3RVUD

Structure of 4c1 fab in c2221 space group
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
221
structure length
221
Chain Sequence
VQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISYSGTTSYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCGRTGVYRYPERAPYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular determinants for antibody binding on group 1 house dust mite allergens.
pubmed doi rcsb
molecule keywords 4C1 Fab - light chain
molecule tags Immune system
source organism Mus musculus
total genus 45
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2011-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvuD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rvuD01
4IOIA 3O8XA 4TVPD 4PGZA 3QRGL 3QHFH 1ZK9A 2B1HH 1KPUA 5I1AB 3D85D 3ZDZE 4BA8A 1KV3A 4LCIL 5I8OL 1E6JL 4KKAC 5F71A 3PE9A 4YK4B 3HI1B 5EBWB 4HX1A 3GMMA 1GZPB 2OZ4H 4GMSH 3MA9L 2YEZA 4WEBH 1FYTA 1BZ9A 3QG7H 3GSNA 4PS4H 4Z95L 2H41A 4XGZB 1K3IA 3FFCE 1DTUA 3PWLA 3B9KC 3TCLA 3MLSH 3DRQB 1WLHA 3B2UC 3LEYL 4XP1H 4MCZA 1W2KT 5EO0A 3DUUA 3B2VH 4I77H 4WHTA 5DHVH 4I9WD 3DROB 4L3ED 4Z7WA 5CZKA 1JZ7A 4PJHA 1OW0A 3KNBA 1Z0NA 1T7WA 3T4YA 1U6AL 3MLPA 3BUYB 2NY5L 3I6LD 2H8PA 5CGTA 4WFFE 5I18L 1TJIL 4FFZH 4HH9B 1GPOH 4YWGH 2KKQA 1CK0L 4R96A 1K2DA 3DX8B 4F8TA 2XXCB 3BMWA 2P47B 5MEQB 2YUZA 5DVOA 1F2XK 3CJJA 2YK1H 4HXBL 3MLVH 4Z7VE 2GJZA 2XZQL 1NFDF 3C5ZB 1LP9F 5ID0B 1ULVA 5TQ0L 3HC4L 4ZTPH 1G6RB 3PDOA 1SY6H 2XWJB 4D0CA 2RAMA 3ARGC 5KVFL 1CGSH 1QO3A 1BQLL 3QIWB 1QBLL 2Z92B 5EZOL 5D2LA 4Y2OA 2UYLB 4DQOH 1S7TB 1LEIB 3OZ9L 1C7TA 4K8RC 4KRNA 4OLUL 1BVLB 3KPLA 3OV6A 4J7RA 4G43A 3FTGB 2VERN 1OAUH 1YEDA 5FYLL 3KWWB 3KYKL 1H9VA 4H25A 2ATKA 2IAMD 1KJVB 3A6BL 5JXEA 4JQVC 4MNQB 3HAEH 4WUUE 3VFOA 3L7EA 4IIQC 5AD0B 4KMQA 3UBXI 4R2GB 1GAFH 2XZCH 4PJAF 4ZXBC 2E27H 1P7HL 5JQ6L 2YR3A 1U8OA 2PXYA 2DLGA 5GS0L 3PG2A 2X70A 1BEYH 3FMGH 4ZUSA 3V5DB 2ZJSL 2AI0H 5DWUH 2GT9A 4HSQA 1BF8A 4UTBH 4JM4H 3GJFB 5DRNA 3Q0HA 2B4CL 4MJIE 2FATL 5FM5O 4ETQB 1ZEAL 3MRCB 1J1XL 2Z31B 2VXSH 1UWXH 1LMKA 4JANA 5A2LH 1T5XB 1IKNC 5EIIB 3GSOA 1FSKC 1N59A 1WFNA 2VZOA 3K7UA 2MPAH 3J7HA 2H1PL 1FO0A 5GHWL 4DJMA 3NCJL 1I1FB 4S1QH 5IK3A 3FHAA 1Z9MA 4OFIA 1WZ1L 3MRQB 3QQNA 2AJZB 1RZKL 4POZD 2M8XA 5IFJA 1QNZL 5IIEA 3SDAA 2XTJC 4XI5C 1IM9B 3BQUB 2AABL 1YN7A 5JPMA 3KYNB 4HWBA 1A7OH 2CUHA 4KROD 4YHLL 3O2DL 3WFCL 5F8RC 2IQAA 1D5ZB 1FBIH 2XN9D 4K9EC 1DUYB 3FB8B 3FN0H 3MZGB 3NTCL 2I24N 4K7PX 2V2WB 1P5UA 2BERA 4NNPH 1DQDH 3CFDB 4HUWB 4G7YL 3ULUF 5L6YL 3FO1A 5L8JB 2N4IA 4FQ2L 3GMLB 2Z93A 4OF3A 3T2NL 1K4CA 3ROLB 1OTUD 1OB1A 3IFPB 3TBYA 2RQ8A 9CGTA 4PB9L 4G6MH 1WWAX 3OHXB 1NCTA 2IJ0C 4LHJB 3D5OF 5DRXB 4OCRL 2WP3O 2X4OA 4GG6E 1URLA 4XVJH 2M2DA 3VWJB 3FFCA 1RVFL 4TTDC 2A2QT 1N6QL 3V0WH 1MJ7H 4L4TB 1U8HB 2DI8A 5E70A 2WINB 5HHXH 4XWOD 2AW2A 4GAGH 5KVDH 5EBMA 5L9DL 3I50L 1JI2A 4Y16D 1V3MA 4RIRB 4ALAH 2R4RH 1K8DB 3UROR 1YJDL 5ANMB 4J4PC 2FSEA 5DZOA 1RUQL 4W4OC 4OLXH 2WQRA 3NIDE 4YDIH 4H1LB 2HRPL 3Q1SH 5IBUG 4I3GA 3F7QA 3LD8C 4OTXH 2GJ6B 2FGWH 1VDGA 4JO4H 3TV3H 4Z7VA 1QFUH 1XEDA 2AGJH 3TBSA 4JE4B 2L7UA 1JNNH 1X6LA 4YBQC 1M6OA 1FZKB 1Q0YL 2XZAL 3HTLX 1AHWA 2NLJB 3QYCA 2CIKA 3X13A 2HT2D 5D2NE 4HUNB 4EN3C 2EYSA 5H37G 4PREA 1WWBX 3BUTA 1FNGA 3RY4A 3RTQC 1ZLUK 4WCYL 1YC7A 4UI2A 5DVKA 4YEFA 5FK9A 5FYJH 4LGPB 5FDYA 4K7PH 4TUKL 1VFBB 3CX2A 2BNRE 3P9LB 1PQZB 1KCLA 3W81A 4R3SB 5C0GA 3QEUB 2OZ4A 2GY5A 1GGCL 4R8WL 4KAQH 3VA6A 5J0BA 5KOVC 1G9NC 4I18B 1I85A 1NMCC 3VXNA 4KK6C 4WUUA 4PGEB 4OZFA 3MJ7B 1IGCL 1MAKA 2BCKA 2H26A 4UIMA 3THML 5K9OA 4GAYA 1SVCP 3WUZA 2CRMA 4FQ1L 3BXNA 2FX9L 3HZKB 2V7NB 4PRPB 4U1GB 3HFMH 5INDB 2W0LA 1KLGA 1BD2D 1WC7B 3ZE0E 4JHBA 1A7BA 3DYMA 1LDSA 3L5XL 1P4BH 4ZOCA 4GRWB 2XQBH 5IP4A 4MJIA 4EI5C 2YKLL 1QKZL 3MRDB 1JYNA 4OB5H 1UENA 4WFEE 5EU5B 2Y6SC 1X5JA 2L7JA 3FT2A 4JM2F 4QY8B 3O8XD 3D2UA 4JR9L 4JRXE 2ARWA 3TBWA 4NZRH 4RQQA 4GBXC 3FONA 5D5ME 2CDFB 2ZUQB 1RFDH 1SY6A 4TVPL 1F2QA 4U3XA 4APQB 3O2WH 1R3HA 1FLRL 3G5YB 4R4BB 3MUHL 3BP6B 4KKLC 1S3KL 4GW5B 1FYTD 1XH3A 4PJEF 4DN3L 3EO0B 2R23B 5D7LA 3GBNL 4NRXB 4XP5H 5KN5A 4PYHA 3ZYZA 3V0AC 5DJYA 5LQBL 5IKCB 4H1LG 3ZKND 4AG4L 1BQSA 2F53E 5HVHC 4UB0L 1T4KB 1UCBH 4K7PY 4YHKL 2PW2A 3HAEA 1Z9LA 3K2UH 4P3DB 2HWZH 4M48H 4MYWB 5JDSA 1E4XI 3FQWB 3KAAA 4CN1A 1FL6A 3MGAA 4WWID 3RDTA 4ZAKB 4PB0L 3K3QA 3WD5H 2DLFL 1U8KB 4XNYH 5KSVA 5E8PA 2FZ3A 1KYOJ 3BIBX 2IH3B 2XQYK 1C5BL 2R2HA 3QI9A 2OK0L 3CFEA 1HHGA 1EHLL 2ATPA 2HKFH 1AXTL 3RFZC 4UNUA 4N0UB 3WEXA 5ETUB 1NLDL 1CFSA 4HXAL 2ZWLT 5GSVA 3NCEB 3CC5B 3SOBL 3P30L 4IDJL 3WUWA 5E03A 1QBBA 3GEWB 1B0RB 4L4JA 4GG6A 3KDMA 2PETA 5E2UH 3TP4A 4OSUL 3QDGB 1J5OH 3OKDA 4ERSL 1YMMB 2UZIL 1C5DA 5B3JE 2PYFA 3NABH 3TFKC 4M03A 1W8NA 1HSBA 4OUUA 3VD5A 5GGUB 3IF1A 4MJ6B 2YPVH 3QXAB 4QXTB 5DD5L 5DK0A 1D7FA 1M71A 1FL3A 1S5IL 3O3AB 4X7EC 3KG5A 4X8JA 5I8KL 4BKLA 3PHQB 3DO7B 4AT6A 5J11B 5DJCA 2O5ZL 5CD3B 2J88H 1FIGL 4NN5C 2QQKH 4ZS6D 1T5WA 5T5NF 1NMBL 4JG0H 4JN2A 3KJ4B 5JXED 1J86A 4UDUA 4L5FL 1IAIH 5FYKE 1GGTA 4G9FE 4JDTL 1UM5H 2VNCA 1V7MH 1VFUA 1H3TA 5HHMB 1KELH 1UA6H 5LXGH 1CIUA 1JPSL 3DX7A 1MWAB 3U46A 4XNUL 4GRLC 3VXRB 1IC4H 3L3KA 1T1YA 1YEEL 3PL6A 4N0YH 1A6AB 2PXYD 4N9GA 4BSVA 3MLZH 4TSAL 2BVPB 2BJML 5C0BE 1TCMA 1DBJL 1JPGB 4JZJB 2YBRB 5CBAB 2D3VA 4JY5H 1YUHB 3HLAB 5JUEH 1OL0A 4LPWA 2BC4B 1YNLH 4ORGB 3MXWL 4JQXC 4M7JH 4LDOB 3RVTD 1JPFA 2F5AH 4MXVF 3SJVE 5CJQH 2AK4D 4GMTH 3K8LA 3NACL 4D0BB 2FJHB 1CDCA 3WO3B 1WJ3A 4JN1L 1S7UA 2E3VA 4ZD3L 4XPFL 2NY0B 1UYWL 4YHIB 2J7LA 3BWUC 4PRHB 2DDQL 5C07A 1ZANL 3IJYB 1FIEA 4U1NA 3WS6A 2RCSL 1OP3H 5D8JH 3ZE2E 3GSXB 3FQTB 3RZCA 3SE8L 1A14L 2VN7A 3VW3H 4P4KD 3SDAD 1G7HA 1I8MB 1A6VH 1UZ8A 4NQXB 1WVZA 4Y4KB 4HGWA 5LGJB 2BSTA 3D25A 1NGZA 2MJWA 4NM4H 3ESUF 4MMXC 4KHXL 2VITB 1NLBL 4NZTH 3VD9A 2K1MA 3VDCA 3T1FA 4PLNC 4NC2B 4K71C 4H20L 2EEBA 4RGMC 1P69B 3TT3L 2V9RA 4RFOL 4X80H 1HDMB 3TA3A 5C6TL 2OR9H 1T7ZA 3KLHC 2ZNWA 2ADJA 1F6AB 4JRXA 2RJMA 5K9QG 2HJLA 2QSCH 4NKIL 2YS4A 1AGFB 5J57B 5D5MA 2FIRT 4K94H 4IHOB 4NKDB 1S7WA 3GHEL 4OM0H 1CZ8H 2HJKA 1U8MB 3T77A 4O51B 3FOMB 3IJSA 1MFEH 4NZJA 2BVUA 3O2VL 1G0DA 4TQEL 3UTZB 1MFCL 4P46A 4W6XB 5CIPH 3FFCD 1NCCH 4NQDB 5I1KH 4J23A 1A2YA 1K8IB 4JFZH 5T1MB 1IILE 1BP3B 3FOLA 3S5LB 1HH6A 1UWEH 3IDIB 5MHSE 1AGCB 1U92A 1F42A 4M6NL 5E9DE 1J1PL 3ALPA 4ODXA 2YD7A 1FGVL 4YHOH 4CVXB 5BO1H 4C4KO 4WFFD 4S10A 3DSFH 5CLWA 3ARVA 1DVFC 2X1OA 3HS0B 5FA4B 2DF3A 1EBAA 1XF5B 3X3FL 2LVEA 5ITBH 3CD4A 5IW3A 4LMQI 3R8QA 5MP6L 3BGAA 3DI2B 4RRPA 1KG0A 3QA3A 1FNLA 4ELMF 1AGEA 4N0RA 4ONHB 1R3JA 1IGYB 4UV7H 1FGNH 4UV4L 5BMFH 12E8H 1UEMA 3BIKB 5K9JL 3RVVD 3HC0B 2I5YH 1GL4B 2E6JA 2JF1A 3C6SA 4FP8L 1SM3H 1QRKA 1KF9B 4PJ8D 1JYVA 3P0VL 4JFYA 2X05A 3MV01 3DTXA 1RJZA 3TIEA 3MACH 3F7PC 2VJXA 1YEFH 4KPHH 1KJ3L 3ZSTA 1F4WH 3CLFL 2GITA 4ENEC 5LWYH 4AMKH 3QO1A 4GFTB 4P9HC 2NY3B 2YD4A 4S1DD 2EC9U 4FXGA 4WUUD 3AREA 4FG6D 2HLAA 4M00A 3WIHL 2JIXB 1QRNE 1CLYL 4PJ5E 5IVZB 1DDHB 2Q20A 3LHPL 4S11A 5HDLA 1CFTA 3BPLB 1MCCA 4M5YL 4PJFE 1X5GA 2X40A 1AR2A 3WFEL 5CJXC 3V7AG 1CDGA 1A7QH 4P2RE 3FQRA 4R6UA 2B1AH 1G7IA 3I2CH 1G6RH 4HZAA 5C0BA 4PUBH 3VRLE 3ZKXC 5ENWB 4Z7NE 3MBEB 1A9BA 4RWHA 3BP4B 4UNTA 4OZIF 5DO2D 3OJMB 4AEHL 1BFVH 3MJ6A 4OIIL 3RNKA 1M1SA 1RJYA 2WNGA 4MJID 2J4WH 4N0FB 3ARBA 3SJVA 1BJ1H 2W0PA 1BREA 1J11A 1U58B 5I1JH 3HI6H 4YR6B 1HZHL 1U3HC 4AZ8A 2D7TH 5ADOH 4FFYH 1HHHB 1S5HB 5FCSH 3D2UD 3UXFA 3RGVA 2E6PA 4NQCB 5T1LB 1F4XL 1C16A 1DR9A 3DHJA 4MLIA 3U30B 3RY6A 2CXKA 3S5LG 2A1WH 5F7KC 1JF1B 1ONQA 3LB6D 3F62A 3REVB 3RKDD 4M8QB 4GQ9H 3FQXA 3MLUH 3EJZC 5JW4M 1EJOL 4HIIB 3PIQB 5DJZA 4JFXB 3DYOA 3DVGB 5EIVA 5J13B 1ZLWK 1L0YA 1I1RA 3QNZB 1XGYH 4JJ5A 1C8PA 1A7PH 3C6LC 4ZS7H 4MJ5B 3MRBA 4I3SH 2QQLH 4IRSC 3VFWB 3BJ91 1MJJA 1I75A 1QYGL 1U0QA 5F9JA 4HAFA 4QWWD 2F8XC 3CZFB 3VCLA 3RDTD 1FQ9C 4NN6B 5F93C 2AJYH 3UJJL 3L3DA 5IG7B 5HI3C 4DAGH 3B5TA 4QRSB 3QI9D 4N9OB 5C0CB 3MRFB 3HZVB 1PZ5B 1OP9A 4P59H 5F21B 5H37H 4YDLB 2NY2C 3E3QE 4JB9H 4GKNA 4Q6IB 2Y9RT 3GMQA 5HHPA 3HB3D 4ZNCD 2DBJA 1IEBB 4W6YB 5HYSG 5LGKA 3GO1H 1UB5A 4BZ1L 2ARJB 3V6BR 4Y8DC 2I9TA 4JG1H 5EC2A 1T2JA 5FGCB 3ES6A 3T3PF 1VERA 2GSGA 3QPXH 4FN0A 3U0PB 4F7PA 1H0DB 2YRZA 4LIQH 1QTYT 2R0LL 1ED3B 4PJXB 4YHZL 1S7VA 1T22B 4GRMA 3U4EA 1VGEH 3QCUL 1T83A 1UB6B 1DSFH 2EDWA 3U1SH 1M7DB 1RZJC 1XCTA 1N0LA 1B88A 3QUYC 3G5VA 5E9DA 4JKKA 1FL5B 1KEML 2VQ1A 5JR1L 3MRMA 3IDGB 2X9WA 2YA0A 3BH8B 3MLWH 3W9EB 2C1PB 3S36L 3OB8A 3SY0B 2JJVA 1CD8A 2XTJE 4ZFOB 3LKOB 3ULSB 5EO9B 2LAAA 1KLUA 5HDOA 2ZNXA 4N0CD 5ESAA 2NCMA 1CLZH 1I7ZA 4EVNA 1N4XH 5C71A 1A3RH 3PL6D 5CGMA 1RZGB 2NPLX 4J8RB 4K3EL 3I75A 2NW3B 3BKJH 1E4KA 5IVOA 4NGHL 2C4XA 1G7MB 1RUPL 4DWHA 5I73C 3F7VB 4V1DB 4Z7OE 1MCBA 5GIRB 3U7YL 1TJGH 2EKJA 2AEQH 4P5TA 3UPRA 4WV1C 3JVGC 5I19H 3KPNB 4QOKB 5JHLH 2D9CA 4GKZA 3OJ2C 3GSRA 4FS0A 4UDTA 3QUZC 3EYQD 5IFAL 1F4YL 4LEXH 5EBLB 2VDNL 3QNXB 3IFOA 5F7DA 3GSWB 4NHUB 4H1LH 1FO0L 4R4FL 2C9AA 3SDDB 3EDEA 2GTWB 3OXRB 4HHAA 3TYGH 3VXOA 3RZCD 1QRNA 5KVGH 4PJ5A 2CRIA 1C7SA 4LIQE 4X0KA 1JIBA 4P2QE 2MCG1 4OT1L 5DJ8A 4PJFA 3P77B 2XXMB 4QCIA 5IMLA 3HRZA 4P2RA 5DEGB 1DLFH 1JUFB 3V52H 1ZKAA 5DURB 4GXVL 5HGHA 1BIIA 4LLDA 1N3NB 3UX9B 4HWBL 4WI7A 3JZ7A 4Z7UF 2VLKB 1R0AL 5CJOL 2YA2A 1AFVH 4TSCH 5I1AA 1JGVH 4KGLA 2WK2A 4CN6A 3PABB 1QSFB 3B6SB 3BGFC 4RX4A 5TF0A 1G9ML 1VEOA 4MMZC 4WFED 4LRIC 3TA3D 3HI1A 4MS8D 4OLWL 1L0XA 4JRXD 3FT3B 4Y4FB 2X5PA 5AYUH 3O6FC 3D0LB 2VR9A 3PGDB 4NC1C 4M1GL 5I75B 2XY1A 4XGZA 1JE6A 1CXEA 4DGYL 3KVQA 2WUBH 1P9MC 4X7DC 5ICYB 1NBVH 1LDPH 1QVOB 1LO0H 3R8BB 4TSBH 4J6RL 5DXWA 4P46D 5E2WL 1DBBL 4X5XB 2ERJC 4P9MH 3BUYA 3S34L 2PO6C 5EOQH 3DUHA 2VKWA 3O4LB 3CNKA 4HH9A 4IMLB 1NJ9B 2F53D 1KJMB 2FBJL 4B7LA 3DX8A 3RWCB 5JOPE 5MEQA 5I8EB 3MCKA 4QTIH 5F6HJ 4WJ5B 3WJJA 2GJ6E 4F15C 2JELL 4KY1L 1TMCB 1V5JA 2KL6A 2WBJB 2DQCL 4ISVB 4RBPK 5IJKA 4BUHA 3C5ZA 1MCPH 2AK1L 2VDLH 4IIQA 5SV3A 4D0DA 5ID0A 3LQAC 3LPWA 1AQKL 4YBHA 1G6RA 2DQDL 1VENA 3W2DH 5DMYA 2XWJA 3WCYA 1AIFB 3BPNB 3N1GC 5GZOC 1I7TB 2DMBA 1AR1C 5C7XL 4PR5A 3S88L 2X09A 4XMKH 1V3LA 3QIWA 4FRWA 1IQWL 5C09B 3EOYG 4PV9B 5E00B 4ZO7A 2GKIA 4FNLH 4FZEH 3LEVH 5ESQB 2UYLA 1S7TA 1LEIA 1MRFH 3FQUB 1YEJL 1BVLA 5D7KE 3FTGA 4YHYB 4W70A 3KWWA 3STZB 3ZT6A 3VFUA 4RZCB 5F7HA 2G75B 4QF1B 1KJVA 1JNJA 3QHFL 2B1HL 4F37K 2QV2A 4L4VB 5AD0A 1IAII 5D1ZC 4DZBB 4HBCH 2EDEA 4QGYA 3QCTH 2LE9A 5DMJB 4V2BA 2NY1D 4OIAA 2EZ0D 5HI4D 4TNWK 2VB5A 3P2TA 4PRPE 4UILH 4HGMA 1MUJB 43CAA 2OZ4L 2VLLB 1OWWA 4GMSL 4XBEH 4Q9BA 5FYKD 3ARED 4MA1B 4WEBL 3V5DA 3U83A 3QG7L 3IFNH 4PS4L 4XC3H 1WWCA 5BXFB 5T3ZE 4GRWE 3GJFA 5TE4H 1HYSD 4Y5XC 4ETQA 4F57H 4LHUG 3MLSL 2Z31A 4XP1L 4NC0B 1T5XA 5C0BD 4XNMB 3B2VL 4I77L 1MRDH 1AGDB 5GGQH 2VDOH 5EIIA 3MNVB 4QNPE 3MOAH 1RIHL 5I0ZA 3PUCA 1CU4H 4N5UA 4HKBB 3R1GH 1A7RH 1I1FA 2UUDK 2HH0H 3QBTB 3ARBD 3SJVD 1J18A 1EBPA 4FFZL 1S9VA 4YWGL 3MRQA 2VXVH 2AJZA 2C7UB 3QXVA 1ACYH 2WBKA 1IM9A 2YK1L 3BQUA 3RGVD 4Z7WF 4OZHB 5HD8C 5DK2B 3KYNA 4PJHF 1CGTA 5JDJA 3MLVL 1WWWX 4K23H 3HUJE 2OQJB 1D5ZA 2ZUWA 4CDHA 1AD0B 5D1QC 1DUYA 4ZTPL 2MQCA 4QHMB 1SY6L 2JB5H 3ZKQD 2V2WA 1MVFA 1IT9L 4P2QA 3QIUB 1CGSL 5LBSH 1LO4H 3CFDA 4HUWA 1HH9B 3IS1X 3GMLA 2J2ZA 3QUXB 3ROLA 3IFPA 3VMNA 4U7KA 4G7VH 2X9YA 2JB6B 3OHXA 1T7YA 2XFXB 4NQEE 2VO5A 3SDCB 5C9JB 4WFGE 4N0UE 5JXAH 1ZSDB 4PD4K 1UH3A 4XPHL 5DRXA 3T09A 3T0EC 4X6CB 4O58H 2APTA 1GAFL 4WGWB 4JFOB 3OKMB 2J8UB 4HS6B 3WFBH 2E27L 3QDGE 3VWJA 5LGHH 1YMME 2R0WH 4ZPVB 2X1PA 1BEYL 2WM0A 3FMGL 1IL1A 4L4TA 2C1OB 2AI0L 1U8HA 2WINA 4IRZL 3IDMB 4UTBL 4EQ3A 4JM4L 4EN3A 4ZO6A 5ERWA 4HUXB 1DLHB 5F8QC 2VAAB 4RIRA 5ELIA 2VXSL 1NFIB 1JZ2A 1PDKA 1K8DA 5ANMA 1T89C 4LF3B 1MVUB 1Q9LB 4YBLC 5FDWB 3BD3A 5MHSD 3ET9F 4H1LA 2EYTB 2Z4QB 5TDNB 2ICEB 2R2EB 4KKBC 1IC1A 5E9DD 4S1QL 2GJ6A 3JWOH 4Q7DA 4YGAB 3VXRE 2J5LB 1WICA 3RL2B 5KVMC 5MERB 1KULA 4ODSH 1SVZA 1FV1B 2DQFB 4NQTA 5AZEH 1FZKA 1A7OL 5I17A 2NLJA 1UJTA 3QPQD 1JGLH 3EHBD 5E7BA 4CRPA 3AB0C 1FBIL 1AXIB 2D31A 2XWTA 3LKQB 2WWMC 2LU4A 3FN0L 1UZ6E 1PSKL 5IEHA 4YO0A 1X3DA 4NNPL 1VFBA 3QO0B 3MC0A 3VXMB 3P9LA 1K4DB 1PQZA 4R3SA 3QDMB 3QEUA 3NIFE 1SMOA 3F7YB 4P5TD 4PRHE 1DQLH 3V9FA 4CMMB 8FABB 4I18A 1YNTB 5GRVK 5IVXF 2HN7B 3ILPB 4PGEA 4HPYH 1PG7W 3LDBC 3MJ7A 5DJAB 4YLQT 5E4EB 1EFQA 5GQBA 3HZKA 1FDLH 3JV4A 4KKAD 2V7NA 4PRPA 4YHNB 1C5CH 3ZZ1A 5INDA 3P4OB 4J1UB 1WC7A 1INEH 3WO4B 4C58B 3BOVA 4LQFH 3SDXE 2EICA 1QRND 3WFDL 4PJ5D 4HWZA 1N7ML 3WLWC 2VL4A 4XVJL 3C2AH 3ZDZF 2IFFH 2AJSH 4P2RD 1D3CA 2D0FA 3V0WL 1MJ7L 3MRDA 5EU5A 2V2TB 3VXPB 5T3XH 1MFBL 3C9NB 2A6IB 5HHXL 4GAGL 5KVDL 1KCVH 1RU9L 5F6IB 1FNFA 1QUNA 4UBDC 2XQYG 4ALAL 2P5EE 3OB0K 2CDFA 2R4RL 3EZ8A 4Q58C 5FEBA 3BDYH 4I5BB 4RX4D 4APQA 5IHBA 4OLXL 2GW5A 4RMWA 4YE4H 4YDIL 4YNYB 3KS0J 2LTQC 5E6IB 3G5YA 5IFHH 4R4BA 3Q1SL 2YC1B 3NH7H 5DC0A 5E5MB 5GS0C 4OTXL 3BP6A 2FGWL 3O6MH 1OCWH 4GW5A 1X5AA 4P2OB 3TV3L 1QFUL 3EO0A 2AGJL 1Q1JH 5HBBA 2R23A 3AM8C 4NRXA 1TZGL 15C8H 3QSKB 4ZDHB 5IKCA 1JNNL 1WBZB 4XMLH 1ADQH 3BZ4B 1W72H 3MFFB 4X9IA 3SPVA 4YQXH 1MCNA 3I02B 1T4KA 2W0KA 4P3DA 3FQWA 5FF6B 4Z6AT 4Z7VF 3PWJB 4PGBB 2XRAH 4ZAKA 5FYJL 4MAYC 4K7PL 3PWPE 1U8KA 4ZSOB 4PPTA 2IH3A 4Z5RB 1NGQH 4X8XA 3WS3B 3KHQA 4KTEH 4KAQL 3SBWC 4LVNC 2XG4A 4N0UA 3WKNA 5ETUA 1JN6B 32C2B 3EO9H 3RTQB 3CC5A 1RZFH 3C5ZD 5HYJB 3VDBA 4BYHA 1OM3H 1B0RA 3CVIH 4L1HA 4D3CH 5FUCC 3QDGA 4MNGE 1YMMA 5DTFA 3CX5J 3QIWD 3B3IB 5GGUA 4ELKB 4HKZB 4MJ6A 3QXAA 2EYRB 4QXTA 3IFLH 3BN3B 5D71H 2XQBL 3UZEA 3O3AA 1I3VA 3K1DA 2XA3A 3PHQA 1KC5H 3DO7A 4PJCF 5L2KB 5CD3A 4OB5L 5EORH 1QFOA 3U48A 3LZFH 4AL8H 5GGRY 4NZRL 4PJGE 1SMAA 2D4DA 4HCRH 4R2GD 4YUEH 1MWAA 3O2WL 3VXRA 4ODHH 1A6AA 3FN9A 1CR9H 2BVPA 2W9EH 5KBNC 3BPOB 2XTJD 2W0FB 3CK0H 5DJ2B 1JPGA 5HYEA 4RGNC 4IMKA 4U0RC 2YBRA 3QT2A 5CBAA 1YUHA 3HLAA 1X5XA 2BC4A 1FP5A 4R97C 4W4NA 1QLEH 4F58H 4XP5L 3T0DA 1WCQA 5I71C 1SJVA 5EDXA 3HE6C 2Z31D 5DEFB 4FQXC 4D0BA 4CJ1A 2FJHA 3MRKB 1UCBL 3LS4H 3MODH 3CIQA 4HG4J 3ARRA 3K2UL 2HWZL 2ORBH 4PGCB 2EDXA 4NQCE 3NFSH 3VH8B 5F7NC 1OAQH 5CJBA 4YHIA 4L3AA 5EB9A 3CUPB 4PRHA 1NAKH 3WD5L 4XNYL 2IPUK 3GSXA 3FQTA 2H6PB 5H35B 1I8MA 2HKFL 1X4XA 3BQUD 2IQ9H 3ARZA 4NQXA 4OCYL 4CU8A 5LGJA 2VDMH 3UTTE 5EZJB 2YOCA 3V6FB 1RURL 2VITA 2CRZA 1WQVT 4LSUH 5D6DA 3ZO0A 4U1LB 3SDXA 1EAPB 3KPPB 1G0XA 5E2UL 4P2QD 3IDYB 2NXYC 3RJDA 1J5OL 3NABL 3TNNB 4G3YH 5SWSB 2ENSA 3L9RB 3LY6A 2CSPA 2YPVL 3ULVH 3T0WA 1HDMA 3TN0C 1T80A 1T2QL 2HTKC 4NFCA 4DK6A 2FX8H 2QADB 2RGSA 3RBGA 1F6AA 2R2CA 4GG6F 4XHJC 3BD4A 5C0CE 3MMEB 4G8GE 1IBGH 1AGFA 2J88L 3N85L 3L1OL 2B2XH 4IHOA 4NKDA 5JMOC 3ARXA 1U8MA 4KRPC 4YIQB 2AXGB 3FO9B 1JHTB 3MO1B 3FOMA 4KC3B 1YZZA 5DQJB 1MY5A 1LK3H 1UM5L 1V7ML 4LNVA 1KELL 1UA6L 5LXGL 1RY7B 3Q2CA 1RZ7H 1RUAL 5J3HC 4N0YL 1MHCB 5FGCE 3VWJD 5CGYC 4EOWH 3MLZL 4Y4HC 2QBWA 3MRJB 4NQDA 4F8QA 4MQXD 1JGDB 3WE6B 2EDDA 1K8IA 3NIDF 1MCFA 2EH7H 1FVDB 4QXUH 5T1MA 3S5LA 1EERB 5JZ7C 3IDIA 5JUEL 4PLKC 2ZCLH 1AGCA 4EN3D 4WO4C 1MCEA 4M7JL 4U1KB 2F5AL 4CVXA 3MV9B 3X14A 1QP1A 4GMTL 1F3JB 4U7SA 5E5UB 1TCRB 1IC7H 3MV7E 4XZUB 1FNSH 4OCSH 2VDQL 3HS0A 5JOPD 1I3RB 4FFWD 5FA4A 2VZ3A 5KOMC 2G5BB 1XF5A 5GS1B 1VPOH 4RA3A 4LLAA 2GJ6D 2Z9TA 3WNLA 3P4NB 3G6DL 4KK6D 5D8JL 3FRPG 3RI5K 4ONHA 3VW3L 4Z0XB 2Q86B 3HR6A 1A6VL 1IGYA 5F9AC 3ULVE 1H8SA 3BIKA 1F6FB 4DGIH 1V7NH 3HC0A 3DLQR 4WVRA 3QEHB 4NM4L 4V1DE 3H9YA 1CFQB 4UT7H 2IALB 2GEEA 3CAFA 1QBMH 4NZTL 4G8FB 4DKAA 5I8CB 4P99A 5CILH 4I0PB 1NEZB 3ARFB 2X44D 5CSZB 1GOFA 4OLVH 5IHLB 4QOKE 3VGBA 4LQ1A 1U3YA 4E41B 4EI5D 5D7KD 1XFPA 3X11B 3QEGH 4X80L 3H8NA 5GSRB 2IBZX 2OR9L 5IEKB 1WTLA 3ZE0F 2DMCA 4BFEA 4JY6B 4B41A 3VI3E 4G80B 2QSCL 2JIXA 2ED8A 5IVZA 4NC1E 1DDHA 5IROA 1ADQA 4K94L 2YUXA 3BPCB 2IPKB 1A3LH 1CZ8L 3M17B 3GFUA 4MSWA 4CMHB 4PRPD 3E8UH 2Q8BH 1EFXB 2NZ9D 1MFEL 5ENWA 3MBEA 3U36B 2V5TA 4PJ7F 2VLKE 5GS3A 4FXLA 3BP4A 3OJDB 1Z0MA 5T3ZD 4P23B 3DWTA 4GQPH 5D5MF 4F3FB 3P40A 5K9QI 4P48A 5HYIA 1JGEB 4N0FA 5I1KL 2FL5B 1QSFE 4JFZL 1U58A 1UWEL 4NN7C 3L6FB 3O3BB 4OQ1A 1GSMA 3NPSB 5F1KC 1HHHA 3TEUA 1S5HA 4NQCA 3HZYB 5BO1L 1QR4A 2BY1A 3VG0H 1JTPA 3VG9B 2R4SH 4HWEH 1JF1A 2EE9A 4XCFH 3REVA 4M8QA 1KBGH 1ZLUH 1MCOH 2X4PB 5ITBL 1A4KA 1FFQA 3OSKA 4HIIA 3PIQA 4JFXA 3TBVB 3BDBA 4QRRE 3DVGA 2NTFB 3GSQB 4HWUA 3QNZA 4KJWD 4RMTA 4UV7L 1FGNL 1TQBB 4MJ5A 1VFMA 1G7JB 1ZGLP 3O4LE 12E8L 1FORH 4PJDE 1NBZB 2I5YL 3W5NA 1A64A 1S9YB 4YXLH 3QHZH 4A2MA 1SM3L 2VOTA 2MMXA 4F33B 2Z8WC 5TE6H 4HCRA 3CZFA 2CLZA 1DFBH 1TVBB 3FO0L 4ZAKD 3MACL 3MGOB 3DV4B 3TGXA 5IG7A 4UOJA 1YEFL 5FM4A 1OWRM 4KPHL 4QRSA 2SEBB 5C0CA 3QULB 1KXVC 4G8GA 3MNZA 3MRFA 4NQED 4GS7B 1GJIA 5LWYL 2A83B 4AMKL 4D94A 5B3JF 1NEZG 4WFGD 5EOCJ 1W0VB 5C09E 1YECH 4Q6IA 3UBXB 2APFA 4PG2C 1P4LB 3P73B 1IEBA 4KROC 4GRLD 2ARJA 1ES0B 2MQ3A 1CE6B 3QDGD 1A7QL 5F9DC 4HUMB 2B1AL 1YMMD 3U0PA 1G6RL 1MSPA 1H0DA 4PUBL 2E8YA 3VWKB 2BY3A 4PJXA 5DD1H 2OMBA 5E4IA 1T22A 2ADFH 1BFVL 1UB6A 1M7DA 4X6DB 4L8BB 3SO3B 2J4WL 1FL5A 1FG2B 3WN5B 4LOUC 4Y5VC 3IDGA 3BH8A 3W9EA 3G5XB 5L7XH 3VFRB 1L9NA 4E0RB 3QZWG 5I1JL 3HI6L 3SY0A 1OTUC 4PBVC 5ADOL 4FFYL 5F89B 4GUPB 4ZFOA 4XHQA 3LKOA 3QXDA 2H2SC 2OTWA 2X1WL 3BSZH 5EO9A 3EFDH 3M07A 2BY0A 1NKOA 2IH1B 1QPXA 5C0EB 2A1WL 3VXRD 5FGBA 5BOPA 5EA0H 1RI8A 1RZGA 3SO5A 4GQ9L 4J8RA 2NW3A 5I9QC 4I1NB 3MLUL 4K8RH 2HP4A 4YFLF 2HTLC 3L95A 3V6OC 1G7MA 3OKKB 1PEZA 2IEPA 5FKPB 4X99A 2IBBA 2MOVA 1R3IH 1YY8B 2A6DB 3F7VA 4V1DA 5E8DL 3OAUH 3BO8B 3V4PH 1XGYL 1A7PL 1Y6NR 3BKCH 4F2MB 4ZS7L 1IFHL 4I3SL 2QQLL 2AS5M 3ZE2F 3L3OB 1OAZH 3KPNA 4QOKA 5EU7C 3NIGE 1CLCA 2NY0D 2Q7YB 2X4RB 4OGZA 1PX4A 5BCAA 4XP4H 4PRHD 3DI3B 2XACC 3BN9D 1FNAA 3QNXA 1FC2D 2AJYL 3GSWA 2FJGA 3MYJB 4NHUA 2Z8VC 3KLHD 5AEAA 3SDDA 2GTWA 1EH9A 3OXRA 4JEGB 4DAGL 1HOCB 4OF7A 3O6FA 2IBZY 1EO5A 4AENB 3BE1H 2OP4H 4U05A 3CSBA 4P59L 5B39G 5CLTA 3VGHA 5CUSH 3P77A 2H3NB 1CIDA 4NKQB 2R1WA 5DEGA 1N3NA 3KPOB 5DSCB 5KSAB 2VLKA 3QWQB 3FB5A 3GO1L 3RUGB 4MXQD 3V4UH 2HT2C 4I2XB 3QPXL 4G8IB 3ZTNH 1MJ8H 2CDEB 3PABA 1QSFA 3CFCH 3B6SA 4LIQL 1MHPH 1VSCA 3UBXG 4XPBH 1EMTL 2NY6B 1VGEL 4LVOC 1DSFL 4X98B 3U1SL 4D8PB 4LFHD 1H5BC 3EKCA 3FT3A 4HAGA 1D6EA 2XA8H 2J8UE 2OXGA 3MLWL 4LLMB 2P5ED 5GISL 3D0LA 3PGDA 3O6LH 4K9EH 4BQCA 3RPIA 1KPVB 2GAZA 1K5NB 4LSVH 1YEHH 1S9XB 5FFLA 2EE2A 4GKOA 3PQYE 3U79A 1DUZA 1QVOA 3C5JB 3D9AH 1CLZL 1N4XL 1BIHA 4XPAH 1A3RL 4XTRD 4X5XA 3JWNC 4NQDD 3ARDB 3BKJL 2VAJA 3O4LA 4IMLA 1G6VK 5F1NB 1NJ9A 1NKRA 5FGRA 1J9CT 3RWCA 1H8OA 3B9EA 4XP9H 4WJ5A 2AEQL 3KPMB 2C5DC 3EW3B 4ISVA 1A3QA 5BVJB 5I19L 1BFOB 1UJ3B 3N1QC 3ZDXF 3FFDB 5CINH 5JHLL 4MDIB 1IJ9A 2OBGA 3O8XC 3KPRB 4EZMA 4QGTA 1RPQA 4LEXL 4ENED 3MLTB 3M1BB 4EDWH 1I7TA 3N1MC 4OCNC 2NX5B 5GGVH 3NA9H 5HVGB 1TPXB 4WV1B 5C09A 2J6EA 4LPXA 5E00A 1JNLH 2ZKHH 2XIDA 1B9ZA 5ESQA 4QHUA 3FQUA 3DMMB 3ZDYE 5T3XD 4DUVA 3CLEH 3NOIA 1DLFL 3V52L 3GI8L 3STZA 1VGKB 4UTAH 2WIMA 3ZKNC 2XKNB 4RZCA 5FYLE 2G75A 2Y5TB 4QF1A 5E2VH 5ALBH 5F3BB 5ALCH 2HFGH 1EVTC 4L4VA 4TSCL 1CGXA 2DI7A 2VXTH 1JGVL 1OP3K 2AEPH 4DZBA 4JLRB 1OW0C 1EAJA 5D93B 3K2MC 2VZUA 2YUWA 3IDJB 1SBBA 3CSPA 4JFEB 4QHNB 1MUJA 2C4FU 2NY3D 4Z7NF 4XCCL 5E8OB 2VLLA 2Y4SA 3GRWA 4L9DA 2JIXD 1ZA6B 5AYUL 3REWB 3MRGA 2FO4A 5BXFA 3I6KB 4M7ZB 5FYJU 4U1MB 1GGBH 2LQRA 1OAXH 3R4DA 2WUBL 1LP9B 4KXZI 1LDPL 1AGDA 3VFTB 2HYMA 2O26U 3MBED 3MNVA 3TC9A 4GT7A 2OI9C 3H7BB 2L0DA 3IJHB 5MI0B 4HKBA 1P6AB 1E4WH 3JTTB 5EOQL 2X89A 4R4ND 1KOAA 3V0VB 4IRSD 1NCUA 2YZ1A 5INCB 2V5YA 1WFTA 1CGWA 1MF2H 4UINH 1SJXA 3BP7B 5JOEA 4NQCD 4OZHA 3O3UN 3SHSA 3MLRH 2WSKA 3SCMB 3IAGC 1RAMA 4KFZC 3FB6B 1A6WL 5FECB 2DJSA 4ZS6C 1MCPL 2OQJA 2VDLL 3W39B 1K85A 1AD0A 2CLRA 5EU6B 5GGVY 5JXEC 2GQHA 3GNML 3W2DL 4QHMA 3IDUA 4HUVB 3DSNA 3VGGA 3F6LA 5C6WH 2CRYA 4PJAB 4NP4H 4XMKL 3V2AR 3UTTD 1HH9A 3MZTA 2PXYC 1UGNA 1D9KB 4D9RE 4FNLL 4FZEL 3LEVL 4EKXA 1MRFL 1KFAL 5IB1B 5IQ7H 4C56B 1NAMH 3HR5B 4K3DH 3EO1B 1SEBA 4XXCA 2JB6A 5F7FA 3RVTC 1IGMH 2LVCA 2XFXA 3SDCA 5C9JA 4OF6A 3PNWB 5C1MB 4X6CA 2WWKT 3L7FB 1NC2B 4JFOA 4HBCL 5FHBH 3OKMA 2J8UA 5C0CD 4G8GD 3QCTL 2ZPKH 4MDJB 4PLOB 2BP3A 5DI8B 2DQTH 4LU5L 4ZPVA 4E9LA 4XBEL 3H2WA 2C1OA 2ZUXA 3SDAC 3IFNL 2AQ1A 3VMOA 3IDMA 4XC3L 5TE4L 3EJYD 4HIXH 4HUXA 1F97A 1DLHA 4F57L 5F7YC 4M43H 4NNXB 3O4OC 1NFIA 4OI9A 1IAMA 1X5LA 3U0TB 5KJRH 1MRDL 5GGQL 2VDOL 1Z2KA 1MVUA 5MENE 5IHZB 5EOCL 3MOAL 1NDGB 3HMXH 4LPTA 1Q9LA 1CL7I 1G9MC 2EYTA 1CU4L 4JO1H 5TDNA 2ICEA 1J8HB 4RFNB 3C09C 4F7CB 1T66D 3R1GL 3SGEH 1A7RL 1MHHB 3W0WB 4ODTH 1O0VA 3SN6N 2BOCB 2VXVL 3GHBH 2D03H 3OGOE 1NANI 3MV7D 4PJ9A 5D70H 5F88B 6FABH 1ZLWH 1RIUL 1CTOA 4XP6H 1CXFA 3QUZD 1FV1A 2DQFA 5M7QA 3F58H 3L3HB 5KTEH 1BHGA 4LK4A 3LSOB 1YEIH 3LKQA 5D6CB 5FO8B 4ZMAT 4HF5L 2BXZA 2JB5L 2YD1A 3QJFB 5FM8A 3MV8B 3ULVD 3QO0A 4UU9B 3IVKB 4F9LA 4QXGH 5LBSL 1LO4L 1K4DA 4AIZB 5FB8B 3QDMA 4V1DD 1P5VA 3BZFB 4DFHA 5EUOB 2R8SL 3F7YA 1EGJH 1MELA 1A1OB 4CMMA 8FABA 1CS6A 3QFJB 4G7VL 1YNTA 3WL9B 2HN7A 4QOKD 3UMTA 2DLIA 5L0QC 2FHFA 5DJAA 2DTSA 4LPCA 4CADB 3TVMB 4KQ4H 4TUJA 2IANB 5JXAL 1LGVA 2C3WA 2EIEA 5A2KH 4NWUH 3P4OA 5HGBA 4J1UA 3SDDD 2R0ZH 5CKAA 4O58L 4N1EA 2JJSA 3O6FD 4LRNH 4OCMC 4PY8J 4M5ZH 3ROOB 4Q2ZB 5ECJE 5FO9B 2JCCB 4C83B 5LGHL 5IHUH 2R0WL 3B43A 4JQIH 5C08E 1B4RA 5SWSE 5DURD 3S96B 2V2TA 3VXPA 2WQ8A 3C9NA 5B8CB 1DEDA 4G8EA 2VLKD 5DHVB 1AHWC 3C8DA 5KSBF 3QFDB 5I16B 2CH8A 2PO6D 1TTUA 1QSFD 4PBXA 1NCDH 1VADB 4TVPE 4Z18A 3JV6B 4K55A 5E6IA 5I1EH 4PG9B 2YC1A 4XCNB 3RIAF 1CFBA 3JWOL 3AUVA 4ZPTB 4ONGH 4TULH 1PG7X 4P2OA 3B9VA 1ZV5A 2GK0B 4Q6YA 1BMGA 4WU7B 4ZDHA 4S1DC 3RL1B 1I85C 5TPWH 3IDNB 4ODSL 1DE4B 1I9JH 3CFKA 4FG6C 5AZEL 3BZ4A 3RWIB 2NY7H 1LNUA 3MFFA 4ZOAA 2PTTB 3JTSB 4PYGA 5ILTH 3I02A 3HE7C 3MRRB 3GKZA 5JIHA 2WUCH 4HS8H 4QRRD 5FF6A 3PWJA 4PGBA 3RY5A 4DTGH 5KVEH 4KI1A 3INUH 1DCLA 3MCG1 4TYUA 1KXTB 1QACA 3O4LD 5HGAB 4ZSOA 3U4BL 4LCWB 3S3PA 5DO2C 4NBZB 4JVWA 4XT1C 4Z5RA 3O9WB 3S9DB 3WS3A 1OSPL 2N56A 4O2FB 3BMVA 2DQUH 4BQ6A 1DQLL 1RULH 4YZFE 2PF6A 1JN6A 32C2A 3O0RH 4I13B 5HYJA 4NBXB 1DBKH 4JM2B 2BDNH 4U1IB 3O45B 3X12B 3ZT7A 3FT4B 4BSWA 3QWOB 4Y2DB 3ARYA 1C5CL 3A0OA 4GH7B 1U3JA 2W92A 5C0RL 1INEL 5C09D 4KJQD 1VESA 3B3IA 4LQFL 3RKDC 3MNWB 4ELKA 4HKZA 2V7HB 2PW1B 5SWQB 1FFOB 5JNYB 4BUGA 3JWDH 3C2AL 2IFFL 1KYOK 4E41E 5EU4B 2AJSL 4PJEB 4PGDB 5IBTL 5TQ2L 2IPTH 5T3XL 4CDGC 2PNDA 5FUOH 3TH2T 1XMWA 2XT1B 3MUJA 2G60H 1KCVL 3P3YA 2F74B 5IB2B 1U95B 1LWRA 2IPUG 3PDGA 3SGJA 1M7XA 4GRWF 4AQOA 1L7IH 4XH2A 2FGZA 2UZXB 4QWWC 2VABA 4LSTH 3I3BA 1MCJA 3RDTC 4YE4L 3BEVB 3BI9X 1ZVYA 5J6HB 2EDNA 3NH7L 5F9WC 1V3KA 4QNPF 4ZNEE 5DJ2A 3O6ML 1OCWL 4H0IA 1Q1JL 1PG7H 3QAZC 4NYLB 2YPKB 15C8L 5D96B 3CCHB 4MXWH 4DFIA 2ZUYA 4XMLL 4MHHI 3I6GB 4UT6L 1ADQL 5DEFA 2DL2A 2HJFB 1OOAA 4RBPH 3TJHD 3MRKA 3HB3C 1EZVX 4YQXL 2IMNA 4Y19B 4CW1B 2O61B 3FRPA 4PGCA 3VH8A 1YMHB 4M7LL 3CUPA 4P9HH 1B2WL 1MRCL 3HUJF 1IEAB 2X89D 4ODVH 1FRGH 1N64H 5TE7L 2NW2A 2H6PA 1RIVH 4KTEL 5B3NA 3QG6B 4TPRH 4J3XA 4RFEB 4YXKH 2R2BB 2EIZB 5EZJA 4AYFA 3VGAC 1RZFL 3MRIB 1JTTA 5E1HB 4BJLA 1OM3L 2D4FA 2ICWI 5DD0L 4U1LA 4IBLT 3CVIL 4AEEA 1EAPA 2X1XR 4D3CL 1U8NB 4U31A 2JJTA 1HNFA 3HMXA 4N0CC 4ZG1A 2QHRH 2F8VA 3TNNA 2UVEA 5SWSA 3L9RA 1ZS8B 5AYQA 1QHPA 3IFLL 1EPFA 5D71L 3TF7C 4H88H 1KC5L 3MMEA 4S2SB 5HI5D 3SDCD 1ZGLM 1UH2A 3QQ3B 1AE6H 3IRPX 2Q6WB 4DVRH 3UO1H 3LZFL 4YIQA 2NY4B 4AL8L 3FO9A 1YDPB 1JHTA 1TVHB 3MO1A 5M94B 5DQJA 3HPJB 4HCRL 1EV2E 3NVQA 5FCUH 1UQSB 3EYQC 4MCYB 3UTOA 4YUEL 5IGXH 4ODHL 1MHCA 1CR9L 4GG8B 3GMPB 2W9EL 3MRJA 3CK0L 3WS6C 4MD5B 1JGDA 3V6OE 1EGJA 3WE6A 5EC1A 4CVZB 5GS2D 4TNVK 4F58L 3QISA 4U1KA 1ZHLB 5CEYA 4S0SD 2XWBB 3MV9A 5JIIA 2DLEA 1F3JA 3MJGX 5I1IH 1TCRA 3LS4L 4XZUA 3NFPB 3MODL 4KK8C 5AG9A 2XICA 1I3RA 3SKJH 2ORBL 3NFSL 1OAQL 2G5BA 5GS1A 1NEUA 1NAKL 3P4NA 1T21B 4D9QE 2NTSP 3VI4E 1I7UA 4LCCB 4PJ9D 3TA3C 1TNMA 1LK2B 4Z0XA 5DFVD 2IQ9L 1KNOB 1F58H 3NIFF 3EDDA 3QEHA 2VDML 4IOFC 2PYEB 3QQ9D 1CFQA 5GRWA 2IALA 4PRAB 1D5BB 3KYAA 4G8FA 5I8CA 4LSUL 2FR4B 3FRUA 3UP1A 1FZMA 5DT1L 4I0PA 4I48B 1NEZA 5CSZA 5DC4B 1KCSH 4E41A 3U9UA 4RAHA 4G3YL 2COQA 4P46C 3QXTA 3WFZA 5I1LB 4NWTH 3X11A 5T5NG 3GDBA 3ULVL 5GSRA 1F11A 1GHFH 4A6YH 5HHOB 3HI5L 1GIGH 1MHEB 1I9EA 5FYLD 2FX8L 5IEKA 3D39B 1X44A 3Q3GB 3SDXF 5KANI 1TJHL 3LS5H 3T0BA 4G80A 1HIMH 1P4IH 3E6HB 1IBGL 3TZVC 1GZQB 3UYRH 4DEPB 4R0LC 1CE1H 2B2XL 1J88A 1IRAY 3BPCA 2IPKA 3M17A 3NGBC 3OMZA 1FNEB 3ESVF 1TQCB 3HCVB 4NQSB 1EFXA 1LK3L 2Q3AA 5GS0D 4ZNEA 1F3DJ 3U36A 5CZVL 1RZ7L 3RUGE 3OJDA 1X5YA 4P23A 4U6VH 4F3FA 4I2XE 1I7RB 1KTLB 4YAQB 1JGEA 3KLAB 2EE6A 2FL5A 1XF4B 2EH7L 4QXUL 1BVZA 2ZCLL 2AXFB 3UYOD 3UTSB 1EZVY 3HZYA 4LBEA 5LAXB 1IC7L 4TOYH 1FNSL 4JPIB 1BWWA 1S7SB 1BQHB 4OCSL 5J1TC 5E6ID 4YJZL 3C60B 1CG9A 2XOTA 3VRIB 2X4PA 3SKOB 2DKMA 4P3WA 2NY1C 3TBVA 2EZ0C 1F00I 2W65B 2DRUA 3GSQA 5EFIB 2VDPH 1J1OL 1YYLH 3MX0A 1G7JA 2BXYA 3AREC 5GJTH 5E24E 1DP0A 3FO2B 5CD5C 2A6KB 4M93B 4DGIL 1Q94B 5AUMB 5IF0B 1NBZA 4TTGA 1S9YA 2AJ3A 2RHEA 1HYSC 2CJUH 2P46B 4UT7L 4F33A 3NPZB 1QBML 1WITA 1SBSH 2CIIB 4D9RD 4OCWH 3GJEB 5CILL 1TVBA 5HYQB 4OLVL 3MGOA 4LASH 3DV4A 5ICZB 2EH8H 1WIUA 4BQ8A 3KPRE 3RJQB 5DUPH 4Y5VA 2SEBA 4XVSH 3QULA 4OZIB 7FABH 3QEGL 1Z6JT 2C3VB 2A83A 4QTHB 2APXA 2MSPA 1W0VA 4I3RL 4HV8B 4M6AA 1E4XH 1TETH 3UBXA 1LEGB 3RGVC 1P4LA 1T7VA 5ITFB 4XCYB 4HS3B 3P73A 3QR2A 3LH2H 1A3LL 1ZLVH 2OL3H 4QYOB 3TH3T 4NUJA 1ES0A 3RY6C 1CE6A 2A77L 2Q8BL 3E8UL 3WIFB 3OB0H 3GI9L 3PHSA 3VWKA 2WAHA 1OLLA 1CN4A 2CO7B 4Z9KB 2Y7QB 3MUGB 3RWDA 4PJGF 5SX5H 5BQ7B 3EIFA 3LEXB 2G9HB 4L8BA 1FG2A 3WN5A 2AXHA 1YNKH 3HE6D 4KZEH 2EC9T 3SGEI 3SKMB 3G5XA 3VFRA 4Q9QH 3CDGB 5GRUH 4E0RA 2VTFA 3QUMH 3MRPB 4JFEE 5LKNA 5MEND 5F89A 4NO5B 4GUPA 2Z8SA 3NZ8B 5CMAB 3H6JA 3BVNB 4ZO8A 3TNMB 3FL7A 4B7IA 1IC5L 3CH8A 4L29B 4EEEA 2IH1A 3EYOA 1XF2B 4HWEL 4XCFL 4HEME 1T03H 1KBGL 3G5ZB 5HDQL 1MCOL 3ZKSD 3O81A 3OKKA 5FKPA 4OIBA 4LSQH 2OR7A 1YY8A 2A6DA 5IB4B 2VLJB 3BO8A 3GRWL 1BQHG 3TO4B 4F2MA 2F15A 2IAMB 1FORL 2FHBA 3L3OA 4BQBA 1PY4A 5E2TH 1DBAH 1J0ZA 4YXLL 2YD6A 2Q7YA 2X4RA 1A1NB 5TE6L 1FN4A 1I9RH 3WHXB 3U9PH 1DFBL 1H8NA 3TN0D 2DBLH 1B4JH 1A7NH 3MYJA 3S37X 2BSSA 1XF3B 4DKDC 1HOCA 2KZWA 3HRPA 1QD0A 4GAJH 2I26N 4AENA 3ULUH 3WIHA 5B4MD 1KLFA 2H3NA 3P9WB 4KRPD 1VACB 4OQTH 1YECL 3ME0A 1Q9KB 3CMGA 4JFDB 5DJ6A 3C8HA 2VH5H 4X83A 1T20B 5DSCA 4C56E 5KSAA 3RUGA 2DTMH 4HC1A 4I2XA 4Q0XH 3EHBC 4G8IA 5C08D 4TRPH 5CIPB 1IAKB 1K3ZA 2CDEA 5SWSD 3B9AA 5DD1L 2P5WB 2YXMA 2ADFL 1E4KC 2YMXH 2FBOJ 2QADD 4X98A 2B5IB 3JV0A 4RMVA 1U2CA 3TWCL 4LLMA 3DARA 3TYFB 4P5TC 4JGJA 4W6WB 3P0GB 1JGUH 1KPVA 1K5NA 2A73B 4ZODA 3QIBB 2XN9B 4K94C 1S9XA 5CEZH 3MRHB 2GI7A 5C0FA 1PYWB 4LLUB 1CDUA 4AM0A 2BHUA 3SE9H 3BSZL 1G84A 4LARH 3EFDL 3C5JA 4O4YL 4N8VB 1EDQA 1ND0B 3SEPA 4X9HA 4KQ3H 4OLYH 4E5XB 3L5WB 1FVCB 4K8RL 3STBA 3VRJB 5ICXB 5F1NA 1O7SA 4U3CA 1EEZB 1S7QB 1R3IL 5C92A 3IAQA 1TLKA 3OAUL 2NNAB 1J8HE 4GLRH 1T1WA 3ARUA 3V4PL 1JTOA 3BKCL 3KPMA 3W0WE 4RMQA 3ULUE 5F9OH 4XWGL 5BVJA 1BFOA 1UJ3A 3X3GH 2FX7L 3FFDA 4MDIA 4U3HA 4Z7UB 3KPRA 2H32H 1J05B 3UJIH 5J06A 5DMIH 4XP4L 3MLTA 4XPGH 3M1BA 1CI5A 1KTDB 4HJ0D 4YK4C 3V5KB 3S37H 2P42B 4KTYA 2OP4L 4R90L 2VN4A 4PP2B 2D7QA 2IG2H 3D0VB 5H2BB 1Q9OB 5CUSL 4JKLA 2H45A 4Y16B 1CT8B 1GOGA 1IVLA 2CR3A 5EUOE 3VD7A 1I1YB 1YQVH 3LQMA 5C0JB 2XKNA 2P24B 3QFJE 4X5LA 1E6JH 2WIIA 4I0PD 5MEPA 4PJIB 5C0IB 2Y5TA 3NMEA 3VI3F 2X41A 5F3BA 2EXYD 1BLNB 4U1SB 5HY9B 2R39A 3DPBA 4E41D 3MA9H 3ZTNL 4JLRA 3CFCL 1S7RB 5CP7A 1JWSB 1MHPL 5EPMB 3A6CH 4ODWB 2IANE 4XPBL 3LKSA 4MNHB 3MCLH 3IDJA 3A67H 1FCCA 1ZHNB 4JFEA 4QHNA 4ZTOH 2VDKH 5T1KA 2D0GA 2OSLB 2EIDA 5E8OA 5J1AB 3S35H 1ZA6A 4NIKB 2QTEA 4UIKH 7CGTA 3WJJC 2LV4A 3O6LL 4K9EL 3I6KA 2JCCE 2CUMA 3UZVB 4U1MA 2VDRL 3OG4B 1YEHL 1XGUB 3NA4A 1CICB 4OKVB 5CKGA 5IJKC 3C5ZC 1EFXD 2FECL 1LP9A 4CJ0A 1OGTB 5I18H 4HIHB 3VFTA 4RNRB 1KB5H 1CGYA 3EGSB 3D9AL 4WRLA 4XPAL 3AS2A 3H7BA 4X6BB 4P23D 3MUY1 3IJHA 1KT2B 1HXYB 3E3QC 3JTTA 3IU3B 3QIWC 4CBPA 3V0VA 1NCBH 2QKIB 2X42A 5DA0B 5INCA 4M9OA 1WFOA 3AS1A 4N8VG 3LPFA 3LN5B 2R9HD 4XP9L 5IBUB 3HC4H 4R9HA 4YC2B 4OJFL 1EEQA 2XY2A 1DL7H 1JV5B 1NSNH 3GIVB 4PRDB 3FB6A 3GSUB 2CK2A 4NT6B 5CINL 3G6AB 4V2CB 1BD2B 3L5HA 2R69H 1A4JB 1N0XH 1R24B 2EECA 4MB4A 4PJDF 2X4SB 4X4YB 4LMQE 4HUVA 4R2GC 4ZUVB 1KUMA 4EDWL 2VXQH 3NA9L 4PJAA 4OLUH 4F7MB 2OTPA 3I3DA 3N50A 1PLGH 1B3JA 1JNLL 2ZKHL 1OAYH 1U91B 1R5WB 5IB1A 4WWKB 4C56A 3HR5A 43C9B 3A6BH 3EO1A 4LAQH 5D7LE 1Q0XH 1ETZB 4B50A 5FV2A 5CSBA 5E8EB 2EDBA 2Z31C 3OWEA 3PNWA 5ACZB 1B6UA 1PJ9A 5E2VL 5ALBL 5ALCL 2AVGA 2Q7NA 4HX1B 1LHZA 2VXTL 1NC2A 2AEPL 4LOUD 4WW1B 1FYTB 1MQKH 2DIBA 3OPZH 5A43C 5J6GA 3GSNB 3M45A 4MDJA 1QA9A 1FPTH 5DI8A 5EN2A 5DJXB 2FATH 5DJ0B 3PWLB 1TENA 1RUKL 2H2SD 2OJZH 4RSVA 4MB3A 3BQUC 5IOPB 4Z7WB 5DMKB 1GGBL 2H1PH 4WHDA 1OAXL 2GYSA 4NNXA 2AJXH 3IB4A 3LKNA 4WU5B 4KWUA 3U0TA 2HTLD 3VWKD 1N2RB 5JA8B 1JWUB 5IHZA 1NDGA 3RX8A 4U1JB 1J8HA 1QNZH 4F7CA 1E4WL 1D5IH 5TGBB 4GAFB 3W0WA 3UDWA 4YHLH 2BOCA 3EYSH 3O2DH 5JTWA 3WFCH 5DYOB 1CF8H 1MF2L 4UINL 5F88A 2YN5A 4OQTA 2CK0H 4WW2B 3PF2A 4MVBD 3K1KC 3L3HA 5JIKA 1WCBA 3MLRL 3LSOA 1QOKA 2R15A 4D9QD 1G1YA 3H0TA 5D6CA 2FCBA 2F8OA 1HWGB 3T2NH 2ZOKB 3QJFA 3NIGF 1ZTXH 3MV8A 3BD5A 4UU9A 3IVKA 4Y19E 1DJSA 1PEWA 4H26B 3VE0B 4KDTA 5FB8A 1KXQE 4IS6B 1MEXL 5CP3A 3VWJC 5EUOA 1EHAA 5LCVH 5BV7B 2VZVA 4MQXC 3QFJA 4H25B 5IQ7L 4J3UA 3WL9A 4K3DL 3BIAX 3VFOB 3MGTA 1LEKB 3EFFB 4PRIB 1IGML 3QB7C 2IANA 5J12B 1ODAA 4LDEB 1U8PB 4FFWC 4DKEH 4QHKI 5FHBL 2H9GA 1UM6L 3EYFB 3MXVH 4HT1H 2OJEB 5CWSB 2ZPKL 4Q2ZA 3ROOA 5FO9A 5C07E 2JCCA 5DRNB 3D48R 2DQTL 4C83A 4EUPB 1M05B 3K8MA 5A16B 3BKYH 3W82A 2AK4B 3S96A 4ACPA 1FFPB 1HI6A 1QPPA 5B8CA 3GSOB 3HE7A 5KSAD 5DHVA 4HIXL 1ZA3B 3V6ZB 2CGRH 3QFDA 4M43L 5I16A 1UXWB 1WF5A 4CVWA 1JHKH 1BVKB 5KJRL 4W81A 5L2JB 1VADA 3HMXL 3ZYIA 3JV6A 2NY6D 4WDIB 3DXAE 1CLOH 4BH8B 4JO1L 4UAOB 4PG9A 4XCNA 4P4KB 1Z5LB 1HINH 4ZPTA 4RGOH 3DYPA 4ODTL 1I8KB 4NJAH 3GHBL 2GK0A 4DN4H 1OPGH 4PD4J 1RZ8B 5EIQA 4WU7A 6FABL 4I18C 4XP6L 3RL1A 1DE4A 5IVXB 3F58L 1QFWL 2DMKA 5KTEL 3RWIA 1G7QB 2PTTA 3JTSA 2NXZB 3MRRA 5FYKU 1YEIL 4NRZB 5I2IB 4U1GC 5I66B 1O7VA 1GGCH 2NZ9C 1K4CB 4R8WH 4RMUA 2DM3A 3TBYB 5HGAA 3MJ9H 4TVSa 5FYJE 2HVJA 4GO6B 3BP5B 3UTPE 3O9WA 1EGJL 4O2FA 5DLMH 2D7MA 3CU7A 4FQ1H 4N1CA 4LVHB 2FX9H 2X4NB 3U7AA 5D7JB 1R5VB 2VXUH 1A0QL 3KPRD 4JM2A 2FEDD 3ZDYF 3O45A 2O5XH 3X12A 4KQ4L 3FT4A 5HVWA 4DK3A 1ZT7B 1A02N 2ZUQC 3QWOA 4Y2DA 4NWUL 4XNQB 4APQC 2PYEE 4KU1A 3FFCB 2R0ZL 4OZ4B 3S7GA 4K7FB 5BVPL 4A2LA 3MNWA 4JRYB 5EWIH 2VR4A 2V7HA 1NL0H 2IC2A 4LRNL 8CGTA 2PW1A 4M5ZL 5SWQA 1A1MB 1FFOA 3ABZA 2NR6D 5JNYA 5L0QB 2CKBB 5IHUL 2DICA 5EU4A 2CDGB 4PJEA 3GSVB 3RVXD 4KJWC 3IXAB 4DUWA 1TTGA 2VE6A 4KVCH 4X9FA 3D39E 2F74A 5IB2A 3EUUA 2ID5A 1U95A 4EUPG 1MFAH 4D2NA 3RNQB 5F97E 1Y6KR 1GGIH 2FH6A 3VFVA 1R3KB 1HILA 4ZAKC 5ACLA 3BEVA 4JFED 5T1KD 5I1EL 5J6HA 1UKSA 5EOTA 1H3UA 4ONGL 4TULL 3KLSA 4M4RA 1P84K 1QLFB 5A1AA 4WGVB 4NYLA 5DVLA 1P6FA 4BFBD 2YPKA 2EYSB 3PWVB 4EIZC 2UVFA 3F8UB 3U6RB 2MHAB 4PJ8B 2X7LB 1I9JL 3I6GA 3SQBA 1F02I 2HJFA 2NY7L 4WY7H 4PB0H 4Y19A 5ILTL 4CW1A 4OV5B 1RK0B 1FAIH 1NCNA 1YY9D 2WUCL 1ROWA 1YMHA 4FQQB 4DTGL 5ID1B 5KVEL 4JDVB 3INUL 2X4TB 1UACH 4J3SA 4N8PA 3RKPA 1T2XA 1P7KB 2DB8A 4WI8A 1DN0B 4GXUN 5ISZB 3P30H 4NO2A 5D1XB 4UIMB 2DQUL 3MLYH 5F96H 3QG6A 1RULL 4XNZB 5J11C 4PJCB 4RFEA 1JVKA 2X9XA 2R2BA 2EIZA 2W38A 3O0RL 3OG6B 3MRIA 1KIPB 1DBKL 3KJ4C 2BDNL 2ZUUA 5B38B 4KV5F 1H3XA 4F7TB 3EDKA 1U8NA 3GUTA 2Q8AH 3MLXH 4YFDB 1XR8B 1NC4B 2Z0BA 3BYYA 4GJTB 5GRYA 4UMGA 2BSED 2EDOA 2JK5B 4C56D 4IMKC 2KH2B 3JWDL 4JZJC 1CCZA 2ZOLA 4JDTH 4S2SA 2FRGP 4X4XB 4YGVB 2IPTL 5KS9B 2ZUVA 4ODUB 3QQ3A 5FUOL 1JPSH 2Q6WA 4LPUA 1X5KA 2G60L 1WZLA 3GMNB 3U7WH 3CVHH 4C55A 1E28B 3DXAA 1YDPA 1TVHA 3RA7L 3HPJA 5JOFB 1L7IL 1DBJH 1NC2D 2A6JB 2NY0C 1UQSA 1I1AB 4LSTL 3BN9C 4LLQB 3GMPA 4IRJB 1XT5A 4MD5A 1ORSB 4FFVD 3D3VE 4CVZA 1BGXH 1PG7L 1KSRA 4MXWL 4Y4KC 3UCRA 1ZHLA 4KKCD 4GLRI 2APWA 1FL6B 4QRQB 4L8DB 4WEMB 5D6DC 1MCWM 5E8PB 3V7MA 2PR4H 1FFNB 1UC6A 4MXQC 3QI9B 1J8HD 4P9HL 3PHOB 3K46A 4HJGB 1T21A 3UTQB 3W0WD 4ODVL 4OI8A 3ULUD 3WNNA 1FRGL 3RIAK 1N64L 2OR8A 3JWOC 2QJDA 3BRFA 1OLZA 3RWFB 4LCCA 5GSVB 4EBQL 4KHXH 3TZVA 1LK2A 4R0LA 1RIVL 3P11H 2AEWA 2CD0A 4TPRL 5IUSA 5FM5M 4PJBB 4X6EB 4YXKL 3WIIL 2VLJE 2PYEA 3OKDB 1YPZB 2PYFB 4PRAA 1D5BA 4LSPH 3K80A 4OZFG 4ZOEA 5IBLD 4R26H 1KACB 4I48A 2V5MA 3DURB 1M71B 3MV8D 5DMGD 4BFIB 3T04D 5EZIH 2QHRL 2V5RA 2GTZB 4XTRC 5I1LA 4HD9A 3MROB 1R3LB 4NJ9H 5HHOA 5B38G 4JZOB 1MHEA 2XPGB 3GHEH 1T5WB 3QFJD 4FA8A 5IT2H 3D39A 4FHBD 4XNXH 3Q3GA 4JN2B 3T0AA 4H88L 4IJ3B 4UDUB 3P9MB 1BFTA 1KCUH 4QRPE 3FAXA 1GZQA 1QR1B 4OUOA 3TCXA 3O2VH 1AE6L 3STLB 4TQEH 3U46B 4DVRL 2IAND 3UO1L 1FNEA 1IARB 1HEZB 5IWLA 3PL6B 4NQSA 5GGRB 4UNVA 4JFDE 5FCUL 2GJJA 5GRZA 3OKEB 5IGXL 1ZT1B 5HYSB 3MJ9A 5D2NB 4OGYH 1I7RA 1KTLA 4YAQA 3KLAA 3BH9B 3LVEA 1XF4A 1T04B 1PAMA 3G9AB 4MAUH 2P5WE 4XB7A 5DS8B 3C08H 1W72B 2AXFA 5LG1A 5A40E 4L9LB 3HE7D 2BNRB 4G6AD 4P2YA 5I74B 2F58H 5IM7B 2VWEE 2Y36H 4XMPH 1N8ZB 3X3FH 3RZWA 5I1IL 5MP6H 3RX7A 5LAXA 1YC8A 3A6OA 1AI1H 5C0DB 1NBQA 1KPRB 4HC1L 1NCAH 1S7SA 1BQHA 2DQHH 3SKJL 3C60A 3RZCB 5C70A 1JZ3A 1CDYA 3VRIA 4EXPX 3SKOA 4UV4H 3DUSB 3H3KA 1TFHA 5K9JH 1LE5B 4HGKC 1NGZB 1F90H 2W65A 5EZLA 5EFIA 3MOQA 2NY3C 3PGCB 1JF6A 3P0VH 4MQTB 3FO2A 3DBXB 2A6KA 5AUMA 1F58L 5CJ8A 4OGXH 1C08A 5IROC 3UZQA 3BPLC 4R7NB 5FOBB 2K3TA 2B8OT 4YZFF 3T3ME 2CIIA 4XRCB 4Y5YB 3WUWG 5B22A 1MH5B 5HYQA 2O93L 4GW1B 4Z7QE 3MBEC 1NPUA 2MCPH 3HA0A 4JFPB 4PJ7B 5D7LD 3TIDB 1LO5A 4NWTL 3O9WD 4EDXA 1U8LB 3OGCB 2C3VA 1GHFL 4R4NC 4A6YL 4YXHH 4ONOA 1GIGL 5BS0B 4HV8A 3T77B 3LS5L 1HIML 1P4IL 5I6XB 1J7VR 3FQNB 4JM2D 4L8SB 1LEGA 4MJ2A 3UYRL 3WLBB 1CE1L 4XCYA 4HS3A 5ITFA 4K2UH 1Q8MA 4MA7H 3U30C 3RWHB 4Y2DD 2HFFA 1NUNB 3S36X 1MJUH 4NBYB 1HQ4B 5ADPH 3D3VA 1NBYA 2Y7QA 2F53B 3F5WB 4PJIE 3MUGA 4CU6A 5AWNH 4PV8B 5BQ7A 4U6VL 3LEXA 5IW6A 1AJ7H 2G9HA 3EAKA 4JREB 3SKMA 5E08H 5J13C 1KB9K 3CDGA 4RMSA 3MRPA 1KEGH 3F65A 1DQJA 3NZ8A 5CMAA 4M6OH 4PTTB 3TNMA 3TESA 2ESVB 3T2PA 1CVRA 4L29A 1TXKA 1XF2A 1KG0B 1BZ7B 4H8WH 4TOYL 4H0HB 4JZNB 4NN6C 1Y6MR 4MNQE 3O41A 3G5ZA 3BHBB 2KDGA 5GJSH 2DKUA 2E5EA 3GSNH 3CFBB 2E7LA 2FDBP 3ZE1F 5IB4A 2VLJA 2XG5A 4YDLC 3TO4A 2J1KA 4I0CC 2MKWA 1YYLL 2B39A 5GJTL 4Q6IC 2IAMA 1ERNA 1FLTX 2KUTA 5GRVL 3I9GH 1EHXA 1NGWB 2IADA 1MAMH 1ZVSB 3EZJB 3E0GA 3MYZA 4Y19D 1G0YR 2CJUL 3EJYC 4PRBB 1A1NA 1SBSL 3QCVL 5E8NB 1Q9WB 3WHXA 4OCWL 3IU4L 1XGRB 1AQDB 1E6OH 2DQGH 1IGIH 4LASL 2IF7A 2EH8L 1WT5A 1GRWA 5F7LB 1PFCA 1XF3A 5DUPL 4XVSL 4G9FB 4QRPA 1T66C 2EDJA 3N1FC 3C8KB 5FHAH 1EIBA 1VACA 1IM3B 2G2RB 1Q9KA 2IFGA 1E4XL 1G7IB 1TETL 4JFDA 1U42A 3LH2L 2BVOB 5FKAB 2F9BT 2CXGA 3QH3A 4FMFA 2OL3L 1LO2H 1I9IH 4NSKB 5C07D 4UQ3A 4NCDA 3U82B 1D5MB 3UYPA 1KENH 5CIPA 1IAKA 3ARBB 5FGBC 3SJVB 3SDYH 2ZCKL 3QNYB 3SKNB 2BSRB 2P5WA 3S36H 2ICCA 3ULVC 3DRTB 3PWNB 1HCVA 1QQDB 4ZFZB 1YNKL 5BV7H 1OGAB 2ILLA 3H3PL 4KZEL 4O2EB 3TYFA 4Q9QL 5GRUL 1N26A 1DANU 2A73A 3QIBA 3H9SB 4KK8D 2NY4D 3DXAD 5L8KB 4DGVH 1PYWA 4LLUA 1XIWB 4WEUD 5T33H 2HMID 1SYSB 4P3CH 2K7QA 2YD2A 5DUMH 4N8VA 4NFBA 1ND0A 1WAAE 1T03L 2AJUH 4OZGB 1OAKL 4LHUB 5CAYB 4E5XA 5EBWA 2BNUB 1GZPA 3L5WA 1FVCA 2ZP0T 3AVEA 3SDDC 3VFMB 2EXWC 1WEJL 3EYVB 3VRJA 5ICXA 4RMRA 3W11D 1S7QA 4LSQL 4EUPH 1SJEB 4IOFD 4FTVB 2NNAA 2VMFA 3DRQA 4L4TE 3VI4F 4F37F 3DIFB 3N9GH 4O9HH 5EULV 2WBWB 5E2TL 4OLEA 3CFJB 3RQ3A 1DBAL 3DROA 4U6XB 5FYJD 4KJPC 2HVKB 4TNWF 1I9RL 3UTPD 3U9PL 3QP3A 5ANME 5IMMB 5T1DH 1B4JL 1KTDA 4OT1H 1A7NL 4KI5E 3MREB 5J56B 2QQQA 1GOHA 1NGPH 1MPAH 3BRDA 3V5KA 4GAJL 3TZVD 1MIMH 5HHPB 3ULUL 4PP2A 4LNRB 1GC1H 3D0VA 5H2BA 1Q9OA 4Y4FC 2E9JA 4UT9H 4B5EA 4KDVA 5DF0A 4OQTL 5EC2B 4U33A 2PYED 4FQCH 3NCYP 4F7PB 1I1YA 4WTZG 5C0JA 2VH5L 2P24A 1G9EA 2VL5B 1E4JA 2N1KA 4GKSB 4PJIA 2DTML 3KPSB 4N68A 5ESVB 1BLNA 2ED9A 3MTRA 3B4NA 1LD9B 4PRIE 4Q0XL 4U1SA 5HY9A 4OLWH 3ALXA 4TRPL 2Z92A 1S7RA 2HKHL 4CNIB 1JWSA 5EPMA 4ODWA 1VA9A 4MNHA 2YMXL 1ZHNA 2UWEB 4JCMA 3D39D 2OSLA 1BBDH 2XNAB 5J1AA 3F7RA 4WI3A 3RUGF 5DZNA 3UEZA 4HFUH 4OD1H 1JGUL 5ESAB 1IGTB 2WBJC 1XGUA 5CEZL 1CICA 4OKVA 4MNQA 1WZMA 3S34H 3E2HB 3I75B 3RVUD 1OGTA 4CGTA 4HIHA 4LARL 1FVEB 4RNRA 3EGSA 4M1DH 1T0NB 2WANA 4M3JA 1JHLH 3BPNC 3IT8D 4KQ3L 1U8QB 1KT2A 4OLYL 4S1RH 2N7BA 1HXYA 4LPVA 3IU3A 2L4OA 2JELH 4XCEB 4KJQC 5CD5D 2QKIA 4G5ZH 5JORB 2CKBH 3RIFK 1EO8H 2AK1H 4NZUH 3LN5A 3W9DB 2YD9A 5DD3H 4WTXA 2YSSB 3MRCA 1HHIB 2GSIB 5F9OL 2ZG3A 1JV5A 3GIVA 4PRDA 3GSUA 4XX1G 3X3GL 1OY3B 4NT6A 3G6AA 3TPUB 1VKXB 2EIBA 1A4JA 3VXOB 3C60D 3UJIL 1R24A 5DMIL 2X4SA 1QRNB 5JMRA 1TVDA 5JO5B 4ZO9A 4ZUVA 3MOBH 5DJ8B 1GPOL 1EUTA 1IGJB 3WMSA 3KPTA 4WHYG 3B9KB 3D6GA 2ZG2A 4GW4B 4WHCA 3RBSA 1U91A 1C12B 4WENB 3BAEH 1CVSC 1R5WA 4MA1C 2IG2L 4WWKA 43C9A 2BVQB 3BEWB 3DETD 4PFEA 4LKCB 1ETZA 4OF0A 5CCKH 1OD9A 1T0MB 2F5BH 1YQVL 1HKFA 2A74B 3L3GB 3FB8A 1G7PB 5DFWH 5E8EA 3SQOH 3WXWH 5J8OA 4MGXA 3T2QA 1BWMA 3VGDA 5ACZA 3TJHC 4MD4B 4KMLB 4WW1A 4X9GA 2OMNA 3TO2B 3A6CL 4MQ7B 1HCFX 3MCLL 2N7AA 3A67L 4DQOL 1BFSA 1EXUB 2BVEA 1JMZA 4ZTOL 2VDKL 5DJXA 4OZFH 5DJ0A 2DD8H 5DFTA 3S35L 4JRYE 1CD9B 5I30H 4UIKL 1JP5A 1OAUL 4R7DB 3ARGB 5TF1H 5IOPA 1RIHH 3HNVH 5DMKA 1WAAA 5D2LF 3VXQB 3LN9A 4WU5A 2XZCL 4NKMB 1N2RA 1PY9A 1JWUA 3D3VD 1KB5L 3AU1B 2Y72A 2X4UB 5CZXC 4JGUA 4U1JA 3QIUC 3MCKB 1TITA 3BKMH 4PTUB 3CDYA 4QO1A 2C4FT 5TGBA 1ZWIB 2C3HA 4P49A 1NCBL 3QUXC 5DWUL 1PGRB 1YYMH 5DYOA 2CMRH 4IIQB 4D0DB 3TH4T 4WW2A 4XXCC 4ZXBB 1DL7L 5HI5C 1NSNL 1UT9A 1AY1H 1IT9H 3SDCC 4BZYA 3JXAA 4O5LH 1SJHB 4PR5B 2R69L 2MPAL 2FYYB 1N0XL 5DHYB 2ZOKA 5HHME 2VXQL 2BHYA 4H26A 4KMTH 3VE0A 2VLJD 3MR9B 4IS6A 1PLGL 4JFQB 2R0KH 1IKFH 1OAYL 2DQJH 3TO4D 2ICWB 3VFUB 1HWHB 3OAZH 1FSKB 4BH7B 3BFOA 3GKWH 3LIZH 4LAQL 1Q0XL 4XPHH 5I1DB 1LEKA 3EFFA 4PRIA 5ISZE 2R1YB 1DEEB 3U0WH 1RK1B 4PJCE 2H2PD 5IB3B 3P4MB 2NY5C 1U8PA 1DQDL 2XTJB 43CAB 3DECA 1MQKL 3EYFA 4QRPD 5CWSA 2OJEA 3OPZL 4IRZH 4CU7A 3CXHK 1FPTL 5T5FH 4G6JH 4EUPA 2I27N 1M05A 2YN3A 4G6ML 4AEFA 2J5LC 1ZHKB 5A16A 4PJ9C 2AK4A 4JFDD 2OJZL 4JHZA 5DFVC 1FFPA 3ZL4H 4JHAH 3AY4A 3RU8H 1ZA3A 1D5XB 3V6ZA 5F3HB 2AQ3A 2WWKO 1FC1A 1SHMA 1UXWA 2AJXL 3QQ9C 5DEZA 1BVKA 2CLVB 2VKXA 5KS9E 5L2JA 1S9VB 2P5WD 1RZIB 2FLRT 1J8KA 4WDIA 4BH8A 1WBYB 3BW9B 4P4KA 1Z5LA 4F9LC 2JJWA 3G6JB 1D5IL 1I8KA 2DI9A 4AIOA 1FFRA 4HZLB 3EYSL 5A3ID 1CF8L 5IVNA 1RZ8A 3V7AE 4QY8A 3QIBD 1ZLVK 2CK0L 3EDJA 3KGRA 2GCYB 3KYOB 4OBSA 5IVXA 1PSKH 4YDKH 1QFHA 1G7QA 2PCPB 4MHHG 2YZ8A 4P2QB 2HT3D 5E4EC 3HNTH 1KN2H 3NFNB 4NRZA 5SX5K 1JK8B 5I2IA 5I66A 1KJ2B 4LGSB 1SYVB 3T65B 3GZKA 1ZTXL 3WO4C 4JO4L 2FIKB 2JJSC 3UAJD 4CKVX 3BP5A 1AXSB 3OR6B 4NQDE 2B20A 5LCVL 2B4CC 5K9KB 2LU7A 4FZ8H 2P7TB 4NNYB 4I4WB 2X4NA 5D7JA 1R5VA 1V05A 3BZEB 3LD8B 4E42B 4QT5B 5F6IC 3RWEB 4Q9CA 3WFDH 5KSBB 3LQZB 1ZT7A 1N7MH 4PJBE 5EUOF 4XNQA 4NKOB 1ACZA 2ADGB 1YPZE 4OZ4A 2OTUB 4K7FA 1BF2A 3DGGB 3KR3H 5E6IC 3NCFB 4DKEL 1IL1B 2VIRB 1RZKC 3MXVL 4JRYA 4HT1L 2KQMA 5JW3H 1K9TA 1MFBH 3IAPA 3PGFH 1A1MA 3NAAH 1N5YH 1EJ6A 4EN3B 2CKBA 3QHTC 5I15H 4P2OC 4X7SH 1RU9H 5ERWB 2CDGA 2Z91B 3GSVA 3BKYL 1I8LA 1CD1B 3IXAA 2Y5EA 1BJ1J 5T3XE 5CFHA 5HGGS 2CGRL 1EHNA 3ZSSA 3HFML 3VFSB 5D7IB 3DVIA 3RNQA 4KHTH 5EUKB 1JHKL 2JCCF 2C3XA 1YN6B 1JCKA 3MRLB 1R3KA 1CFNB 1NMCB 1CLOL 1P4BL 1TZGH 2QSTA 1HINL 3Q6GH 3SGKA 4RGOL 3BISA 3MFGB 4U49A 5I17B 3RAJH 1QLFA 4NJAL 2DQIH 4DN4L 1OPGL 2VLME 3PWVA 5JLZB 2D31B 2MHAA 2XWTB 1CICD 4PJ8A 3U6RA 4MNQD 2ZG1A 2X7LA 3ILQD 5IEHB 1RFDL 4YO0B 1QZ1A 4OV5A 2V9QA 1RK0A 3OAYK 4EI5B 2DIAA 1IZJA 4FQQA 5ID1A 2W60B 4JDVA 3SE4C 3LKRB 2X4TA 4X7CC 2IGFH 4JPWH 2Q87A 4JZJA 1AP2B 1P7KA 3MJ9L 2DM2A 1NAMB 4ORGA 1JPST 1DN0A 4GBXB 5ISZA 1S8DB 5D1XA 1OARH 5DLML 4KXZH 1F6LL 4BM7A 4PJCA 1UM4H 3JV4B 4OGAC 2VXUL 2XV6B 1YJDC 1ZLSH 1KIPA 3AS0A 1GVIA 4M48L 3RWGB 3TJEH 5B38A 2O5XL 3G04B 2DAVA 1MREH 3B8YA 3SGJC 4HWZB 4F7TA 5I76B 1JWMB 5EU3B 4YHMH 1A21A 3IJYA 1DBMH 5JW4Q 1XR8A 3EOBB 2DQEH 2QL1A 1NC4A 1OQXA 2E7MA 5EWIL 5BZWB 5HVHB 1NL0L 3BPOC 1IM9D 4PLJD 2JK5A 5EH1A 4WWKD 3HMWH 4Y4KA 1KCRH 4PJ7E 3CMOH 5KANG 4X4XA 4YGVA 5AAWA 5KS9A 4ODUA 1HXMB 4KVCL 5HHNB 3KPQB 5BS0E 3GMNA 4JO2H 1E28A 3PJSB 1MFAL 4MX7B 2I07B 5JOFA 2A6JA 4MB5A 5JPNB 1I1AA 1GGIL 3RI5F 5ACMA 3B83A 5JW4R 3HUJB 3F12B 4LLQA 5FYKH 4IRJA 4W68A 5L88H 2P8LB 1ORSA 1X5FA 3K81A 4OFVA 1QHOA 2QQKL 3SPVB 5B4MC 4M3KB 2A9MH 4JG0L 1KIRB 4ODBD 1IAIL 4O51A 3S98A 2DM7A 1I8IB 4QRQA 5GPRA 4L8DA 4WY7L 4X4ZA 3RHWF 3GMOB 3UTZA 1IC4L 1FAIL 5JW4N 2JJTC 1FFNA 3IDYC 3ZTJG 1B0WA 3PHOA 4NQEB 4NN5B 2ESVE 4HJGA 3UTQA 1UACL 4HFWB 4L4TD 4PJXE 1QSZA 4U2YA 4X9BA 4JY5L 4OCYH 1LQSR 3RWFA 4OBRA 5DGQA 4HH8A 4XC1H 1YNLL 2QADC 1RURH 3EOAB 1JPTH 3MLYL 5F96L 2VRAA 2E9BA 3NCYS 5CJQL 4GRLB 5FO7B 4PJBA 4X6EA 1CL7H 2Z35B 4MA8H 4KI5D 4HUUB 2V2XB 5DTFB 1YPZA 4MD0B 3KHOA 2NYYD 4RDQF 1T2QH 3DURA 2Q8AL 4XVUC 2YHGA 3MLXL 4BFIA 1NANH 5IV2B 4FQLH 1NUGA 2DJUA 2GTZA 2EDRA 3LRSB 3MROA 3N85H 3L1OH 1R3LA 1GYAA 4JZOA 4KRMB 2XPGA 2YD8A 3PXHA 1BX2B 2R29H 3P9MA 1MFNA 3PP4H 4PRID 4JRWA 1QR1A 2NQCA 1I3GH 3STLA 1VFAB 4WHYH 3ZYOA 3U7WL 1RUAH 3CVHL 1HEZA 4LPYA 5GGRA 2UY7A 1A6TB 4FABH 5DRZB 3B8SA 1P53A 4OF8A 4HJJH 3OKEA 1HYRC 5GS1C 1ZT1A 5HYSA 4Z8FH 4OM1H 4ZUTB 5D2NA 3AAZB 1BOGB 4FMKA 3BH9A 4OKDA 4HJ0C 1T04A 2A0LC 3LV3B 1OT1A 2FWOB