PV9B 2DM3A 2R2BB 4G5ZH 5TDNB 4NZUH 3BWAB 3SN6N 1HQ4A 5IBLC 3FFCB 3HNTH 4PLOB 5E9DB 4GG8B 4J3VA 3VFWB 4H26B 5D71L 3FO1B 4HWUA 4LLYB 4N8CH 5TDNA 1U3JA 3BWAA 3RL2A 3MRDA 3KXFE 5E6IB 2Y72A 4XXDA 5TF1H 5K9QG 5M7QA 4HQQH 3VFWA 1PJ9A 3FO1A 3G04A 1KNOB 3G5ZA 4QHLA 4JFFE 5IFJB 4H88H 1E4WL 1A1OA 2Q1EA 2E7LC 2N56A 2VDLL 3SO3C 3TBWB 1RIUH 2DICA 1UYWL 3CAFA 1FG9C 1KNOA 4ODBD 1DANU 4NO2A 3H7LA 4XT1C 5JXED 5IFJA 2F19L 5D7JD 1WIPA 2DQTH 1BHGA 5FV1L 3RKPA 3VI4E 5L0QB 3CLEL 3T3PF 4PJBE 3GSVA 4I9WE 5DSCA 3HR6A 2XN9A 1AGCB 3RI5F 4OZGF 5DFTA 2XRAH 2R69H 4ODHH 3C5SB 1K3ZA 4P2QA 1SEQL 3ZKQD 1CGSL 1U58A 3C8KB 4LIQE 3V7AG 1M7IB 5EOQH 4K8RD 1MRFH 3SCMB 1TETL 1DL7L 4D8PA 1XCQB 3C5SA 3OAZH 2B20A 1BD2D 3V6OC 4K3EL 5DEFB 3QIWC 1IFHL 1U8IB 3T4YB 2LAGB 3SCMA 2Q87A 1XCQA 2A74A 3CIQA 3ROOB 1A14H 3BPNC 1J1OH 2XZCL 3T4YA 1NGXB 1ZGLP 1TJIH 1R3JA 1YUHB 5ALBL 3BN9D 3ROOA 4YHNB 5F71A 3RP1A 1TVBB 1IKNA 1HEZA 2NXYC 4HUVB 1NGXA 3QA3B 4FQCL 2X4UB 4EXPX 1AI1L 2DJ4A 3B9VA 4XBPB 1YUHA 2UWEE 2VDRH 5KS9B 3QCUL 1TVBA 2JCCF 3MLRH 3OKOB 2HJLA 4HUVA 3DMMD 4GBXA 1R3KB 4QTIL 1Z3GH 4AENB 5D6DC 4MS8C 4XBPA 3NCJL 5KOMC 5KS9A 3KS0H 1ZLWH 1NL0H 3GM0A 1YEEH 1EAJA 1JIBA 4C59B 3MUGB 2A6KB 1QTYT 3E1F1 3U4BL 4AENA 3ZE1F 3SKMA 3DX7B 2E9IA 4P2OB 4DEPC 5FO7B 4HIIB 1VFMA 3GGWB 3IFNH 3MXWH 3DVIA 2IBZY 3C8DA 3LOWA 1ZVSA 4HUKB 1CXHA 5F7LB 4EIZC 2R56H 4IRJC 1MREH 2VXTL 4Q2ZA 4UDUA 1ERNA 2UZYB 4P2OA 4CJ1A 4H5SA 4LSRL 1JGDB 1P7QA 2YD3A 5FK9B 2EIEA 4X5WB 5K9KB 2FD6H 5D1ZC 1IGYB 3O6FB 1WEJL 4PS4H 1FP5A 5E0QA 2OI9B 1D5MB 4KRPC 5GS0L 3S4SB 1JGDA 5HYEA 1S7SB 4X5WA 2WZPD 5DLML 1D5ZB 1IGYA 1QVOB 5D5MA 2DQGL 3JVGA 4LHUG 4OZHE 3RX5A 4DKEL 1D5MA 5EA0H 4MSWB 4K9EC 4OGAC 4ZS7L 3S4SA 1S7SA 4WFGE 1QLEH 1D5ZA 5C86A 4JRYE 3NCBB 2OXGA 5I76B 1E27B 5ESVB 3H0TA 3B6SB 4RGMC 3PGDB 4MLIA 5EOTB 5I76A 2CMRL 5ESVA 3B6SA 5FA3B 4JR9L 3P0VL 2BVYA 3R4DA 3JV4A 1OAUH 4PIRF 3PGDA 3CSYA 4UUJB 1UQSA 5EOTA 4F7PA 1ZHLB 3MJ9A 3ZHDA 3IDMB 4R9HA 4DAGL 4X6DF 5FA3A 1S9VB 3T77B 4BK5A 4TSCL 3OPZL 4RZCB 5AZEH 2PTTB 3DHJA 2ZCKH 1RULL 4MA3B 5C0GB 3QJFB 4IRZH 4PJ8B 4UUJA 5DRNA 4LEOA 4AH2B 1H3UA 3ES6B 4M7ZB 1S9VA 2EC9U 3L1OL 1MY5A 4RZCA 2IAND 2ITCB 1BEYL 2PTTA 4MA3A 2VITB 1ZGLB 4AZ8A 5KSAC 3QJFA 4AH2A 3VXMD 5F3BB 4M9OA 3ES6A 3OB0H 5C9JB 2ITCA 1U8JA 4FQJL 3PQYE 4Y1AB 2YRPA 3HAEG 2YD4A 4RRPA 4ZUWB 4FP8H 2XKSA 2BC4A 4HCRH 1AQDA 1F90H 2NY3D 4JFOA 1R5WA 3S3SA 2HKHL 4XC3L 1Q9OA 4FFZL 2O5YH 3DVNB 3TPUA 4E41A 2W9DH 4EVNB 2MKLC 5DWUH 1EPFA 1JJUA 4WW1A 5JXAL 2X4QB 3K80A 4EI5A 3DVNA 5KN5B 2DWEB 4NKMB 5I66B 4DOHE 4EVNA 1E4KC 3SDXB 3HG1D 1AXTL 4LASL 4F7CB 3PV6A 3VXPB 4TVPE 5KVFH 1N8ZA 5KN5A 1CFSB 4M6AA 1DQMH 4P9HH 1T3FA 4FQIL 2EH8H 3CDGA 3QEQE 2K3TA 3Q1SL 1B88A 3PIQA 2J88L 2CLRB 1SYVB 2NX5D 2MPAL 3QHZH 4OTXH 3TN0D 5D2LE 3QEHB 3K8MA 1WCBA 4KQ4L 1HK6A 2KQNA 1MFDL 5D1XD 4OBSA 5IBTL 3NOIA 1SYVA 1VKXB 2YC1A 3QEHA 2HFEA 5DMGC 4WGVB 3RIAF 1QRNB 1JNHB 1R6VA 4FZ8H 5EZIL 3WNPA 3WUZA 2R9HC 3DSFL 4HKXB 2P5WB 5C0FB 4YFDB 1NAMB 1NQBA 3Q3GA 3S5LG 5BV7C 1XGYH 3SGJA 4DW2H 1D3CA 3BYYA 1P6AB 2AV7B 3FJTA 4UNTA 4HKXA 1NJ9A 1TZHA 5C0FA 4RFOH 3RZCC 4I13B 5EU7C 4JPKH 3IDJA 5ITFA 2H9GA 4GW5B 1BOYA 2YXFA 3I6LD 1JF1B 5DFVC 4ACPA 1UWEL 1LK3L 5BQ7B 1OF2A 3CH8A 4BJLA 5GS2H 3PP4H 2J1KA 4F3FA 1RJZB 3G6JF 4GW5A 1FZOA 4YDKH 1J7VR 2VUYA 4PTUB 3MRIB 3C6LB 2EXYD 2FX7L 1NPUA 3V5KB 3EGSB 4NNPH 4I48B 1ZT1B 2ZUXA 1FL3A 4TYUA 2H32A 5BOPA 1WZKA 2EKJA 4LNRB 5DVOA 5DK2B 5F7KC 1OP9A 1I1AC 5DDHB 3CU7A 4I48A 5C3TA 3BP6B 5F3HB 2IQAB 4KMLB 5SWSD 4WI4A 1C8PA 1QLRA 5DK2A 4MCZB 1SJEB 5DJXB 3ALWA 1FZKA 3WKMH 3O45B 5F3HA 2JJSC 4PRNB 2IQAA 1JPTL 1FZJB 4JFHE 4G6FD 3WHXB 4CRPA 2R0LH 2OL3A 3BKYL 5DRZB 4JFFD 2W60B 3JWOC 1WZLA 5KAQG 3O3EB 4MQ7B 4WJ5B 1KLFA 1FZJA 1XT5A 4BKLB 1Y0LB 4WHCA 5DRZA 5D1QD 5LGHH 4F2MA 1H8SA 4CGTA 3LRSA 4MDIB 4WJ5A 5DA4A 4P4KA 3LKNA 4I9WD 5I0ZA 3RHWK 4BKLA 5ISZA 1Y0LA 5EC1B 4J3TA 5JO5B 4UIKL 1AD9B 5GS1C 1P1ZA 5HD8C 3S8WA 3MCKA 1T21B 3IAQA 5EC1A 3Q5TA 1BQUA 4I0PC 5D7LA 4YHOH 5C0BE 1N0XH 1AD9A 4P5TB 3RA7L 2CDEA 3Q6GL 4P59L 2D7TH 3MQIA 3UDWC 1S9KC 1DUZA 4POYA 3D85B 4TUJA 5IFAL 4PLKC 4O9HH 3T65A 1L0YA 4X7FC 3TCLA 2JIXD 1DBAL 2NW2B 2D03H 4HK3J 1T4KB 2XT1B 4OLXL 3U0PB 5AYUL 3D85A 4YDVB 3VGDA 2EYTB 5F9OL 3O11A 2PXYA 1A4JB 4MVBC 4FQXC 3LH2H 3WFBL 2OR9H 2NW2A 4TNVF 2FATH 4C56E 1X4XA 3VW3H 6FABL 4JN1H 1G9MC 3QYCA 1OL0A 2DDQH 3HUJF 1OP5K 4JGMA 3MBEC 1VACB 1TVHB 1AKJB 3L5HA 4XNXL 1TITA 3CH1B 2XQBH 1G6RH 1JGEA 1QO3A 2E6PA 2X4OA 5KZCD 1CXKA 5J89A 4LAJH 4X7CC 1H3WM 1RIVH 2P8MB 3MACH 4KXZI 1LMKA 3MZGB 3HFMH 5I18L 3CH1A 1F11A 3BD5A 3UBXG 3KVQA 1SBSH 2I9TB 2VNCA 3EO9H 5J56B 5BVPL 4Y5VB 1KXQE 3OJVC 4HC1A 4FXKA 1FFPA 5DURB 5EU6E 4HPOH 4Y5VA 1JTOA 5IMKB 3PDDA 3QI9B 4Q9QL 3UPCA 3AREB 4M8VA 3ARDC 4OCSL 3V6ZA 5EBLB 1OAZH 3EUUA 4OCYL 2PUQT 3NFPA 4WCYH 1M4KA 2X5PA 4NWTH 5IMKA 4APQC 3BGMB 1BREA 1OTUC 5CCKL 4WHYH 4Y16C 1P4IH 1RUKH 4LRIC 4NQDB 5C0IB 4Y4KC 1S7VB 3O2VH 3ZO0A 5HHNA 3BGMA 3IJYB 5E8PB 4X8XA 5D4QA 5DJYB 3JV6A 1GSMA 2NY4B 1XF3B 1KCVL 2EDQA 4WFGD 1IM9D 4NQDA 3EDFA 2VLJB 2W1NA 4OZ4B 4YPGB 1PEZA 1X6LA 2NLJA 4HWEL 4LARL 4BFBD 4ETYA 1S7VA 4JRYD 2GSIB 5FOBB 4MA1C 2RFXB 4N68A 3PWPB 4QXGH 2EE6A 5E8PA 2J2ZA 1XF3A 1J12A 1DLFL 3LV3A 4AIOA 1PSKL 4YPGA 1JN6A 3T0EE 4XVUD 4XVSH 1DBJL 3DX6A 1RUML 1T89C 3PWPA 5LQBH 3GSRA 3GMRA 2X89A 3DOSA 1I9JL 3OG4B 4JCMA 3WS3A 4BQCA 2OK0H 4I18C 3HCVA 4DKFH 2R4RL 5KJRL 4YXKL 3SE9H 4RGNC 5C07A 3I75A 2PO6C 4X4ME 1FG2B 1Q72H 3MRNA 5CINL 5J3HD 2A9MH 2KDGA 5SX5H 2VZOA 3WCYA 3DX9B 1X5KA 4WW2A 3M8OL 5EDXA 5C2UB 1A02N 3ORJA 1KTKE 5EWIL 3EW3B 3OGCB 1D9KC 2F8OA 5I15L 3DX9A 1BIHA 5SWZE 4UV4H 1I4FB 2XWJB 4J2XA 4OFDA 3WN5A 5T1KA 1V05A 2VR5A 3NCCB 1GIGL 5ECJE 3BPOB 5CBAA 2PETA 1ZAGA 5IVNA 3IDIA 1CN4A 3I2CL 3FQXB 3H7BB 1NCWL 2XZAL 3RY6C 2CJUL 3B9KC 1EXUB 3BGFB 3MJ9L 5C08B 1SVZA 1FPTL 2QADD 1NBQA 1XR9B 4NPYB 4FG6D 3U2SB 3ZKND 4JG0L 2X1PA 1LP9F 3H7BA 2ADIA 4AEHH 3TGXA 1JE6A 5C08A 3CVHA 3EZ8A 4JKPH 1XR9A 5ANME 5JMOC 1JZ6A 3R0NA 5EUOA 4JO2H 3UTSE 1PG7X 3R8BB 4LCWA 4UT9L 3QEQD 4X5XA 5CKAA 3VE0B 4QF1B 5HI4D 4QRPB 3O3DB 1ND0A 1G0DA 2QSTA 4HEPG 5E2UL 1JZ7A 2Q76A 1NKOA 3UO1L 4XBGA 3VE0A 4QF1A 3WL9B 3HI6L 4ZDHA 4BSWB 5J11C 4LAQH 3T4AB 2VZTA 4QRPA 2EDKA 3O3DA 1XEDA 3CFIC 1DBKL 2IQ9H 3OJDB 3FN9A 3WL9A 1P53A 1Y18A 1MCWW 4P9MH 5SX4H 5FDWB 2J12B 4YGVB 4HX1B 3NH7H 3OJDA 3RKDC 1KPUB 2HTLC 4CVXB 4ZO7A 2J5LC 1CXEA 3GSUB 4JY6B 5T3XH 1C5BH 1NCTA 5F89A 4FN0A 3EFDL 1NCDH 4YGVA 4HX1A 1J8HD 1JP5A 3D39A 1JHKL 4S1DD 4IDJL 5F1IB 3VI3E 4KDVA 4CVXA 4JY6A 3CDFA 1CZ8H 5D7JB 3MV8A 3C5ZD 1VGKA 4YXHL 5IVZB 4D2NA 4XX1G 3MLYL 4XP1H 1EEUA 4X5LA 4H1LG 2EIZB 3QCVH 1LO2L 4KJQD 4LCIH 1S9YB 2DM7A 4DGIH 5IVZA 1S78C 4IMKC 4NRYB 4HWZA 4XZUA 4U6YA 3CSBA 3DWTA 4RWYL 1MELA 4QOKE 5F7UA 1ES0A 4PREB 3TV3L 1CQKA 1B0GA 3PWLB 3A6CL 3DV6B 2B8OT 3ZSTA 1S9YA 2HT4D 1BD2B 1F02I 3BE1L 1QEWB 15C8L 5F7WC 1QFWM 1NAML 3DV6A 4A6YB 4BYHA 1BD2A 3WHE1 1QEWA 4KJWD 1F3JA 4JFHD 4A6YA 2A6JB 4X8JA 3BDYL 1HH6B 5CILH 3OR7A 2OTUB 5HHXH 1A3RH 4BQ8A 4HKJA 5H37H 3MRRB 5E8OB 2QQLL 2BZDA 2ZOKB 1HH6A 4CBPA 2C5DC 2OTUA 4ALAH 1NUNB 4WFFD 2QSCH 2IC2A 2W38A 3DMMB 3UZVB 3MLZL 3MRRA 5E8OA 2ZOKA 4PGZA 4FFVD 3UXFA 3NA9H 1XFPA 3DMMA 3DRTA 1RUPL 4L8CA 1YY9C 2QHRL 1IGIL 3EFFA 5C0BD 4U1MB 4L1DA 2A1WH 5B8CB 4KROD 4NO3B 4RIRB 5GISH 2OL3L 4MX7B 2APXA 1NLDH 3RY5A 4WWID 5JIKA 4TSAH 4U1MA 3GO1L 3EYVB 3KR3H 3KYNA 4NO3A 5IWLC 4RIRA 1ZT4B 2HMID 4MX7A 1CFQB 3CDCA 2Z91B 3P11L 5HDBF 2B2XL 1YDPB 3QCTH 1H0DA 5K9QI 4HGWB 4JGUA 4LKXB 1MLCA 4C56D 3CU1A 3RWFB 3DJ9A 3LAFA 3O2DH 2Z91A 2FX9H 3LKQA 4P3DB 5SWQA 1IC4L 3TPKA 3GFUA 1REIA 2WUBL 4LKXA 2ATPB 3QQNA 3UC0H 1FL5B 4MXWH 4P3DA 3RWEA 2W0FA 4RWHA 4PJDE 2AABH 1FYTE 2P8LA 4F15B 2BSSB 1FL5A 3V0VA 3QIUB 3VD3A 5DJ2B 5IKCB 4G6JH 2FJHA 4KKCD 1L4IA 2XTJC 4NOFA 3ULUC 4ONFH 1GC1H 1YZZA 1R5VA 2X1WL 3VGGA 5A2KH 3QIUA 4F7TB 4HIXH 4L1HA 5EU6D 5CEYB 2EDDA 1EO7A 1VHPA 2WM0A 1BBDH 1FNFA 5E5MB 4F7TA 5CEXA 1HHIA 4JDVB 5CEYA 2H8PA 4U3XA 1HSAB 4HV8B 4JFYB 3G5YB 2IANB 1ZMYA 2IFFH 3W9DA 4K94L 5C0DB 5CD3B 4ZPTA 3P4LA 3VXMB 2PTVA 4JDVA 1FDLH 5AYQA 3QUZC 4HV8A 4PJGF 4JFYA 2IANA 3FQNA 3BP4A 1PD6A 5C0DA 4FXLA 3KPPA 3QDGE 5CD3A 1N5YH 2NY3B 3VXMA 5AD0B 3E8UH 4XP9H 1GRWA 3IFPA 2FIKA 2ID5A 4XPAH 5D72H 4UBDC 1KJ2A 3G9VA 5AD0A 4OLUL 5I0DA 3ZE2F 2F8VA 3S34L 2DTMH 4MQXC 3OR6B 3T0ED 5DHVB 1MCBA 2BOBA 3ZE0F 1JPFA 3NBNA 3RU8L 4NQVB 4YDLC 1YPZE 1TTGA 3HG1B 1IL1B 1L0XA 2OJZH 3BWUC 3EOBA 2CIKA 3RGVC 1U3HD 3SE8H 3O8XD 1KSRA 3WUWB 4KUCF 4PJHB 4NQVA 2ZKHL 5FYKH 3PDOB 1IL1A 2UY7A 3E6FB 4ZTOL 5INCA 2V17H 5JW4Q 4NHCH 4PGEB 2AXFA 3FZUD 3DYPA 4DTGL 2NX5B 3TN0B 1E28A 1VGEL 4PLJC 3WFHB 4JG1H 5JR1L 5CGYC 4KKAC 3TM6A 3MJ7B 3RHWF 1GGBL 3PDOA 2J6EA 3CMOH 4JLRA 5SWZD 1T2JA 1ONQA 5D1XB 4YLQT 1I8IA 4GAJH 2NX5A 3RUGE 3V2AR 3FO2B 3WFHA 3BUYB 1JZ3A 3HRZB 1AGDB 1J0KA 4O58L 5B39B 1HHGB 2CDGB 1MCPH 2D2OA 2EIBA 4JFZL 4PJ7E 5D1XA 1K4CB 4LMQE 1DDHA 1UH2A 3FO2A 4YE4H 4LSTL 4HIJB 1IC7L 1X9QA 5EH1A 3HRZA 1AGDA 2O5ZL 1MIML 1KUMA 1HHGA 3EO1B 2CDGA 1GGCH 2V5MA 1EFXD 4LCCC 4ZXBA 1UXWB 1K4CA 2LTQC 5KTEL 4FABH 1BQSA 3ISWA 2R1XA 4RAUB 5J0BA 4YHMH 5K59F 2CRZA 1HOCB 1HNGA 3V4VH 2B39A 3RQ3A 1FC2D 1IQWH 5BO1H 2N7AA 3UTSD 2AI0L 1UB6A 4HK0A 4CW1B 3ARGD 4X9FA 5J6HA 3F7PC 1VFOA 3PE9A 4GH7B 5EZJA 4W4NA 1BLNB 1IAIM 5D2NB 4XBEL 5BCAA 1A4KA 3DUSA 4CW1A 1PKQE 2YEZA 4HUWB 2BERA 1GOGA 1P2CB 1HDMB 1BLNA 4AEFA 3O6ML 3U30B 1XF1A 5DRWB 4NIKB 4HUWA 4OLWL 4P46C 3JTTA 2NY0C 2A73B 2W92A 1KEGH 1HDMA 4GLRH 5SWSB 2CPCA 5IW1B 4R97B 5CEZH 2G60H 2BMKB 5DRWA 1JMXA 5GS2D 2APFA 1YNKH 5B3JE 1LQSR 2YSSB 4P99A 5SWSA 4G6FB 1F42A 5F9WB 1Z9MA 5IW1A 2Y5EA 1FH5L 4JFFB 4OZGE 3NCYS 3QUKA 4PJ5A 4LRNL 5SV4A 3LB6C 3DV4B 4L4JA 3BXNB 4JPWH 2ADGB 43CAB 5D1QB 1QNZH 2CH8A 2YD8A 2CDFB 2IF7A 4LHUA 3BXNA 4H20L 4PJBB 1MPAH 1E6JL 3K1KC 4U7KA 2ADGA 3CCHB 4LSQH 2Z8VC 43CAA 4NN7C 3MLUH 1YQVH 3VMOA 4LLUA 3BHBB 5GGTL 1T66C 2I9LB 1X7QB 3BUTA 4PJBA 3ULUF 3UJJH 3VD5A 5I2IB 4LU5H 3BHBA 1EGJH 5IEHA 3QQ9D 1U36A 5CKGA 3GRWA 4HXAH 4NCDA 5TDPA 4RMTA 1SJXA 2JIXB 5CJOL 4HUUB 1FVCA 1IQDB 1B0RB 3BSZH 3OZ9L 4MNQE 4R7DA 5F70A 4PP1C 4S1SH 3HB3D 4TVSa 1FHGA 4HUUA 5ID0B 4MNHB 4AG4H 1B0RA 1B3JA 3R06A 2IALB 2I5YH 4S0TD 1QPXA 1V7ML 4QWWC 3VXUA 2HLAB 4MNHA 3MODH 2C7UB 3HC0B 5KG9A 2UWEB 5C70A 3QNXB 1Q0XL 2IALA 3AY4A 4P23D 2BVEA 2NCMA 1I75A 5KZCB 1JHTB 3PP3H 4NSKB 3NPSB 4NQTA 3HC0A 5F72S 1EEYB 4Y19A 5GZOC 4K7PH 2AQ2A 2G2RA 3QNXA 4YHPB 4XWGH 4K8RL 3FTGB 4G9DB 1MVFA 4PJEF 1IGCH 4NSKA 4FHBD 2AKRA 3U4EA 4YHPA 1EBAA 4M62L 2ADFL 4N8VB 4A6YL 1RUAL 2VN4A 5CIPB 5IB2A 2HT2C 4C4KO 4ZFGL 3INUL 4CJ0A 1JYWA 2F19H 3DBXA 3D69B 3SDDD 1F3DJ 4O5LH 5J1SC 1U8LA 2UY6A 3CLEH 4KHXH 3C60C 2Z8RA 5JOFB 4N8VA 3QUMA 1WAAE 2JJUA 1ZSDA 4HWBH 1SJVA 1Z2KA 3TO4A 4JQVC 1ORSB 1VESA 3LDBB 4I77H 2WW8A 3CX2A 4PUBL 5DQJB 1LNUA 4OZFH 3QG6B 1CF8L 4OB5L 1DL7H 1JRHI 1ORSA 1U93A 4AL8L 3WUWG 4JHBA 4OZHB 5CJXA 1A6WL 1FVDA 4QO1A 2OJEB 5DQJA 4IOFC 3D0LB 4KTDH 2I60H 4K3EH 4K23H 4U6XA 5GGRB 2R1WB 3KPQB 1IM9B 4OF0A 5I6XC 4JRYB 3QISA 3K8LA 1UM6H 5GRUL 4C54A 1FYTD 2GTZB 3FOLB 1V3KA 4NRXA 4X6DE 4OKVA 2JJTA 3QPXL 3C87A 3MR9A 1IM9A 1LDSA 2V9RA 35C8L 4U6VL 3Q48A 3S5LA 1KN2L 4HPYL 1MJ7L 3FOLA 5B39G 1EO8L 3VRJB 2J4WL 3QHTC 1OAQL 2BVPB 1NGWA 3KDMB 4KZDL 3MLPA 4DN3H 2BP3A 1A6VH 4XHQA 1MNUL 1X5GA 4ZOCA 3KJ6L 5F88B 3LMJL 2V9TA 3LPWA 1DN0A 2A9NL 5GGVY 3FKUS 3LIZL 3GI8L 4R3SB 1A7OL 3IFLH 4NQSB 4B5EA 1FLTX 3STBA 1WWWX 2MQCA 5DK0A 1NFKA 2R0WL 5F7NC 4F57H 2X70B 1W72H 1NCBH 2F15A 3VCLB 2KBGA 2WBKA 4J3SA 4WNQB 3OXRA 2B1HH 4NZRH 4WI9A 3QDGD 3CFCH 2ZPKL 2OZ4A 2IAMA 3K1DA 3BP7B 4M6MH 5I71C 5DJCB 5FYKE 4NBYB 2IADB 1A6UL 3TZVD 4JO4H 2EH7H 4RA0C 1A7BA 5JORA 4JPVH 2QADB 1F4XH 1E4JA 4JM2A 3P40A 3BKJL 4GMSH 5IF0B 2CRIA 2RCSH 3L3GB 4YHLH 1CLOL 2CO7B 4XRCB 3UBXI 5HGAB 1MF2L 2DQJL 5H35B 1QBBA 4KKBC 4DOHB 1XGPB 2DQGH 4ZAKC 4JHWH 5IF0A 3L3GA 3TFKC 2HRPL 1QD0A 2HAZA 4ZS7H 4GRLA 5CD5C 1JGLL 5H35A 4WI2A 1CDIA 1XGPA 1QFWL 4U1KA 1WZ1L 4BH8B 3QEQB 5IB5B 1DQDL 4NQEA 4PJFB 2VDMH 1XF4B 4RX4D 1T20B 2V9QA 3IRZA 3EOAB 4I0KA 2E6QA 5D2LB 4BH8A 5DVNA 5IB5A 4XPHL 3DUHA 2BHYA 3STZB 4PJFA 2CMRH 2VZUA 3A6BL 1T1YA 4X6CF 3IF1B 1I3RB 3P0VH 4F80A 1WLHA 3EOAA 2D7NA 3V4PH 1CR9L 2QJDA 1KIRA 1UVQB 1NEZG 1YN7B 1RULH 1QSVA 3ZZ1A 2XFXA 1CIUA 3TT1H 4ELME 4L3EA 1JNLL 4XWOD 3L1OH 4ENED 2AEWA 3UTTE 1KBGH 3MA9H 1J8HB 5F1NA 3ZHKA 5DD1L 4JJHA 1OARL 3QR2A 1T5WA 4EKXA 4KK8D 3U7WL 1NGQL 3C5ZB 1J8HA 3AU1A 1KB9K 2E6JA 2F5BH 2J6EL 1DBML 3QXUA 3MOAL 3QZWA 1HHJB 4M00A 5GRJL 3SDCD 5CEZE 1AQKH 4G43A 3WFCL 3GMPA 3PGCB 3T1FB 2RJMA 2X4PB 1EHXA 4IMLB 3MLSL 1EHNA 3D3VE 1T83A 3MRJB 5T3XD 3M17B 3T1FA 4GRWF 4NQXA 3LS5L 4L3AA 4KKLC 1JHLH 2DYPD 2YPLE 1GYAA 3EYFB 2WV3A 2VC2H 2LU3A 5L9DH 4WY7L 3MRJA 1NCAL 1OWWA 4LASH 3SE4C 3VMPA 3UAJC 1AH1A 4LPCA 1PQZA 4Z77A 2WP3T 4EIGB 1D5IH 4ZUTB 2W07A 3EYFA 5C0NC 4QYOA 3EDDA 1OAKH 3P0YH 2XTLA 3E2HB 3Q1SH 4ZUTA 1FVEB 2JKXA 1F58H 3W11D 1WFUA 3FQUB 4LNVA 1MFDH 5EUKA 1F4WH 1CFNB 1FVEA 4P48A 3KLAB 5IG7A 1VSCA 3WKNA 2A6IA 3AXLB 1E4XH 4Z76A 4JJ5A 4BZ1L 3FQUA 2ATKA 5CZVL 3SOBH 1IEBB 1CFNA 4OLVL 5TE4H 4M7JH 1UACL 4I8DA 1RZFH 1S7RB 1QA9B 2K9UA 3SDAC 5J9PA 4JRXE 4O51B 1CD8A 4Z5RA 1J5OL 1MFEL 3MLTA 4NKOB 3N1GC 2XI9A 5C0BB 1I7TA 3TH4T 5GIRB 2HN7B 3WSQL 1Y6MR 2YD6A 3LHPH 5DC0A 5FDYA 1G9NC 3VWKD 4I3SL 5C0BA 2FLRT 3HUJE 1OW0A 4UQ2B 4MNQD 5GIRA 2HN7A 3RTQC 2EEAA 1M7DA 1JPSH 4D0CB 4RDQF 2GT9A 5ICZB 3C09C 2EO1A 3KPSE 1DVFC 1I7ZB 1A7NH 5LXGL 4C56B 3MCLH 1RVFL 1UJ3B 2Y23A 5FYJH 3TBVB 4OI8A 5ICZA 4R96A 4CMMA 4WU7A 1SJHB 2UVFA 1UJ3A 2D31B 4E0RB 2QL1A 1LWRA 3QHFL 3VFNB 1QBMH 4FZEH 4JZJB 4LIQL 1SJHA 1H3VA 43C9B 1YEJL 4XCNA 5D7IE 4ZUSB 3RZWA 1VDGA 5C0RH 2W9EL 2FR4B 5TJWK 4OV5A 3VFRB 3J7HA 1BFTA 3KWWA 3VFNA 2RR3A 3HI1B 4JZJA 1F45A 4MAUH 43C9A 3HRPA 3O4LD 5BW7C 4ZUSA 5FF6B 2XZQH 5I1IH 2YUXA 1Z5LB 2C3XA 3FB6B 1NH6A 4H8WL 3BAEH 4Z7WE 1GAFL 5EU6B 3JUZA 4NGHH 5GS0C 4G7YH 5FGBC 2BRRL 4EUPA 1KCUH 4KQ3H 1QFUL 1BBJA 5FF6A 3U7YL 1D5XB 1C5DB 1OQXA 3RVUD 3T2PA 3AB0B 3O3UN 4ZO8A 3GBNL 3QWRD 2ZWLT 1NFDF 1CGXA 5ADOL 1BFVL 2OBGA 4Q6IB 1CDBA 1ZWIB 1D5XA 1C5DA 3O6KL 2DMKA 4PRIE 3KPOA 2PW1A 3EDEA 4ZQKB 2DS4A 5DVMA 3EZJB 3UYOD 3TYGL 4MGXA 3IS1X 4JGJA 4YJZL 1ZWIA 3IDYC 1F4HA 4H0GA 4Z7UA 4GG6F 1RHHA 2XY1A 3N1FC 1CI5A 5IHZA 4LLVB 3WJJA 5EIQA 5DS8A 2W91A 1IAIL 2W65B 3T0EB 4NM8H 3HI5L 5JNYB 3WFBH 4ODTH 3QXTA 3CK0H 5BOZG 1B9ZA 4WFHE 3QUML 3VXRE 5DJ0A 5TGBA 4XNMB 3THMH 1FN4B 1KLGB 1HH9B 4P2YA 4Z7QF 1I3VA 1ZANH 1Q38A 4MXVF 1U3HB 1EFQA 3O8XB 3BEVA 2I24N 4XNXH 3GJFA 3WO3B 4XNMA 5HHME 1VPOH 1FN4A 1HH9A 1GGTA 1WBXA 1MRDL 3VGAB 5D6CB 4HCRA 2X41A 1KJVA 2NQCA 2CIIA 1C5CH 4LCUB 3EOTL 3F12A 3FQWA 3C08L 1BFOB 3CFBA 1TQCB 5BVPH 5SWZB 4YX2H 3VH8G 1P4BL 1ODAA 4WHDA 1DBBL 4FQLH 2PNDA 5CZKA 4JKMA 1RMFL 1OP3H 1BFOA 2N4IA 4NN5C 1NSNL 1ZHBB 3R1GL 3ZDXF 4TSBL 4HIEB 1QZ1A 1GGUA 4I5BA 4LVOB 4XMPH 5EU5B 2VDNH 5KVEL 4HKBB 4PTTB 1BZ9B 1WTGT 4Y5XC 1EFXB 3AM8A 1ZHBA 1HILA 5T1DH 2APBA 4PBVC 3OB8A 4PTTA 1DEEB 2YPVL 1MEXH 5ANMB 1EFXA 1EAPA 3O41B 4DN4L 3RY4A 1OGTB 2C4XA 3MCG1 5GSRB 5MEQA 3ARVA 5FFLA 1DUYA 2G9HA 3UTSB 3IGAB 4MMXC 3OAYK 3ARGB 1NMAL 1PX4A 1A6ZB 3QIWD 1MJ8H 2CLVA 5ICXB 4Y4FC 3ZKMD 1SY6A 4NRZB 3HE6C 1HI6A 3DHMA 2QR0B 4M5ZH 1OP5H 3HPLA 4G8GE 1DBJH 3IDGB 5BXFA 5JW3H 4NRZA 3IETB 3GIZL 4N0FB 1HXYB 2DLFH 1UZ8A 4PJXB 4QTHA 1ZTXH 1TFHA 4UNUA 4JFXB 4YNYB 3UX9B 4YXLH 4X4YB 3IDGA 5J13C 2VE6A 1K2DA 3BQUC 1LO5B 3IETA 3OHXA 5EO9B 1U92A 1HXYA 4NKIL 4LHQB 3RDTD 1NC2D 3QUXC 1NKRA 4PJXA 5F93C 5I8CA 1YEHH 4U0RB 3VXOA 2AXJA 2VXVL 4JFXA 1HINL 4KK9C 4QRRA 5L88H 1BOGB 1FNEA 2DMCA 3BW9B 3HZVB 1JVKA 3LEVH 1E0OB 2VKXA 5JPMB 3LKPA 4YIQB 5ENWB 4HS8L 5JHDE 3BW9A 3HZVA 2WAHA 1MUJB 1YNTA 3P9LB 4PGBB 3S36H 2C1PA 2KUTA 4YIQA 5C7XL 2MOVA 5F7DB 5CEZD 4YWGL 3SGDH 5F6HJ 2X9YA 1KJ3L 3P9LA 2MQ0A 3WIFB 3FO0L 2CJUH 5CJQL 1UB5B 4A2LA 2XZZA 3MJ9H 1K3IA 1J0IA 5DUBB 5F7DA 4CN1A 2DQFB 2ED9A 1CFVL 1EEZA 3D3VD 4BUHA 1T1WA 3U7AA 4ERSL 1TJHH 5I8KL 4P3CL 2ARJQ 4RGOL 1F2QA 3ZDZE 4BFGA 4LPVA 3WIFA 1ED3B 4KRPD 1UB5A 4HUXA 3H2WA 4FNLL 5GS3A 4HHAB 1HIML 4J3XA 5DUBA 3ULUH 2DQFA 3FB7B 1KG0B 1JI2A 3QEUB 1ED3A 3QH3B 4OGAD 4OCRL 5T5NG 4X6EB 4NYLB 2VMFA 3B2UD 4OT1H 3QEUA 3MTRA 1B2WH 2JK5B 3NVQA 4NZUL 4J1UB 1X44A 3MNVA 4JKKA 1G7MB 5HPOA 4NYLA 3WFDH 3HNTL 4WV1B 1Q0YL 3D48R 3HI6H 3PL6D 4GFTB 2C3WA 1JCKA 2CGRH 2P24A 3WS6A 3OXSB 3LQAC 4XAKE 4N8CL 3P4OB 5D93B 5DGQA 4R2GC 4J1UA 1DBKH 3KYMB 4P23B 1IGFL 3GMNB 5TF1L 4PG2A 1KIPA 3OXSA 4F37K 1SYSB 1NANI 1EDQA 4H88L 3CUPA 4P23A 4U7SA 1AGBA 4Y2DA 4JRXD 5E6IC 2Z4QB 1RIUL 3EJZD 4L8SB 2BJMH 5HDBE 2Y36H 5FYJE 4X9IA 2DQTL 1H3GA 1IAOA 5JUEH 4R0LB 3RRQA 1J05B 1MH5B 2XNAA 4L8SA 3SDDB 2GFBA 4YXHH 4IOIB 1G6RB 1YJDC 2XRAL 2R69L 3MGTA 4KY1H 1WT5C 3VWJD 3LD8B 1LO2H 5BZWA 1MH5A 4LPXA 4CVUA 2PKDA 3RWGB 2HTKD 5EOQL 4X6FA 4IOIA 1DANT 3GKWL 1MRFL 3BKCH 4MAYA 2KH2B 2DI8A 3KPSD 3PWNB 5E03A 1JWUB 2IPKA 3A6CH 5CZXC 2AJZB 4WGWB 4LGSB 3L7FB 3MREB 1BECA 4BA8A 3PWNA 3TVMC 3HPJA 3VG0H 5HY9B 1I9RH 5GRZA 4LDEB 1A14L 3PJSB 1J1OL 3MGAA 1DP0A 1U8KA 2OTWB 3OKLB 3W39A 2OLDA 4QXTB 3L7FA 1ITBB 1FYTB 1TJIL 1EVTC 3K0WA 5JW4N 4EI6B 3HR5B 2FCBA 3FONB 2OTWA 3OKLA 4M61A 3BJ91 1UKTA 4L9DA 5CGMA 3SPVB 3LSOA 1JPST 1MCKA 3HR5A 2VDRL 4JREB 1KCSH 1WWBX 2AV1B 3MLRL 5C0EB 3KLHC 1CU4H 4B7LA 1KXVC 2AK4A 3QIBC 1Z3GL 5GGSB 1NCCH 3DI3B 3JV0A 2OR8A 5DMGD 2H32H 2VXUH 1NL0L 3ARFA 3V52H 1I3GH 1YEEL 1QSEE 1OOAA 5F7EL 1J88A 2AEQL 5DMYA 4KU1A 1DSFH 3I6KB 4Y5YB 1H8NA 1WGOA 2AEPH 3RJQB 4Z0XB 3IFNL 2XN9E 3MXWL 4URTB 4PRID 4Y0GA 2B7DT 2YUVA 2R56L 4NT6B 4HJ0C 1MREL 3GMLB 3GJFK 4P2QE 4Z95H 1JWMB 2ICWA 4MJ4A 2OL3H 4Z0XA 1MI5A 2FO4A 1KTDA 3RAJH 1XCTB 3BN3B 2B1AL 4YZFF 4CU8A 5DFVD 3TZVB 1JWMA 4W68A 1YMHB 3KHOA 4HZAA 1VEOA 1EO5A 1WBZB 4J3WA 4POUB 3O6FC 4WFHD 2VAAB 5EA0L 3WE6A 1YMHA 5F6IB 4ZPVA 5I74B 3VXRD 2FB4L 1QLEL 1WBZA 3BIAX 3VA6A 5F7FA 5IVXF 3G5XA 4WTZA 3ZT6A 1UWGH 4UDTA 5F1SA 5GGSY 3S37X 2VWEC 1RZKH 3EIFA 2HJKB 5HHMD 3PXJA 1A6AB 4PGDB 1T2QH 3STLB 3S9DB 4NHUB 3O81A 5HBBA 3OKDB 5TFSH 1AO7A 2HJKA 2R23B 1L9MA 5GRXG 4O2FB 3UPRA 1OAUL 4PGDA 3DXAD 5KSUA 4NHUA 2V2WB 1W0VB 3CD4A 4M8QA 2ED7A 5KS9E 1ZVHA 2A0LD 3MO1B 1RHFA 4V2CB 2ZCKL 1N7ML 4IRZL 4BSVB 1K8DB 3PWUA 2XWBA 3P4NB 3X17A 4W6XB 3MO1A 4JQXC 4P3WA 3RVTD 1JTTA 1K8DA 2WUCL 4PJ8C 4KRMB 1MHHB 4IRSA 4QRTB 5HD8D 1Q94B 4LSSH 4J3OC 1T83C 4FP8L 4HCRL 1R24B 4AMKL 1F90L 4U6TA 3IDUA 3FN0H 4O02H 1MHHA 2EC9T 1DLHB 2X10A 5DEZA 1Q94A 1Q9LB 3SDCB 2W9DL 2WWMD 3DGGB 1R24A 2YWYA 3U6RA 4HC1H 5D5ME 5DWUL 2X7LB 5IFHH 5HHVH 5DD6B 1DLHA 4OLUH 2DQDH 3MYJB 3DGGA 2DN7A 4G8GD 4RFNB 3H9SE 4MJ6A 4G3YH 4BM7A 2YBRB 4EQ2A 2X9XA 5CWSA 2DYPB 3TBTB 5KVFL 3HZMB 4HIHA 5DD6A 3GSXB 1DQML 4JN2B 4CKVX 2EH8L 5MI0B 5BZDA 3KJ4B 3W0WA 5DI8B 2V7HB 2YBRA 3MC0A 1HN1A 3TBTA 1VENA 4X0KB 3IT8D 5FA4B 5FXCH 5DF0A 2MMXA 4JN2A 3QHZL 3QO0A 3GB7B 4OTXL 2FEEI 2Y1VA 5DI8A 2APWA 1C12B 4F33B 5I8OH 4RNRB 2AAVA 1IAKA 5HHPA 4XI5D 3VRIA 3D0VB 4OZGB 5IV2B 3HMXH 2V5TA 3N85H 1GGIH 3NCFB 4NZTH 2XKUA 5CAYB 5DUPH 3HC4H 5BJTA 1G7PB 2NY6D 3FMGH 2HT3D 4F33A 5JHDD 1F6AB 1U42A 3ULUE 5KVDH 4FQHB 4GS7C 5DO2C 1R5IA 1XGYL 3J8F7 1KOAA 3WDHA 5DQ9B 4DW2L 4JFZH 3DO3A 2VDOL 1V3JA 2XA3A 1F6AA 4QRSB 2D7QA 1O7VA 4FQHA 1AHWB 1RURH 1T5XA 1WISA 1MIMH 4RFOL 5DRXB 2HVKB 1CLZH 4JPKL 4APQD 1OTUD 1PZ5B 3S3JA 4E41E 5B3NA 2EIDA 3VXTB 5FUCE 1VFAA 4Y4KD 5I30L 3VWKB 3VU2A 3PP4L 4OAWB 3W5MA 4MNQB 4C57C 1RK0B 4FQ1H 1UGNA 4PJ9C 3FOMA 1A9BB 2WSKA 5E8NA 4OAWA 4XBEH 5EC2B 5I17A 1RK0A 4AT6B 4L9LA 1D5BA 1AP2A 1M71A 3L3OB 3C6LC 3HZKB 2FECL 5LCVH 2JCCA 1BF8A 1FIGH 4D9RE 2NTFA 4XAKD 4PJEE 3S7GA 3I50H 3TA3C 4NDMA 1HYSC 1P9MA 3L3OA 5KAQF 4DFHA 4J4PD 3WKML 4HFUH 3CVHH 3QXDB 4RGND 3EYQC 4LLQB 5ESAB 2PO6D 3I6GB 3OKKA 2CQVA 2C9AA 3MRFB 1UENA 4D3CH 3MRHA 3NCEB 1BJ1J 1HHHB 1HHKA 3E3QE 3NA4A 3QXDA 2JB5H 3I6GA 5E1AB 1FCCA 2VQUA 5LGHL 3O4LB 4HKZB 3MRFA 4Q0XH 5FYJD 3RBGA 1D9KD 1HYRC 1HHHA 3Q6FB 2Y06L 5E1AA 1IC1A 3O4LA 5D7SH 5DVKA 1U95B 3P30H 3RWDB 3Q6FA 1DR9A 1WCQA 4U1SB 2PYEA 4B53A 4IJ3B 1XGUB 5FYLH 4YHOL 3IRPX 1N0XL 1QPPA 1IAII 1U95A 3WXVH 1MHEB 5IHLB 3EOYG 4P57B 4PRBB 3QWRA 4K7FA 4O9HL 1XGUA 1INQA 4TUOA 4NJ9H 2YA1A 4OI9A 4ORGA 1U8QA 4XGZB 4PRHE 4P5TC 1AC0A 1CDJA 4EN3C 5I75C 4ZSOB 1A0QH 4P57A 5DR5H 4PRBA 1ZLVK 2XQYG 3OZ9H 4FFWC 3H42L 3MRBB 5T3ZH 4XGZA 4X6DB 3LH2L 1NUGA 2OR9L 1J0YA 1NEZA 4ZSOA 2FIRT 1XGQB 1TTFA 4JN1L 1H3PL 4L8DA 1Q8MA 2DQCH 4X6DA 1NDMB 3WD5L 1V7MH 1XGQA 3FCTA 2XQBL 1G6RL 1DTUA 4LLAA 4PYGA 3HS0A 4K94C 5IOPB 4XCFH 1Q0XH 1NDMA 1RIVL 1A1NA 1AXIB 1A2YB 3MACL 3ULVF 1KPVA 5IB1B 3HFML 4HDIB 4BUGA 3LEYL 1QSED 4F7MB 3EO9L 4GUPB 1TENA 1QR1A 2Q7YA 5BS0E 3RNKA 1PG7W 1A2YA 4M1CD 3RKDD 1JPGB 1UZ6E 3DLQR 4HDIA 4S1QH 1BX2B 2XN9D 5ISZE 4F7MA 3WNLA 4HPOL 4P2QD 3SO3B 1RUAH 3SDXF 3WLWC 3MFGB 5J12B 1CGVA 5IR1A 4OUOA 3F5WA 4FQQA 5D7LE 4WCYL 5FKPB 2WIIB 4XPGL 2E7LA 4NWTL 3VJ6B 5EBMB 3GSWB 4KJYB 3QI9C 4GAYA 3N9GH 3NMEA 3AREC 3PF2A 1RUKL 4KVNH 2P46B 1TLKA 3QXAB 2H45A 2GAZA 2WIIA 3O2VL 1IM3A 4E42B 3SGKC 4KV5E 2X4SA 4AL8H 2DM4A 3QXAA 4TN9A 3FO9A 4QXGL 4JKWA 1DEDA 4M6OH 1PX3A 1KB9J 4X6CE 1VCAA 3JZ7A 3QIWB 3IKCB 1TZGH 1J0JA 2VDPH 2DJSA 1GL4B 3F6IA 3BFOA 4XVSL 3V6OA 3BX7C 2YPKB 3B2VL 3B5TA 5LQBL 3IFOA 3VXSB 3BPNB 35C8H 3QIWA 1YN6B 3X13B 4F37F 2CR3A 4MQTB 4GBXD 4HPYH 2OK0L 1JF6A 1IGTA 5JLZB 4M3JA 4DKFL 1OAQH 3SE9L 4U0QB 3VXSA 1MCOH 4ZUVA 8CGTA 1YN6A 1Q72L 2CUMA 2OMBA 2A9ML 1BWWA 3BDBA 4OZIF 3TEUA 4R4NC 2B4CC 5DHXB 3RDTB 1G9NH 1NC2B 4RCAA 4TNWF 5EO0A 5JMRA 1V3LA 3LMJH 4UV7L 2A6DB 4Z7OF 1EX0A 4ELMB 1B4JL 5H37G 1MIEH 1A7OH 4UV4L 4MNGE 2V7NB 4XP5H 2A6DA 1T04B 1P7QD 2R0WH 1T22A 5D6DA 5DD0H 2AGJH 3TIDB 1YY9D 3IVKB 4PR5B 1YC8A 4LSUH 5LAXB 3G6JA 3UJTH 3L3HB 2X09A 1BGXH 3RWIB 3MUHL 3TIDA 1U41A 4IRJB 4QHKI 1YEKH 3L3HA 3K3QA 2EE2A 4J6RH 4OLYH 4WWKC 1JBJA 4AEHL 3RWIA 3SE3C 3BKJH 3ZTNH 2VABA 1XGRB 3BGFC 4IRJA 3H9SD 4NUGH 5ETUA 4KRPB 1IT9L 3RI5K 4TOYH 4WTXA 3NGBC 4JO2L 3BO8A 3UTZB 4YBLC 5D1ZA 4M1DL 1OTSC 3ARBC 3TJHC 2HRPH 1S7QA 4X80L 2ZUQC 4U3CA 5J6GA 3NFNA 4YDJB 4KI5C 5ESQB 5FUZL 1CL7H 3L5WA 4HLJA 4AIZB 4Q7DA 5A16B 3L5XL 1BF2A 5C07E 4LAQL 1CLCA 5F9AC 4RGMB 4XPHH 1IMHC 4BH7B 5ESQA 2IQ9L 3PL6B 4AIZA 1U8NB 2Q86A 1KJ2H 3P77B 3ULUD 3GKZA 4P9ML 3CSGA 3BT2H 1CR9H 4XPTH 3NH7L 4YQXH 3QPQD 3ESUF 2D4DA 3DURB 2E5EA 3QWOA 5T3XL 1C5BL 2A83A 1INDH 4ZS6D 2E9BA 4J8RB 4JRXB 4Y7MA 3F7YB 5GRYA 4L4TE 1N64H 1XGTA 2VO5A 1X5IA 4C55A 3DURA 1A22B 4NNYA 4PJIF 5FM5O 3BYTA 3GJEB 4E41D 4J8RA 2VQ1A 3BRFA 3F7YA 4OF7A 2R0ZH 1NAKL 2P7TB 4LOUC 2DBJA 5HVHB 5JPNB 4P5KB 4XP1L 3QCVL 1T6VN 3HUJB 4EI5D 1DBMH 1EZVX 2DQHH 3MOAH 5JXEC 3WYRA 5KSAA 5D7JC 1FFOA 3WFCH 5JOPE 3VWJB 3HTLX 5JPNA 2P7TA 1DFBH 3PV7A 5EUOE 2DM2A 3MLSH 4HH9B 2XXCB 3KPSB 5IK3B 4XTRC 5F21B 1Y6KR 2MQ3A 3HMWH 4LCWE 4UBDD 2ZUTA 1S5HB 1L7IH 2BOCB 4JVWA 1P84K 4ZFFB 4D9RD 3BVNB 3OL2A 1WWAX 2X4NB 3DO7A 3QO1B 2ZCHH 1RPQA 4AQ1B 5FIEA 1B4RA 3BVNA 4IHOB 5CILL 1E4KA 4N1EA 1UEMA 5FKAB 4NN6C 1A3RL 5D7IB 1ZHKA 3QO1A 4HBQA 4JY5H 5FYLE 1QKZH 4OZFB 4HWBA 4ZUUB 3S35X 5CGYD 4KKAD 1RFDH 1ZA3B 1FZMA 4ALAL 3ET9F 2FGZA 2BNRA 4Z7WB 5TF0A 3S3PA 3SHSA 4M6NH 3CFDB 3D25A 2ZG1A 5IB3B 5KOVC 3D39E 5CZVH 3SKOB 2MSPA 3NA9L 5EIVA 5T3ZE 3TESA 2DI7A 4WI5A 4KH2A 3DGCR 3MV8E 4NFCA 5AEAA 2FHBA 3RX7A 4HULB 3MRQA 1S7UA 2A1WL 4Q97A 1R3IH 2GUOB 5GISL 4PRIB 4I2XA 3U9PH 2VLRA 4JFDA 1NLDL 1TQBC 3AFLA 2OSLB 4TSAL 2EDWA 5FO8B 1SM3L 4PRHD 3GNMH 5JW4R 1MLBB 2GUOA 5B8CC 4PJCF 4Z7QE 3RZCA 3QRFM 4GKNB 1RZGA 3QCTL 2WANA 4TRPH 1OWRM 1MLBA 3OTTA 3OKEB 1LO4H 5IMOB 2NTSP 3O2DL 2FX9L 1JUFB 2GJ6E 2YRZA 5FUOH 3T3MF 1RVFH 4MA7H 3VXRB 4KAQH 1W72B 1OAXH 3L95A 3OKEA 3UC0L 4K71C 4LLWB 3KPNB 4CL7A 2UZXB 4OD2B 1G7HB 3ILQC 1RQ5A 5E94A 1LHZA 2AABL 5C1MB 2CUHA 2NY0D 1W72A 5HHMB 2IBBA 1KTRL 4ZO9A 1C16A 1DE4A 4X99B 4G6JL 3GRWH 1U0QA 1I1AA 1YMMA 4M93B 4DUWA 5BS0D 1ULVA 4F15C 1GC1L 2NMSA 1F5WA 2W9EH 3RPKA 5FO9B 4P4KD 3SQOL 3PHOA 3PABA 3DXAB 4HIXL 4X99A 5ISZD 4JHZA 3CXDH 1LP9B 3ILPA 2JJSA 4IBLT 3FFDB 1GAFH 2JTDA 3DXAA 5E00B 1CQYA 2BRRH 5D7LD 1R3HA 5E24E 4PGJA 2X1XR 1LP9A 4HAFA 2IFFL 4Q9BA 1KPRA 3S96B 3RIAK 1TZIB 1VFBB 3LPFA 1C1EH 2CO6B 5BRZA 5C92A 1FDLL 5JZ7D 1BFVH 1FV1A 1YC7A 3ROLB 3HAEH 3REVB 5FGCB 4POZC 3S96A 1N5YL 1BP3B 1VFBA 3P9MB 5E08H 3QDMD 4L3CB 3E8UL 4XP9L 5GS1A 2PXYD 1VFUA 1QQDA 3LQAH 5C71A 3MNZB 1FIEA 4UT7H 1D6EA 4XPAL 5D72L 4IIQB 4I0PA 5JA9A 3HC3L 2DTML 2NY3C 4ISVA 1QUNA 4ONHA 3EAKA 3UDWA 4F8TA 3MNZA 1CBVH 5DUMH 3MROB 4G8GB 3HI5H 1UCBH 1FO0H 3OKNB 3QUMH 4YC2C 5IQ9A 1ZT7B 1ORQA 4IEFB 1JYVA 2FJFB 4U1NA 2UVEA 2V17L 4FQXA 1ZLSH 4HS6A 4YK4B 5GGVH 1ZT7A 5TQ2H 4NWUH 2RIKA 4JG1L 1ZEAH 4GKZB 2WINB 2FJFA 3L5JA 3MBEA 5T33H 2M1KA 1T1ZB 4GAJL 2R2EB 4LEXH 5CBEB 4JE4B 4ZG1A 3EOTH 4JHAL 4LKCA 4GKZA 2NY6B 3TN0C 5JHDB 1MCPL 2OXHA 1NGZA 2FBJH 1ZLUK 1DBBH 4PD4K 1T1ZA 4YE4L 4FTVA 4JDTL 5F7HA 3LEXB 1GGCL 1CD0A 1BM3H 2ZSVA 5ILTH 1KCKA 2IANE 4JO1H 4FABL 3VDCA 3K8KA 4GRMB 3VXME 2VDQH 2CRMA 3UP1A 4APQB 3V4VL 5E2JA 3G08A 1VERA 1IQWL 3ARDA 3MRLB 3H6JA 5I8EB 4GKOA 5EBWA 5BO1L 2YPVH 2EDXA 1TJGH 4FRWA 4PY7B 1S5IH 4Y4KB 3LKRB 5FHAH 5DJ8B 4APQA 3B3IB 3RX8A 4JZNB 4IOFD 1LO3H 2F5AH 2X89D 4Y16A 2Q8BH 3MFFB 4LRIA 4OZFG 5CSBA 3GMMB 4PY7A 4Y4KA 2YKLL 4MA1B 3B3IA 4ODVH 4RFEB 1S9WB 3K4AA 5B22A 5J1AA 4JZNA 3VD4A 3WXWH 2OZ4H 4XNUL 5C07D 5TH2B 2DTSA 3DVFA 3MNWA 5D2NC 1W0WB 4HS3B 4LPWA 5CP7A 3TNMB 4RMUA 5T1MA 5C09A 5TH2A 5CEZL 1FFQA 4TNVK 1YNKL 2Q6WB 1NMCB 2CR6A 1T89A 4LP5A 1OSPH 1HSBB 4RGNB 3QDHA 1JRHH 3RWCB 2PO6B 2J8UF 3VFUB 4NO0A 5BVJA 5T1KD 1JV5A 2Q6WA 2H26B 4JKLA 2F54A 4I18A 2C3VB 2V2XB 3ULSB 8FABB 4L4TD 4JPWL 3JWDC 2PO6A 5F9WC 3IJHA 1RU9H 1YYLL 3MA7B 3VFUA 3S6CA 1D9KB 2Z93B 1RZ8A 2H26A 4K3DL 2V2XA 4L5FH 1GZQB 1MPAL 4LSQL 3L6FA 5C7XH 3MLUL 4GKSB 1YQVL 1IJ9A 1D9KA 1K6QH 5D1QC 2J3SA 4YWGH 2Z93A 1NDGA 3FT3B 5MP6L 5JOPD 3DVGA 1GZQA 3UJJL 4GKSA 1F00I 1WBYB 1WTLA 4GSDH 4S2SA 5E2WH 1T0PB 4LU5L 1EGJL 4LCWD 1FNGB 1U8PA 4RMVA 3PWJB 4WDIB 1D7FA 3OAYH 4MMZC 3RY6A 2VDKH 4FNLH 3B9KA 3BSZL 4KKBD 4KK5C 1FNGA 4LHJB 4Y4HC 1UG9A 4G9FE 4ZAKD 1W8NA 3P73A 4WHTA 2IPUG 1HKLH 4WDIA 3TFKD 5HJ3A 1RJLB 5EOCJ 4I4WB 1HQ4B 4AG4L 3GMOB 2PN5A 3RWHB 3LQZA 4H8WC 5HGHB 5FYLD 3OAZK 1RJLA 3IAPA 4I4WA 3RL2B 5HGGS 3MRDB 3RVWD 3GMOA 3MODL 3RWHA 1NFIA 3FT2B 4XXDB 1Q0YH 3CGTA 5EPMA 5HGHA 5J57B 3DIFB 4EQ3A 5SWSE 3G04B 4G80B 3G5ZB 5DK3A 4QHLB 3KLSA 1I1YA 1A1OB 4N90E 3LZFH 4PJ5E 1IGFH 3FT2A 3D39D 4K7PL 3WJLC 4XWGL 3DIFA 1MCCA 5T3ZD 4G80A 1QSEB 4NO2B 1IGCL 3MV8D 4PJGA 3ULVH 3NPSC 4YZFE 4P5MB 1DQTA 2J5LB 3GSVB 5DSCB 2XN9B 3T0WA 5JQHC 1QSEA 4O5LL 3AAZA 4CVWA 4P2QB 4X98A 2ZNXA 4JO3H 2BVTA 5JHLH 4KHXL 2PTUA 3WNOA 4FXGB 4P5MA 2HJFA 1U58B 5MERA 1NBYA 4HWBL 2GY7B 4D8PB 1B90A 4I77L 4PJHF 3OX8A 5F1KC 4FXGA 3RPIA 3TH2T 5HYJA 2BNUB 4LLMA 3GKWH 2A74B 4NQCA 2GJ6D 3GK8H 5FHBH 3LDBC 5MEPB 1YNLL 1MRCH 1MWAA 4I1NB 4KTDL 2I60L 2EE3A 4K23L 2BNUA 2QBWA 3CFEB 4KKLD 3T1WA 1Z9OA 4IMKA 1UM6L 1EZVY 1I9IH 1R3JB 5MEPA 1ZGLM 1CS6A 1CLYH 3MJ8B 4MD0A 3UAJD 1HEZB 2LV4A 4MXQC 3CFEA 1JGUH 4P4RA 3VXUE 1IGJA 4R90H 1H5BC 5C0ND 4C58B 5AAWA 5GHWH 5FGRA 5FYJU 5A2JH 3MJ8A 3LY6A 5F1OB 2HJLB 2FWOA 2YS4A 2IH3B 4GBXB 3GSQA 4DN3L 1A6VL 3CX5K 5KANG 4XVUC 4Y19E 2BFVH 3MV11 4XXCC 2DIJA 5F8RC 4GXVL 5GRWA 2IH3A 4DFIA 1RD6A 4DGVH 4DJMA 3U46B 4LPYA 1P4LA 3NACH 3SKMB 3EDKA 5KSBF 1BZ7B 4HMDA 3IFLL 1ZVSB 2P1YA 1KCRH 3U46A 4RBPK 5F7EH 2AEQH 4F57L 1CG9B 4Q2ZB 4UDUB 1W72L 2NR6D 1NCBL 2NY7H 3FRPA 2EZ0D 1BZ7A 4H5SB 1P7QB 1RIHH 2EXWC 5HYSA 2B1HL 4NZRL 5E8EA 3V0WH 5I73C 5EZOL 3ZTJH 3CFCL 1CG9A 3GSNA 4LP4A 4M6ML 1AC6A 3OJ2C 3B83A 4LMQI 3EYUL 3D5OF 1H15B 4JO4L 2EH7L 2YOCA 4JPVL 1F4XL 2B1AH 4KJPC 5D5MB 3H3PH 5HI5D 3RNQA 2DLIA 4GMSL 2GI7A 2RCSL 3QRGH 4YHLL 1S3KL 4XH2A 4O2CA 1H15A 1CICC 1ZOXA 4UB0L 4EUPH 3ZT5A 3H9SB 2VL5B 5DJDA 2P47B 2QADC 5E1HB 5B4MD 4JHWL 2VR9A 3H0TB 4FG6C 4UTBH 2YWZA 5IWLA 1H3XA 2FB4H 5A3ID 3H9SA 2VL5A 5JW5A 3HN3A 5SX4I 2AJXH 2GITB 3TO2A 4AEIH 2VDML 1FNAA 2VISB 3WFEH 1T7XA 2G5BB 3JV4B 3QIUD 3CSYB 1UQSB 4F7PB 2GITA 4IM8A 1KV3A 2VISA 1BJ8A 5HI4C 2G5BA 4U4BA 4XB8A 2N1KA 3V4PL 5DRNB 5AG9A 9CGTA 4LEOB 3WV0A 5I19L 4EXKA 1AE6H 1V5JA 4Y8AA 1QHPA 1N7MH 2ESVA 3TT1L 3IKKA 2H3NA 3BPCA 4AM0B 3NFSH 5KW9H 1U8JB 3CJJA 4JDZB 1KBGL 3MRKB 3MA9L 4D0DA 2BC4B 4GT7A 1AQDB 2WUCH 3GJFH 3EKCA 3QP3A 1B0WA 4JFOB 2VSDA 4AM0A 1R5WB 1K5NB 3B8SA 2ERJB 1G9ML 1Q9OB 4QXUH 4GQPH 3TPUB 4JDZA 4M4RA 3MRKA 4E41B 2X42A 1NGPH 2F5BL 4LSDA 4AMKH 1A5FL 5EOCH 1IILE 1IKFL 2MCG1 3SO5A 1AQKL 4WW1B 4S1DC 1K5NA 1AJ7H 1HKFA 2AERT 4EI5B 2UWEF 1U8MB 3NZHL 3C5ZC 5L7XH 2I07A 3IDNA 2YD9A 1A7PH 5E8DL 3QUZA 3PV6B 3BZEA 1N8ZB 2MCPL 2E27L 1U8MA 4X7DC 1JHLL 4Z0BH 4KJQC 1T3FB 2VC2L 5L9DL 3CDGB 3NAAH 3G6DL 4OQTA 3WNMA 2YD2A 4NQEE 3KYKH 4EBQH 3U4AA 3PIQB 4PJEB 1D5IL 3FHQA 4QNPF 2HT4C 2OQJA 1OAKL 3P0YL 1WCBB 4PJFE 2DQIH 4PJEA 3I85A 2FZ3B 2YC1B 1F58L 2HFEB 3DSNA 3VFMA 3VFPA 3RGVA 4M4PA 4HXBH 5CHNA 1F4WL 4NKQB 2FZ3A 2BY3A 3NIDE 2R29H 3Q3GB 1SY6H 3QFJA 2ICWJ 2UV3A 3S88H 1E4XL 3TBYA 3UTPE 4L3EE 4LGRB 1P69B 4OZHF 4ZXBD 3SOBL 4TPRH 4UINL 1NJ9B 1TZHB 5TE4L 4M7JL 1RZFL 1CD1A 1WFNA 4ZFZA 2VDOH 3IDJB 5ITFB 3PUCA 2H9GB 1YA5A 1I7UB 4CMHB 1J0ZA 1J8HE 4FFVC 1OF2B 4RMSA 4G6ML 3LHPL 4F3FB 2BRQA 3IXTA 1FZOB 4AQOA 1I7UA 1XF5A 3KPRA 3ZDYE 5MHSE 4PRHB 4G6KL 5I30H 4LCCA 4G9FD 4OGXH 2FJGB 4YBQD 1KENH 1JPSL 2YA0A 4KROC 1FL3B 2H32B 3EO0B 1YEIL 4M02A 4PRHA 1A7NL 5I1GH 3N1MC 1YECH 3LRGA 2FJGA 3O3AB 1AGEA 3MCLL 3ULVE 2EE9A 1CFBA 1MJUH 3CC5A 3HE6D 5FYJL 3TIEB 4PY8I 4BQ9A 3C6SA 3EO0A 1QLRB 1T80A 2UUDK 1FZKB 3O3AA 4WO4A 4P2RA 3TIEA 2OL3B 2XG5A 3NZ8B 1OPGL 3O4OB 1CGYA 1QBML 5EU3B 2QQKH 4FZEL 4N90D 4PJ5D 2NY0B 2CKBH 4XVJH 4L4VD 3BQUD 5DXWA 4UU9A 5C0RL 2WWKO 5C6PB 3NZ8A 12E8H 1C7TA 1FQ9C 2UZIH 2GHWB 4F2MB 1EHAA 5EU3A 4P46A 5BS0B 4MAUL 4KK9D 4G8IA 3LRSB 4LHUD 4P4KB 2XZQL 2QQNH 5I1IL 3LKNB 5ISZB 3BAEL 3KPMA 4NGHL 4LCYB 1CGWA 4G7YL 2Z8SA 5BS0A 5EO1A 4WFFE 1P1ZB 1QFOA 1KCUL 4KQ3L 5C0CD 3ZHLA 4MZ2A 2Y06H 3MCKB 1EV2E 1OB1A 3S4SG 5D7LB 4LCYA 1FC1A 2EDNA 4DK3A 2CDEB 4QLRA 1DUZB 1Z0MA 4TUJB 3T65B 4OV6F 4U1HB 3ZYJA 3TCLB 1KULA 3AB0C 2DKSA 3C5JA 5D2LF 2L4OA 2M8XA 4Q6IC 4W6WB 2LE9A 2C4FU 1YYMH 3QDMB 4U1HA 3O11B 3CPLA 2PXYB 2CK0H 4Z7VA 4X6CB 4GW4A 5C3LD 1J0HA 1JL8A 3H42H 3ABZA 3QDMA 3VXUD 5B38A 4J3UA 5F96L 4NM8L 3V0AC 4ODTL 3CK0L 4X6CA 2HKFH 2FL5A 2X4RB 1FE8H 2W0PA 1MFBH 3THML 1H3PH 1JGEB 1QO3B 3QDJA 1BAFH 2X4OB 1ZANL 3T0EC 3ELAT 1IC5L 4Y19D 1AIFA 1KJMB 4KDWA 3WD5H 2X4RA 4KUZH 1F11B 1VPOL 2GYSA 3V6FA 1GZPA 4ONGH 4RRPG 1ZHNB 4K07A 2VXQH 1KJMA 1U3HC 4FXKB 2RGSA 1FFPB 3O8XC 1G1YA 3LEYH 1AR1D 1ETZB 1C5CL 1FBIH 5K93A 3T08A 2BSRA 3BD4A 3W81A 3NCMA 4YX2L 1M05B 1ZHNA 3ZL4H 4G6AD 4MNGB 3FZUC 4FQLL 3V6ZB 1ETZA 2I25N 2LVCA 2A77H 3TO4D 2NYYC 3NFPB 1M05A 4GRWB 4MNGA 3MUY1 5GJSH 3TYFB 4XMPL 2VDNL 3SGEH 2NNAA 1FGNH 1OY3B 4XPGH 3IAGC 1V3MA 5HHNB 1JWSA 4P9HC 3TYFA 2ICES 5T1DL 2ZJSH 3TLRA 3JV6B 5DTFA 3EBAA 4Z7UE 1MEXL 2NLJB 3IJSB 4N9OB 4ODXA 1QYGH 3OG6B 3KYOA 3C60A 5H2BB 2IG2H 1CTOA 1ZLVH 2BDNH 3LV3B 4JQVA 1MJ8L 3HMXA 5HDLA 1JN6B 3IJSA 3DX6B 3BEWA 4CDGC 5H2BA 1X5FA 3GSRB 3TVMD 3GMRB 1BPVA 4NC1E 2WBJC 4M5ZL 1IEAA 3WS3B 2BXZA 4MD5A 4BZ2L 3ARGC 5JW3L 3HCVB 3B2VH 5D9SA 5C07B 2DLFL 3I75B 1X5YA 3MRNB 5BMFH 3MRMA 4YEFA 1ZTXL 4YXLL 4U1LA 3L9RA 4PV8B 1P84J 3H8NA 4WW2B 4N9GB 4ZYKA 4XX1E 5JIHA 3VG9C 4PJIE 1YEHL 5HHOE 4PV8A 5L88L 3QIBD 4UI2A 2AJSL 2C1OB 4N9GA 5JQ6H 4OI7A 4WFEE 4UV7H 3LEVL 3WN5B 5T1KB 1B4JH 3ZMRA 3DETD 5H94B 5CBAB 3MOBL 2C1OA 2IAMD 4L4TB 3QAZC 3IDIB 1U8OB 1LILA 3S36L 2MWCA 4U6HA 3GHEH 1KFAH 2SEBA 1T0NB 5H94A 4JM2D 4L4TA 5K33A 1U8OA 4HJ0D 2ADIB 3VMNA 1UKSA 3FT4B 1T0NA 3CVHB 4MQSB 5F44A 3JV5A 5C6TH 4ZTPH 1TJHL 5EUOB 4FQ2L 3LN9A 4OFYA 5C6WH 4GRLD 3FT4A 5FECA 4LCWB 5T5NF 3ULUL 1AD0A 1BQHB 2WBWB 3MYZA 4X5XB 4NQED 1IT9H 3SBWC 4YDIL 3ARXA 2UYLA 4K3JH 1ND0B 4M1DH 4ZAKB 4OLEA 2Q76B 5IJKC 1BQHA 3UJIL 3QQ9C 4XBGB 4X80H 4OT1L 4ZDHB 1B2WL 1A1MA 3KYAA 5FUZH 1ZA6B 4ZAKA 1ZS8B 3WFDL 1I85C 3HB3C 3L5XH 1GJIA 4TTDD 1Y18B 3H9HA 2CGRL 4PJXE 1JZ4A 1ZA6A 3X14B 2GJZB 1ZS8A 5CSZA 2IEPA 4QRRE 2A2QT 3JSSA 4L3ED 3UTPD 4JAMB 1HNFA 4PJAF 4WV1C 2F53A 5F89B 4X7EC 1MCDA 4OQTL 1QG3A 3X14A 3D39B 2GJZA 1NFDA 2GTWB 2H2SD 4GO6B 2QEJA 5I1KL 1JK8A 1CGUA 4JAMA 4U33A 4MWFB 4Z8FH 2AVGA 3FL7A 3VFOB 1M7XA 1Q9KA 4MCYA 5FB8A 4LFHD 3MV8B 4S0SD 1VGKB 2BJML 1TXKA 2Y36L 4PJCE 5C0IA 2GTWA 1N2RA 1T0MA 4MWFA 1U91B 3UZQA 1N6VA 3CXHK 4RMRA 5JUEL 3VFOA 4GG6A 5MHSD 4HWZB 4KGJA 4XZUB 3BD3A 1D6VL 1NAKH 4KY1L 4U6YB 3T3ME 1U91A 1R0AH 1ES0B 4EDWH 1B0GB 4M48H 4R0LC 3BKCL 3OF6A 3ALPA 1HQRA 1P7KB 4X4XB 1GGYA 1MJJB 3ULVD 2GJ6B 3ARSA 4R4BB 3LQMA 1P7KA 4X4XA 1WICA 3VG0L 1F3JB 1MJJA 1FRGH 1I9RL 4GMTL 4X8JB 1MAKA 2GJ6A 2ZSWB 3OR7B 3V5DA 4R4BA 5E4EB 3D2UA 4Z7NF 1F4AA 4HKJB 4JFEA 3DTXA 5IHUH 1LGVA 1PY9A 3M07A 2ZSWA 3MBXH 4H25B 3SE4A 2Q3AA 4UNVA 4KZEH 1KCSL 3BZFA 1KIQB 1WJ3A 1CU4L 3MRPA 4H25A 2E7CA 3BH8A 2IBGA 4N0YH 1NCCL 2VXUL 1KIQA 3DRTB 4JREC 3V52L 1I3GL 1MCLA 4L8CB 4WI8A 3EFFB 5GGQH 1DSFL 4XNYH 4DKAA 1YEGH 2AEPL 2IBZX 4HG4K 2BNQE 1A8JH 2VLKD 3V79C 5I1JH 3KYNB 4Z95L 4Y5YC 1UWXK 3RAJL 2ZOLB 3WO4B 4PD4J 3SDAA 1H0DB 1SM3H 2Z31C 1MLCB 5TQ0H 3P4MB 1YQ2A 3LKQB 4X7TA 2ZOLA 5SWQB 4HH8A 3CVIL 4PJ9D 4XVTL 2GK0A 3I02A 3P4MA 1URLA 3TZVC 4NM4H 1NCNA 4PB0L 3RWEB 1RZJH 5C2BL 2W0FB 3C09B 2QV2A 1MCSA 2P8LB 3RTQA 1UWGL 3JWDH 4XPBH 3FHAA 5DD3L 3V0VB 3VI3F 1RZKL 5F6IC 1VEMA 5I74C 2NW3B 3LS4L 1DVFA 1OTTD 2FJHB 3TA3D 1T2QL 1HYSD 5JOEA 1R5VB 1ITCA 5TFSL 5EU4B 2BCKA 2NW3A 1G7QA 5MENA 2AK4E 2ORBH 2Y4SA 2DWDB 2R0KH 1A6TB 4ODUA 3SQOH 5EU4A 5CEXB 1HHIB 5F9JB 2H8PB 5HDQH 4E9LA 2DWDA 1HXMA 1PW3A 3AMKA 3W9DB 1CE6A 3KHQA 1A6TA 4UQ3B 4ZPTB 4QHKJ 4OFVA 5F9JA 5MEOA 3PGFH 4UOW1 2BSED 4W70A 2QTEA 5BW7A 4DVRH 4QHNB 2LU4A 3FQNB 3BP4B 5EORH 3KPPB 5K9OB 3O9WC 4UQ3A 1MI5E 4ELKA 4LSSL 5FGBA 4F9LC 4XWOC 4QHNA 3FN0L 4O02L 3IFPB 2FIKB 2DQEH 4ENEC 5K9OA 4D9QE 1A7QH 2FYYB 1KJ2B 5INDB 5KANI 2DF3A 4HC1L 2BOBB 4LBEB 3W9EB 3LVEA 5IFHL 1Z6JT 5HHVL 1IGMH 3IDYB 1JPFB 5LWYL 4KK8C 4EJ1C 4EN3D 2EDHA 2FYYA 3HC3H 2DQDL 3D6GA 5INDA 3SDCC 3GHBL 3GIVB 4FFWD 4IOSD 3EOBB 1NGYB 2CIKB 4G3YL 4LBEA 4OGYL 1JNJA 1LK2A 3W9EA 3H3KA 3T8XA 3OAUH 2FH6A 4AIXA 2CXGA 2J8UE 1PBYA 4R8WH 1F4YH 3GIVA 1K4DA 5INCB 2NZ9D 4M9PA