3RWGA

Rhesus macaque mhc class i molecule mamu-b*17-mw9
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
276
structure length
276
Chain Sequence
GSHSMKYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAESPREEPRAPWVEQEGPEYWEEATRRAKEAAQTHRENLRTALRYYNQSEAGSHTIQKMYGCDLGPDGRLLRGYHQSAYDGKDYIALNGDLRSWTAADMAAQNTQRKWEGNRYAERFRAYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTEFVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I
publication title Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 80
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rwgA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rwgA01
4DKDC 4ZAKC 4IRZH 5C1MB 3P0VH 5IK3A 3QRGL 4F37K 2H8PB 3ARVA 1ZA6A 4JQVA 3U0TB 2LE9A 4OZFB 4TNVF 1DLHB 4OZ4B 4GXUM 5HVFB 4HK0A 3QEGH 2C3GA 1NGWB 3H7LA 4AEFA 2DWEB 4N0CC 5DD1H 1CTNA 4JFFA 1BBJB 3ZYIA 3GDBA 4X9IA 4Y16A 2DQIL 4JLRA 1KTKE 2R15A 3IDJB 2AXGB 4Z78B 5MENA 4NN7C 4N1EA 1NL0L 2ED7A 3TV3H 5LGHH 4QOKB 1X4XA 4PJAA 2FLBT 1B2WH 1OT2A 1T0PB 1FJ1A 1I3RA 5DWUH 4UT9L 3BESR 4P5MA 5IHZB 5C0CE 4J3TA 4QYOA 3MUY1 2Z31D 3QNXA 2QADB 5IBTL 2FGWL 2FEDC 3OAYH 5BV7B 1JI2A 1W8OA 1EA9C 4ZODA 5T5FH 2DBLL 4X0KB 1DANU 1L7IL 5A16A 4FQ2L 1U3JA 4N5EC 3QYCA 4NDMA 2W9LA 3G5VB 4FG6C 4KXZH 1H15A 1TDQA 4JQVC 4X5XA 5DEGA 3S8WA 4LSRL 2NTFB 3BDBA 2D3VA 2KH2B 3RWEB 3FOLA 1QRNB 2QSQA 3EBAA 3GSVB 4OQTL 4KI5C 1MCOL 3QFDB 2VDQL 3E6FA 4Y16C 5KN5B 4MQ7A 5GZNC 4M6NH 4JPKH 5JZ7D 1Q9KA 4JGJA 4XPFH 3T2OA 3W0WB 4OT1H 4R2GB 1BHGA 2C3HA 4RAUB 1F02I 3PQYD 4X6CA 3GJFA 3FQWA 4LNRB 5KVGL 5EC2B 1G6RB 3ZYZA 5JIPA 3TO2B 2DQEH 1TZGL 4XGZB 1T2QH 3H9SE 1QSFA 2H3NA 2E27H 2ZOKA 3P30L 4MJIA 3QUZA 5JW3H 5C6PB 1IBGH 5DJDA 5EBLB 3TC9A 3B83A 4KRNA 2DYPD 2GY5A 4KDTA 3RIAF 1T80A 1ZHLB 1JZ5A 3RWJA 5JOFB 5DEFA 2BOBB 2AGJL 5DD3L 3KPSA 5MEOA 5D2LB 3QPXH 4O02L 3WNOA 1ZVSA 2R1YA 4F8TA 1YMME 3WUWG 2ZSVA 1R5WA 1CVSC 4OTXL 1MCFA 2FL5A 3ROOB 1WZ1L 1E4XH 4Z7NF 1CGVA 4PRNA 2NW2B 4NQDA 3VI4F 1QKZH 2AXFB 4OCYH 1X4YA 2CK0L 1QP1A 2HLAB 5D6CA 1S7QB 1WZLA 1X9QA 2F74B 2UWEA 4AJ0A 2EC9T 4YFDB 2QQKL 5KSVA 2VH5H 1D5XA 3VW3H 1H0DB 3V52L 1JNNH 2XT1B 3DIFA 2X4OA 5JDJA 1J1XL 4WEMB 4NNYA 1CQKA 1INQB 3UTZB 2Q6WB 4QRUA 4KDTC 1TMCB 2GHWB 1JHTA 1GC1H 4HH9A 5DJ0B 4MX7A 2IG2H 3WFBL 3PWVB 5KW9L 1U3HD 4I0PC 4XMLL 2IALA 4PGZA 3B4NA 4UDTA 2VISA 1S9KC 2FBJL 4KV5E 1A6AA 1WC7A 3FO0L 4AH2A 5KZCD 5LGJB 2CRYA 4XWGL 3R8BB 5CUSL 3DRTB 1A9EA 3PHSA 1FVEB 3MV8D 1MF2L 4PJ7E 5K9JH 4KAQH 5AD0B 2H8PA 1RJYB 2Q20A 5I6XC 3U0TA 1TETL 1DLHA 1LP9B 3IDUA 3QWQB 4OZ4A 4GRMB 3E1F1 1NEZB 1IFHH 1OSZB 2QL1A 1NGWA 2VABB 2DWEA 5E4EC 2DQDL 4LVHC 4I77L 3TFKC 1BBJA 2BDNH 2A0LD 3VMNA 5DO2C 3GKZA 3L5WB 4JY5H 3T8XB 3IDJA 5HGDB 4RGND 4M9PA 5J4MA 1OCWL 3AMLA 5E4IA 4G8GB 2ENSA 4G7YL 1YQ2A 3PUCA 3M45A 5D7LE 4Z7VE 5IHZA 3RU8H 4IOIB 4YHKH 1TZIB 3L5IA 2KL6A 1NUGA 4OBRA 1CIUA 4PIRF 2C3WA 4JY6B 5D2NC 4RMQA 2ZUWA 4AIXA 4RFOL 1I3VA 3DPBA 1WFOA 3BWAB 1HKLH 3G5VA 3H42L 1AGCA 5FHBH 1DEDA 1QOKA 4PRBB 2F15A 4OSUL 2NTFA 4XPGH 2AV1B 3RWIB 4C56B 1WZMA 4FQHB 3VXUE 3RWEA 5LAXB 1QYGH 4WWKB 1QRNA 3GSVA 2EXWD 1CF8H 1QBLH 3QFDA 1YEFL 5KN5A 1CXIA 5J1TC 4FN0A 2CJUH 4PJEA 4ZDHB 3TN0B 4ERSH 4FHBD 4TSBH 3RVWC 3LHPL 4NP4L 3W0WA 1YNTB 4DN3H 4XCFH 3HE6D 5GS0H 1P69B 5I1AA 4RAUA 5FUZH 4MYWB 2D7TH 1K3IA 4LNRA 5I76B 4M6MH 2ATPB 2I60H 2QADC 1G6RA 3TO2A 3PF2A 5BV7C 1AQDB 2APFA 4XGZA 3RL1B 1PFCA 2DLHA 4RGMC 1EO8H 2WWKO 3RWHB 1M05B 5L7XH 5EBLA 2OJZL 3DXAE 2V5MA 4R0LA 4MA1B 4OAWB 2I5YL 1ZHLA 4OZGB 2BOBA 2RQ8A 4GAJL 3MBED 5EUKB 3CH1B 3QHZH 5SX4I 4FNLH 5D2LA 5JQ6H 3ROOA 1NCWL 4YXKL 3S88L 2YPVH 2NW2A 2IFFL 2YEZB 1KC5H 3F58H 4LSUL 2HLAA 1KB5B 4G6MH 4R2GC 1S7QA 2F74A 2XACC 1QLEH 3HE7A 2E3VA 3QXWA 5GGVH 4NQCE 3U36B 5K9JL 1VACB 2FWOB 1H0DA 3OZ9H 4EXPX 4I5BB 4EI5D 1OGAA 4K71B 2P5WE 5EULV 1WQVT 3OKNB 2OQJB 4JVUA 3U6RB 3WUZA 4NO5B 3UTZA 1I1RA 1W0WB 5HHOB 3MCLL 4GAGH 1TMCA 3GKWH 4WEUD 1ZEAH 3BKYL 4JREC 1FC1A 5DJ0A 5M95B 4HXAH 2PTUA 2VLRB 3PWVA 1WT5A 5JORB 2ZKHH 3VFVB 3SGKC 1U36A 5E8OA 5B38G 4UIKH 2OL3H 3G6JF 4FXGB 5CZXC 4LL9A 1S7WA 1ZLUK 3UTSD 5LGJA 1NSNL 2FBOJ 2GAZB 1X5FA 1SJHB 4G7VL 3WFHB 1FVEA 2YXMA 1J1OL 2VUYA 4I8DA 3Q48A 5AD0A 4JO3H 4HV8B 1DBMH 3TZVD 4HLZG 1EJ6A 4ISVB 1LP9A 2HTKC 1CXHA 1EJOL 4GBXB 2WIIB 3MXWH 1OSZA 2VABA 5ESAB 4HBCL 3W9DB 3O0RH 3HZKB 4NQVB 1CL7L 1NC4B 1A14H 1CI5A 3BIKA 5C0ND 2WY3A 5C09D 5D7KD 1VGEH 4OCLC 3T8XA 3TBWA 3QFJD 4JEGB 5I73B 1NLBL 4G8GA 3L5HA 5C7XL 5HYQB 3MOBL 5DURB 3RVXD 1FL6B 2NX5B 5FKAA 1A1NA 4QEGA 1WT5C 4IOIA 4OV5B 2V9TA 5FYLD 4XX1G 4CVUA 2YKLL 1ND0B 4JY6A 3B2UD 3QCUH 5D7IF 1K8IB 4J6RL 2DDQL 2IAMD 3TBYB 4JB9L 3E6HA 2IF7A 4O58L 5MERB 2ZP0T 2M8XA 4HWBL 1ITCA 1A6UH 5EO9B 2JB6B 2ZUVA 2AV1A 3RWIA 1RZKL 4C56A 3BYTA 4NN5B 5LAXA 1T2XA 4WWKA 3EFFB 1UJTA 3FFCD 3FRPA 5ID0B 1AD0B 2FX9L 1CLYL 4DWHA 5FF6B 1FFPB 5KS9E 4WIQA 4TYUA 1UWXK 2E7LE 3OSKA 1VEOA 5E6ID 4ZDHA 3TN0A 2HT4C 3VMPA 4KDVA 1YNTA 5IVNA 1FZJB 5FHAH 1CDHA 3ZE1E 4ZFFB 4UQ2B 2AK4B 2ATPA 3VDCA 4KROD 5E08H 1AQDA 1KPVA 3G5XB 4K94H 1MPAL 4W68A 4JN2B 3BP6B 3RL1A 4Y19A 4PJ9D 1WZKA 3VXOB 4IRJD 3RWHA 3LVEA 5AUMA 2QQLH 2YC1B 3P77B 4JQXA 4NQEE 2ZPKH 5L2JB 2E9JA 2VC2H 4NZTL 1XEDA 4OZGA 5JXEA 5E8PB 1EBPA 4PJHA 3CH1A 1Q9LB 1MRDL 4PTTA 2GUOB 3CNKA 3OXRB 3O81A 4GXVH 4WWKC 5C9JB 2FRGP 5B3NA 1HYRC 1NBYB 3KYNB 4S1SH 2LFGA 4Z76B 1LO0L 2XKSA 1EK3A 2EDOA 1DBBL 1LILA 3O2DH 5C0DB 2WM0A 3TN0C 2YEZA 4HCRA 3WFZA 1G9ML 3Q5OA 4JFOB 3FFDA 5JR1L 2Q8AH 2GFBB 2MHAB 3NCMA 2P42B 4V1DB 3T09A 1MOEA 4FZ8H 4M7KL 3O6KH 1K3ZA 3VGEA 3X3GH 4LPXA 2EEDA 3MGAA 1VACA 3SJVE 2FWOA 1KLUB 3HC4L 3JUYA 1HEZB 4I5BA 1GOHA 4LRIC 5INDB 3ARFD 4MVBC 3T1WA 2RCSL 3FMGH 3OKNA 2OQJA 5IHUL 4Z7WB 3BPOB 4HF5L 3U6RA 1L7TH 4NO5A 2WWKT 3EOBB 3NZ8B 3PNWB 4JQXC 5HHOA 1FGNL 5JXEC 3U7YH 3VFOA 4DAGL 4NT6B 1EHNA 1B0RA 4U6YB 1NANH 2CO7B 4ZOBA 2GI7A 2H2SD 3MROB 3C8HA 2VLRA 3W5MA 4PY7B 5JORA 3EDKA 1NCDL 3VFVA 4FXGA 4DKEH 4PRPD 4TN9A 5EOCH 4B41A 2CH8A 4Q9CA 1RIHL 1J88A 3CFJB 1SJHA 5ABDE 3WFHA 4CMMB 4S1DC 2JKXA 5ALCL 4KV5F 2XYCA 4L4TD 1OP3K 2N4IA 2R2HB 5JIIA 4P5KB 4HS3B 3T2NL 1WEJH 1CFTB 4ISVA 4FMFA 2X9WA 3IFNL 5GGSB 4WI6A 4JFZH 5DHVB 4ZAKD 5ESAA 4K71C 4YDJB 3W9DA 1LEKA 5JW4Q 1MUJB 3HZKA 3BKML 4NQVA 1NC4A 1A7QH 4DTGH 4OLVL 2CMRH 4GQPH 4TUJB 2QJDA 5SX5H 3RX7A 2AJYL 2HVKB 4RMVA 1B9ZA 4BKLB 4ZMAT 5I2IA 3O4LD 1X5KA 1L0YA 5DVNA 5M94B 5HYQA 4P49A 1FL6A 2BRQA 2E7BA 3UMTA 1DBAH 3MLUH 2W9DL 4LBEB 5GGTH 1B0WA 4PP1C 5ADPH 1PJ9A 4OV5A 3C08H 2VL4A 5FIEA 5IHLB 5TQ2H 4JO2H 1ND0A 3EKCA 3SE4A 1K8IA 1S3KH 2DQFB 2CRZA 3GNMH 1BQLL 5GJTL 4NN6B 3TBYA 4U2ZA 2GTZB 1MFAH 1RU9H 3D39E 3FJTA 3ZL4L 4FFWC 5EO9A 5SX4H 5LG1A 1QFOA 3MRBB 4GBXC 2LAGB 4QXGL 5DRXB 4UNUA 3ULVL 1EVTC 3ZO0A 1ZSDB 3QI9C 1YJDC 3ZE2E 1CFNB 3EFFA 4GMTL 3K4ZA 1AD0A 3FO2B 4JFQA 4HJ0C 3REWA 5FF6A 2BSSB 2FR4B 4X6FA 1GGIH 2FO4B 5DT1L 5I73C 4PLKC 1R3LA 4JFFD 2CLRB 4Z0XB 4JO1H 3TO4B 1BQHA 5I19L 2FX8L 4Y16D 1NCCL 2R0KH 1FZJA 3AS0A 1CFBA 5MEND 4PLJD 4D0DB 4B5EA 3RVTC 4UQ2A 2AK4A 2IANE 4OJFH 1FSKB 5C0FB 4PGEB 1T4KA 1HQ4B 3G5XA 3G6AB 3BDXA 3SE4C 3VFGL 4C54A 4JN2A 2F8VA 3VXOA 1JWMB 5DD6B 5HHME 1FNSH 1UVQB 1GJIA 3O6LH 1EPFA 2MFNA 2P44B 3ARXA 2YC1A 5DVMA 3P77A 5L2JA 1AO7B 4NPYB 5E8PA 2EZ0D 3ARSA 4WTXA 5BQ7B 1Q9LA 4NN5C 2GUOA 2AJUH 3OXRA 3P4OB 4LFHD 2R0LH 5ITBH 5C9JA 4JVPA 1ODAA 1F2XK 1I1CA 3KYNA 4XVSL 5B4MD 5I1EH 4XP4H 1TJHL 4Z76A 1JZ7A 4G6KH 1R3KB 3GSQB 3RWDB 4XMKL 1SM3L 3I3BA 4QTHB 3L1OH 5GSVB 5C0DA 1RY7B 5B22A 3HG1B 5T1KB 1FH5L 3DETC 4GG6B 4OCRL 4JFOA 2V2XB 1GPOL 1IGJA 2HFFB 2XTLA 2MHAA 4V1DA 3MYJB 1OAUH 1FGVH 4HQQH 3UZQA 2BY0A 1WAAE 3Q6GH 1DE4B 1MRCH 4K7FB 1MAML 1KLUA 2N1KA 1HEZA 1AHWB 2IBGA 3CFCH 5FGCE 1KTLB 4WHYH 2ADFL 4AG4H 5INDA 3VH8G 3WCYA 1KFAH 2FJHA 1WTGT 4WRLA 5L2KE 1F6AB 5GZOC 1BFTA 3EOBA 3NZ8A 2Z4QB 4QRPB 4Z77A 4MJID 4LGPB 3WDHA 3QUZD 1F4WL 4K7PL 4NT6A 1IGYB 1CWVA 1R5VB 4U6YA 4CVXB 1ACZA 2X1PA 3MJ9A 1V3MA 3MROA 4LQFH 1U8IB 5HDQL 3MV7D 2VQTA 1R24B 4I2XA 3MRGB 1G7PB 5E8NB 2A9NH 3QDMB 2YR3A 3IDXL 3KYMB 3CFJA 4MNHB 4P3DB 4ZOEA 5AZ2L 2RR3A 1Z9MA 1U8PB 1CDJA 3ARRA 1IGIH 2R2HA 3IFPA 1TNNA 4TULL 1ZLSL 4HS3A 4E5XB 5DA4A 4NQDD 5IIEB 1E6OL 5C07E 1CFTA 2HFEA 2VLME 2W07A 2FEEI 5GGSA 3PV6A 5DHVA 1LQVA 5T1DL 2WZPD 3RAJL 1SEQL 4YGAB 2B2XH 3T0ED 4YIQB 5C2BH 1KB5L 5I1JH 2VE6A 4PRID 4TUJA 2BFVL 5E24E 3E3QA 3BO8B 3FT2B 2CK2A 2HVKA 3DURB 2XY2A 5AAMA 1GOFA 4BKLA 5IMKB 5DMKB 1A1MB 4GQ9L 6FABL 4GW5B 4NO0B 4HAFA 4KU1A 5DO2D 1F4XH 4LBEA 5DK3A 3S34L 1JZ4A 3NFNB 4P2OA 3C8KB 3A67L 3SGDI 5IBUG 3VXSB 1H3UA 4PS4H 4QRSB 3FB7B 3CZJA 4WW1B 5CLWA 2DQFA 4QHLB 1DSFH 2Y23A 2VDLH 3VWKA 4V2CB 1SYSB 4PGDB 4KQ4H 1MJ7H 4XP9H 3ALPA 3ZYJA 1MWAB 2HH0H 3IJYB 3QPQD 1RZJL 4LPYA 1QFPA 1RVFH 5ILTL 3MRBA 4AENB 4PUBL 3BX7C 5DRXA 5LWYL 2A9MH 3NA9L 1AQKH 4OZHE 2BNRA 2FHBA 3WO3B 3IXTB 1CFNA 5D6DA 2DQJL 1KJ2L 2B5IC 3OB0K 2FO4A 5KBNC 4MWFB 3BT2L 2CLRA 4L4VE 4U6HB 4Y4HB 5EU7C 2EIZB 2R8SH 4U0RB 4PJIE 4PD4J 1CN4A 1YJDL 3FN0H 4YHZL 1X7QB 1SY6A 3JSSA 2XI9A 5F96L 1H8SA 4ZG1A 3CIQA 8FABB 2DQCL 4ZS7H 3RVWD 4X98A 1WLHA 4GLRI 1IQDB 5D9SB 5C0FA 4PGEA 3G6AA 3JTTB 3JWDH 4P23B 1DANT 2RBLA 1UH3A 1RK1B 1JWMA 5DD6A 2CIIB 4LPCA 4NN6C 1UVQA 2ZUQB 3V4UL 2QADD 1CGWA 3QUMA 4HUNB 4NBZB 5E2WL 1AO7A 1LE9B 4NPYA 3WJLA 5BQ7A 3QNYB 4X6DE 3N1MC 3CSPA 5JOPD 4KRLB 3P4OA 1JGLH 4OCXL 1QG3A 1CLZL 3IDYB 4KK5D 4DGVH 1R3KA 3RWDA 3ZDZF 4QTHA 2EYRB 1IQWH 4UILH 4HX1A 2YRZA 2W60A 3BKCL 3HG1A 5T1KA 2ICEB 5F9JB 1QRND 3TO4C 3MV9E 1FNAA 4J3XA 4E9LA 4GG6A 2V2XA 4JFED 1D5BB 2HFFA 1UENA 4YX2H 5E2UH 5IM7A 3RWFA 5EZIL 1MCWM 3MYJA 3U7WH 3SDCB 1C12B 4PYHA 2C1OB 4GG8A 4K7FA 2Q86B 4FTVE 3WNKA 4PJBF 3W0WD 3LY6A 1AHWA 3MRRB 1KTLA 2QLVB 3DNKA 5ANME 1T83A 1X6NA 4J3UA 4TVPL 3SDYL 3V9FA 3EDJA 5C08B 1BFOB 3ARZA 5C0AE 1BLNB 1F6AA 2WWMC 3ZDYE 4HS8H 2J4WH 3MRIB 4OFYA 2X05A 1RUQL 3TH2T 2A74B 5HHXH 1UH4A 5I15H 1HIML 2Z4QA 4Q7DA 1UM4L 1JYNA 4QRPA 3QUKB 4WHTB 2F19H 5E9DB 3WJLC 2P8LB 2V9RA 3G9AB 5IEHB 1IGYA 1R5VA 5E00B 4RGOH 3IETB 4CVXA 4TSCH 3B9KA 2NR6C 4IDJL 2X4PB 1U8IA 4LVOB 1KB9K 1R24A 5I74B 4UOW1 1AXIB 1CD9B 1R6VA 3MRGA 3NFSL 4OB5H 5E8NA 1A9BB 3QDMA 3CSGA 4ZS6C 3FQTB 3KYMA 2CR3A 4DUVA 3EZJB 5D7SL 2KPNA 2Q7YB 3NTCH 4MNHA 2EE9A 4P3DA 4I3RH 4XXCA 4FXLA 4W4OA 4PGJA 1U8PA 3CPLB 1FO0H 2HKHH 4E5XA 2P5EE 1HINL 5IIEA 2ZCKL 3HI5H 2X41A 1A22B 1AHWC 4K23H 3ZTNH 1T1XB 3L3DB 4P9HC 2RFXB 4IS6A 1LO3L 3HS0A 4O5LH 3SDDB 3HE7D 4JPWH 2CDFB 2MSPA 2BHUA 1PSKL 5KTEH 1NGPL 1JPFA 2YA1A 5ISZB 3FT2A 1VADB 2EIBA 3DURA 1OGAD 4AY0A 5IMKA 5DMKA 1A1MA 3EIFA 4NO0A 5FGBC 5DUBB 3GSXB 1FAIL 4OKVB 5TQ0L 1XR8B 3CD4A 4GMSH 3S36L 2Z8RA 3NFNA 3C8KA 2PYEB 1EGJH 3VXSA 5EU6A 4CW1B 3PIQB 4QRSA 3FB7A 1CZ8L 4WW1A 4Y5VA 4QHLA 5F8RC 2F5BL 2SEBB 1IEBB 2F58H 3M17B 4XXCC 3TJHC 1SYSA 4W4OC 4PGDA 3RX5A 5CP3A 4KQ3L 3RWCA 3IJYA 3PQYE 3P0GB 5FO7B 5F7EH 3SKOB 4AENA 3O6MH 4RIRB 1SVCP 3BD3A 2B4CC 5F1OB 2WUBL 4GRLB 3CFIC 4U1NA 1P9MA 4LEOA 2VXQL 4U7SA 4BYHA 2BOCB 4MWFA 4U6HA 2V2WB 3BPLB 5BO1L 3V5DB 2EIZA 3UC0H 1DJSA 4MD5B 4BH7B 5JOEA 5L88L 4ELMF 3UX9B 3N1FC 1X7QA 2B1AH 5EZJB 4AIZB 4G8GD 3WV0A 3UJJH 5E70A 2UYLB 3NOIA 1D5IH 1IQDA 1N8ZB 5D9SA 4P46C 5K33A 1A7NH 4Y0GA 5ESQA 3MUZ1 4W6XB 5CKAA 3JTTA 4P23A 3N1PC 1RK1A 3JWOL 3ULSB 2CIIA 1GSMA 3KYKL 1IGFL 3O4OB 1MIML 2UY6A 3BH8B 5F7DB 3KPNB 1BIHA 25C8L 3T2QA 3TWCH 4ZFGL 5TE7H 1N7MH 1LE9A 1FZOB 1BP3B 3LN9A 3QNYA 1GGCH 4W70A 3VE0B 4HWZB 3CFEB 5CS7A 2KQNA 4XAKD 3KR3H 1P9MC 1KCVL 4U2YA 1CTOA 1G9NC 4C56D 2YWYA 3WDIA 2EYRA 5F44A 1UA6L 4NZUL 3VFSB 2FH8A 2A6DA 2ICEA 4WWKD 1F90H 4Y4HC 4U0RC 3EDFA 1D5BA 4NKIH 4KMLB 2A6IB 3HUJF 1O7VA 2XV6B 4UV4H 3SDCA 1C12A 5FYLL 2C1OA 1IAOA 3LAFA 2Q86A 4ZXBB 2W9EH 5DD5H 2D7OA 5DRWB 5ESVA 1IM3B 3MRRA 5F71A 4HUXB 2W65B 3UAJD 2W0LA 1UM5H 4P23C 4X9FA 3KLAB 3L6FB 4O2CB 1BFOA 1BLNA 2ORBH 4OCWH 4KZDL 2ZUQC 3MRIA 3MV8E 4DVBB 2RAMA 4LLQB 4PJXE 2DM3A 3K2MC 3DHMA 3GIVA 3S4SG 3QUKA 4WHTA 4Y19D 5E9DA 5IVXE 2P8LA 1MEXH 5IEHA 5E00A 3STZB 3IETA 1BD2E 3WIIH 4H5SB 3ZSSA 2HG5B 2X4PA 5GRXG 4L4JA 5JXED 3NCYS 1A9BA 1G84A 1V7ML 3FQTA 5D72L 3NACL 4JO4H 2Q7YA 4FZEL 4CN1A 3NIGE 2VXSL 1RHHB 4R7DB 4HWEL 3CPLA 5I0DA 1N2RB 1MCPH 3SDCC 3MMEA 1NCBH 4KTYA 2VLLB 2OYPA 3WS6C 3L3DA 2DTSA 2MQ0A 1LEIB 3KHQA 4X83A 4JG1H 1IGTB 2MCPH 2RFXA 3LMJH 4YDLB 4LLYB 3SDDA 2ESVB 2PR4H 3WFEH 2CDFA 5IGXL 1DUYA 4JRYB 4JFDA 4Z7UF 1N5YL 5ISZA 2RHEA 5KAQG 1VADA 5DD0H 1IAIL 2HFGL 3KDMA 4G3YL 1S9VA 1F58L 4X8XA 5DUBA 3GO1H 3GSXA 4OKVA 1HXMB 1TIUA 4P9HL 1J7VR 3FHAA 1JF6A 3MLXL 1JIBA 4GLRH 1XR8A 3UC0L 2NXYD 5LJYH 1J0JA 4LVOC 3SE8H 5KVFL 4KHXL 5HHOD 5DMIL 3EYUH 1FL5B 4NJ9H 2G60L 2VSCA 1EEQA 4JN1H 4WI8A 3VFTB 3PIQA 1C08B 5CMAB 3RGVC 1WIUA 3KPLA 1CE1H 4IRSA 2XIDA 4YEEA 4BELD 3GHBL 2VLRD 4PP1D 1A6WH 2SEBA 1IEBA 2HN7B 1BBDH 1MCSA 1Q0XH 3M17A 3UO1L 4AQOA 4CGTA 3WEXB 3OL2A 4M7JH 3TH4T 5CJQL 4PJGF 4WHYG 5FO7A 3SKOA 2EO1A 4R4BB 3Q5TA 4RIRA 5DR5H 3CFKB 3SDDC 1RUAL 3N85L 4KTDH 4YC2B 4NQSB 5I8CB 2R2CA 3AY4C 3BMVA 4FFWD 3ARBC 2Q3ZA 4IM8A 3NAAL 1KEGL 1WGOA 4OZHF 1F45A 3BW9B 5F7FA 1FG9C 1IRAY 2BOCA 3IU4H 1XR9B 3N06B 4AEHH 5E1HB 4EUPB 5D1XB 5GSRB 4HJ0D 1UWGH 1VEPA 2DD8H 2NMSA 1PG7W 4MD5A 2BRRH 5HGBB 4PLKD 5KOMC 2NYYC 2YBRA 3UZVB 4AT6B 1BZQK 1QLFB 2UYLA 4N9OB 4TQEL 1N8ZA 4UTBL 1GIGH 1P5VA 1E6JH 1FIGL 1FFRA 4S1QH 2RJMA 1G9EA 3WXWL 4XP1L 4X5WA 3Q1SH 4JG0L 5F7DA 3KPNA 2M1KA 4MAUH 4JPVH 2L7JA 3TPKA 4XHJD 3GJFH 1UACL 3DUHA 2HP4A 5HI3C 4ODTL 3VE0A 1OWWA 1IKFH 4HWZA 1GGYA 5F1KC 4BZYA 1M7DB 3HKFA 5IFHH 4GRLC 2IH3B 4PJFF 1KPUB 2M26A 3UTTD 2K7PA 3VRJB 2V5SA 4BH8B 4MJ4A 2EXYC 1NCAL 2GQHA 3EOTL 1S7TA 1MWAL 4WTZG 4FP8H 3ULVF 3BPLC 3I3EA 1BM3H 5DJAB 2A6IA 3WE6A 4AK1A 1U8OB 3Q3GB 3QO1B 3ZKQD 2X9YA 3MV11 4ZXBA 5DRWA 3SGJA 1IM3A 1I9IH 4CKVX 4Y2OA 4HUXA 4HT1H 2EEAA 1IARB 3OAYK 3UTSE 1J8HD 3U0PB 4UDUB 3KLAA 4O2CA 2AK4D 1NGQL 3O4OC 2W1NA 4DVBA 4OLXL 4LLQA 4QO1A 3ZT5A 4MJ2A 1NPUA 2XG4A 2QKIB 3EZ8A 5SV3A 1FNLA 1AGEA 1JTTA 1DUZB 3MRLB 3IAPA 4H5SA 5TPWL 1NKRA 1UB6B 1EXUB 4M93B 2V17H 1YEGL 2DQTL 4ODVL 5E03A 35C8H 2NY6D 2EC8A 5C09E 5D7KE 1L0QA 4LRNH 3QFJE 1BGXH 4U1KA 2VDML 1WWCA 5TFSH 4FFVC 1NJ9B 1RHHA 4R7DA 1JPTH 4MMZC 3REVA 2AEPH 1XGPB 3EJJX 3WJJC 2VLLA 4ZXBC 3SGJC 3HNSL 3DX9A 3IVKB 1LEIA 5CJOH 1IGTA 2Y5TA 1CGYA 4RMSA 2ESVA 5CGTA 4BSJA 2FHFA 1N6QL 4N1CA 3RUGE 4JRYA 1CGUA 2XKNB 1I9JH 2H6PB 4AL8L 3DBXA 3A6CL 5GIRB 4WFHE 1HWHB 5IROA 5FYKL 3MNVA 3VFMB 3MCG1 5HDBF 2J8UE 1HXMA 4PRDB 4XCNB 4MLSA 1XZ0B 5J3HD 3EFDL 4M03A 4OFVA 4RRPG 5CBEA 3IKCA 3VXPB 4LSQL 1UM6H 1FL5A 3BDYL 3FFCE 3QRFM 3VFTA 1C08A 3FRUA 3MOQA 4MDIB 3VFRB 1YNLL 4FQCL 1MCLA 3WEXA 1FN4B 3CVHL 3RZCB 3QEQE 4HUUB 2OJEB 3K1KC 3IDMB 4Z5RB 1S78C 4ZNEA 4N8VB 4DN4H 4JR9H 4CVWA 3TESA 5LQBL 5DMGC 3CFKA 1BQUA 1R5IB 4YDLC 5BV7H 1F6FB 5JHLL 4YDIL 4KMTH 1L0XA 2J6EA 3L5JA 4ELKB 4DKAA 3KYOB 3QIBA 5F93C 5KVEL 1AFVL 3BW9A 4TRPL 3U30B 5IROC 2HT2C 1XR9A 5F7MC 2UY7A 1ZHNB 2DAVA 2J8OA 4EUPA 5D1XA 3LZFH 5GSRA 4LVNB 3I2CH 3AUVA 2QHLA 5HGBA 5TF0A 3RTQB 4PDCE 5B3JF 4YXLH 3AAZB 4QHMB 5D70H 3AS2A 5I8KL 4HLJA 4N8CH 1MCEA 2VAAB 5C0BD 4YZFE 2J12B 1LK2B 1JNLL 1KB9J 1RK0B 4P2OD 3DGGA 2X4UB 4K8RD 1NDMB 2YZ1A 5LVEA 5EBGA 3F7VB 5CJBA 2Q8BL 5H37H 5DZOA 1DQML 1YYML 3P3YA 3V6OE 2ZZUT 1B4JH 3HC3L 3O2VH 2MPAL 4NRXB 4N9GB 3WFDL 3VWKD 1EAJA 2ZCHL 1G6RH 2GITB 1M7DA 4L5FL 4FMKA 1BFVL 4YC2C 2H9GA 2GEEA 3JTCA 4U1SB 2IH3A 1AGDB 3VRJA 4BH8A 3IAQA 1OL0A 4K9EC 1UEMA 4GW4B 4TTDC 2BNRD 2Z93B 1PY4A 35C8L 3HPLB 1U8NB 2Y72A 3G08B 4NJAH 5D1XC 5DJAA 2YUWA 1HXYB 2LQRA 1ZT4B 1INEL 4PG9B 3Q3GA 3QO1A 4E41B 2XZCL 3HMWL 1TZHB 3PGCB 1LWRA 3S3JA 3B9VA 3M8OL 1Z3GH 3DTXA 5D7JB 1ZAGA 2WBKA 4P9MH 1CR9H 3O9WB 4XPTL 1T04B 1A3RH 3U0PA 4UDUA 3GSUB 1EX0A 3ULUC 5T3XD 1BJ1H 1T1YA 1M7XA 3SDAA 3NH7L 5AYQA 4L4TE 1H3WM 3QCTL 1HH6B 2DQUH 5J11C 2QKIA 4OD3H 5IHBA 1C5DB 4M7ZB 2Y07H 1JL8A 2AABL 2AJZA 3MRLA 4QCIB 2FLRT 1NMAL 5F7UA 1UB6A 3FAWA 4I48B 3PGDB 1EXUA 3S6CA 1GHFL 4JRXA 5IVXF 1AO7D 2VKXA 1A1OA 1X5LA 3OPZL 1INDH 2NXZB 2Z8WC 4OZIE 3S35X 3LEXB 2JCCE 2VKWA 5I1DB 5I1HH 2CGRL 2WBJA 1E28B 3V0VB 3O4LE 2QV2A 1RMFH 3WHXB 4G9DB 4MA7L 1NJ9A 1V7NH 4NHCH 1A6PA 5DDHA 2BNUB 1XGPA 3HG1D 5T1KD 3RJQB 1BJMA 4XTRD 1VA9A 4OGXL 5ACMA 3IVKA 4EBQH 1N59B 3HI6H 5IW6A 1EEUA 3PGFL 3GHEL 2XKNA 2APWA 3T65A 3IXAB 4E42B 4Q9RH 3DRQB 5GIRA 4H20L 5MEQB 2YD9A 5MP6L 3VFMA 2R39A 3GSNB 5CP7A 2DBJA 1C1EL 4JZOB 1EHAA 4OFYD 4PJDB 4XCNA 1XZ0A 1AC6A 1GAFH 4M93C 4JRWA 3VXPA 3K0WA 4UT6L 1CLOL 3FHQA 4L3ED 2YD6A 1A0QL 3B9KD 2BVEA 4ZD3L 1QBMH 1RIUL 5GHWH 4JFFE 3DX7B 3GRWL 4R8WL 4TUOA 4KI5E 4HUUA 3EYSH 3QDMD 5A40E 2OJEA 3V4PH 3IDMA 3U9PH 2C1PB 3O6FB 2PTVA 4Z5RA 1EERB 5MENE 1CDIA 4KRMB 2DLFH 1QBAA 4N8VA 3Q0HA 3G9VA 4RWHA 4PJAE 1R5IA 4LEXL 1RV6X 4G6FD 4ELKA 4KVNH 4OLWH 5C6WH 1I1AB 3FN3A 4KZEL 1HQRB 3ARGB 3MRNA 1GZPB 1ZHNA 5DXWA 4H1LB 3BQUA 4TNWK 2FATH 4LU5L 4L8SB 1JTOA 2R1WB 3RVUC 4WUKL 3KNBB 3VGHA 3RTQA 1OAYH 3HZVB 3AAZA 4QHMA 3IGAA 5SWQB 3N0PB 1PD6A 3QDJA 4KY1L 2V2TA 2VAAA 2C4XA 1U8HB 4L3CB 1RK0A 1NGYB 4C59B 1NDMA 1P7QA 4RX4A 3S37H 4R6UA 5EU6D 3VXSD 3F7VA 4F15B 1VHPA 3RZCC 3D1MC 1HZHH 5HYSG 4HXBL 1JTPA 1QRKA 4NRXA 1N0XH 4NM8L 1ETZA 5DLMH 2GITA 1T20B 3HNVH 2EDWA 1S7RB 4U1SA 1UCBL 3GBNH 5D1ZB 5ICYA 1P4IH 4JHWH 4UQ3A 5C3TA 1AGDA 3O45B 4X6EA 5KSAB 1H8OA 3U30C 4GW4A 1MIEH 3HPLA 4J2XA 4ENED 1U8NA 2HKFH 1GXEA 3G08A 3LB6C 1QSFE 4LVNC 1HXYA 4MJIE 4DGYL 1ZT4A 5I1GL 5I1HL 1KCLA 4PG9A 3RTQC 1WBZB 2GCYB 2OCFD 4E41A 1ED3A 4AEIH 3PGCA 3N50A 1YEEH 2IC2A 2O5XH 5D7JA 4WCYH 3O9WA 1T04A 3KPSE 3GSUA 4HCRH 5CGMA 2M2DA 1AGFB 1DBKL 4ORZC 2IFGA 1ZANH 1H3VA 4NKMB 4XP6H 3AXLB 3VXNB 5EWIH 2FIKB 1NAKL 1HH6A 4JKPL 4P23D 4NQDE 2X1OA 2D9CA 3MBXL 1JP5A 4QCIA 3FO1B 3I6LE 1A7PH 1MCIA 3ARDB 4NZRL 1WWBX 4I48A 2UWEE 3PGDA 4NRYB 3RP1A 1TQCB 1G7IB 3D48R 1KF9B 3QQ3A 5EOQH 4LFHG 3RIFK 3OJMB 3MRJA 5I1DA 1PY9A 3UDWA 4YHIB 3V0VA 1E28A 2AI0L 3E8UH 3RA7L 4G9DA 3SKMB 3WHXA 5T3ZD 1TTGA 4ONGH 5KG9A 3D0LB 3PP4H 2P8PB 3MLVL 4HIEB 1FBIL 5CGYD 4WUUB 5FDWB 2BNUA 1SEBB 4UTAL 5I8OH 4F7EB 4GSDL 5D7JC 2R4SL 1N59A 3O9WC 4R96A 5J57B 3GBMH 3EDEA 2A1WL 1WK0A 3MRDB 1F6LL 5DS8B 3FONB 3IXAA 4E42A 3DRQA 5EO0B 3BIAX 5SWZA 5MEQA 5EIQA 4GAYA 2YWZA 2HVJB 2FECI 1HHHB 1T3FB 1KOAA 3GSNA 4M7ZC 4A6YL 5IB3B 4GJTB 4JZOA 3RZWA 4PJDA 4HIJB 1F4HA 2CKBL 1HI6A 5E9DD 5DGRA 2NXZC 5D96B 1H3PL 1MFCH 1TNMA 4XAWH 3MOAH 3UDWC 4M6AA 5FGSA 2ZCLL 4EZMA 5IR1B 3NFPB 1DL7H 2VDPH 3AROA 5E6YA 2AXHA 1TQBB 5C0CD 1MCJA 3RJDA 1AH1A 1KXTB 2R0ZH 2C1PA 3O6FA 3WNMA 1L9NA 2R4RH 2XWJB 1K6QL 1KNOB 2HYMA 4G6JH 1YEIH 4O4YL 4QRRB 3AM8A 1G1YA 3WDJA 3BN9C 4Q0XH 3MA9H 1XCQB 2VQUA 1HQRA 3ARGA 4U1IB 3MJ8B 3SDDD 3VG0L 1K5NB 4GKOA 4H1LA 4N5UA 5E2TL 4JFDD 1HILB 4L8SA 5ISZD 3GM8A 2R1WA 4NZJA 2GK2A 3DHJA 5HGAB 3HZVA 2EDFA 5SWQA 1W72B 4KK8C 4GRWF 3GI8L 3NN8B 4LHUB 5CWSB 2UUDH 4L3CA 2MQCA 3C6LB 3NCYP 1NAMB 2BY1A 4C83B 1NGYA 4XVTL 1QRNE 1EEYB 5D8JL 4OM1H 5DQJB 3BVNA 1Q1JL 1H9VA 3VXTA 4IRSD 2X4QB 3O6FC 5FO9B 2CDGB 3L7FB 3WL9B 1HK6A 1B4RA 5L8JB 1MCQA 4PJEE 3BP5B 4HJJH 3W11C 3Q5YA 3PWUB 3W0WE 1DZBA 1J11A 2JB5H 4U7MA 3QXDA 4DW2H 3UYRH 3JV6B 5D1ZA 1J87A 3VD7A 1I1AC 3O45A 5KSAA 4K07A 3SKJL 5C92A 5SX5K 5CJ8A 3ARGC 2F5AL 1UEYA 3RGHA 3PWLA 2ADJB 4L8SC 4LGSB 1WBZA 3RBGA 4XCCL 2GCYA 1KENH 4F58L 4M8QB 4D9QD 2W38A 5GRVK 4XNYL 1BEYH 3IT8D 5HVHC 1NBZB 4ALAH 4U33A 4MS8C 3WXVH 4MXWH 1Y0LB 5D2LE 1FDLH 1AY1L 1AGFA 1MCCA 4Q9QL 1TVHB 4NKMA 4IJ3B 1MJUL 2FIKA 1JGDB 2DRUA 1H3TA 1KEML 3QQ9D 2ICWJ 1GH7A 3FO1A 3J8F7 3ARDA 5MEPB 3E2HB 5H2BB 3NA4A 4NRYA 1G7IA 5D1ZC 1JV5B 3TT1H 4BQBA 4DQOL 2R2EB 5KSAC 3F7YB 3IKKA 3LIZL 3TIDB 3LRGA 5IB1A 1OGAE 1AE6H 4YHIA 4MLIA 4YJZL 4JE4B 3SKMA 1QFWI 3MUGB 3SOBH 3ZHKA 1YEHL 3D0LA 2P8PA 4HIEA 4JM4H 3MJ9H 3B3IB 5FDWA 4NM4L 1SEBA 1PQZA 3MV01 4LCIH 1CLCA 3ET9F 1CK0L 4X9GA 1PLGL 1KSRA 2ZWLT 5E0QA 5AZEL 3WN5C 4HFWB 3THMH 4QGTA 3MLRH 2PYFB 2OSLB 2HTLC 3MRDA 4ZXBD 3QQ4B 5DS8A 4H25B 4JM2F 3FONA 1DR9A 5EO0A 4X4XA 3G6JB 1JWUA 3NZHH 3GSWB 2HVJA 3U4BH 4HEPG 4CMHB 1HHHA 1T3FA 1HHKB 2OBGA 5IB3A 1BQSA 1RZ8B 2OK0L 4P3CH 5DHVH 5FK9B 3ARDC 4M7LL 3HB3D 1Q0YL 2W0FB 4PP8C 2BVTA 1TQCC 3DOSA 4WJ5B 8CGTA 5DFTA 1LP9E 5FYJU 4H8WH 3SDXF 1H3XA 5BVPH 2PTTB 4Y7MA 4S10A 1J10A 5B8CB 5IR1A 3NFPA 5DSCB 1LO2L 4HUKB 2HT3C 4FOMA 5EIVA 4M48H 4Q58C 3HHRB 3MACH 4G8GE 4BSWB 3ABZA 4QRRA 2DQHL 2GTWB 4FQ1H 3NIFF 1CG9A 5GISH 1S78D 3DARA 1NFDF 1XCQA 1ZE3C 3T3PE 5I66B 4O00A 4OIBA 2QHRH 3OHXB 5DMGD 4YUEL 1MJ8L 1YNKL 1CGSL 3K2UH 2EC9U 3MJ8A 4U1IA 1JNJA 1A6VL 1JK8B 1QSEB 5IMLA 3WUWB 3L95B 3QR2A 4JRYD 5D7IB 5J56B 1HILA 2EH8L 2R23A 5HGAA 2HT2D 4XAKE 4NKQB 4K3EH 1OAQL 3LS4L 1W72A 3BP7B 4G9FB 4F9PA 3UP1A 3OX8A 3NN8A 5CINH 3WIFB 4C56E 4B7LA 2OTWB 1KN4H 4NFBA 5CWSA 3MLYL 2B8OT 4HUMB 1IMHC 4LSPH 1NAMA 4C83A 4V2BA 1FIEA 2WUCH 3LS5H 1TQBC 1WUNT 4PY8I 3U48A 3BPCA 5GRJH 4FRWA 5DQJA 1JN6B 2VDNH 4HC1L 1DFBH 2DS4A 3D9AH 4OF5A 5FO9A 2CDGA 3L7FA 3WL9A 1SY6H 4YHPB 3BP5A 5T3XH 4QHNB 3PWUA 4KJWC 1VEMA 1R0AL 3MLWH 5GRWA 3TF7A 3NCJL 2VRAA 2VDKH 4FABL 1T22A 4OGAD 3QUMH 4X6CF 5K9QI 2EH7H 4LMQI 5E99H 2ADJA 3I6GB 1AJ7H 4Y19E 3SQOL 3QIBD 4NWTL 1U8MA 3H9ZA 5DA0B 5BXFB 4OCSH 4NNPH 3G6DH 4WU5B 3VGFA 5F21B 3BEVB 4M8QA 4F9PC 4X7DC 3H9SB 5D1XD 4OZGE 1ADQL 4PJHE 3FB6B 1NBZA 5IESH 3C6LC 4OD1H 2VLKB 4M3JA 1Y0LA 4HFUL 4LCYB 1MHCA 4DCQB 1KCKA 1TVHA 4YQXL 4FFYH 4NZDA 1IC4H 1JGDA 4NQUA 4NCC2 4JHAH 3ULUD 5CEXB 4CU8A 2VXUL 5ICZB 3E2HA 5EUOF 4WI7A 3TF7C 5H2BA 3ES6B 4OLZH 1JV5A 1WIOA 2DQGH 4NOBA 2R2EA 1XAUA 5DK0B 3F7YA 3TIDA 1MCRA 5B39G 1F4YL 3QXVA 3MRQB 3PP3H 4PJ5B 4S1RL 3FAXA 5ALBL 3HAEG 4NGHH 5DJ2B 2YD5A 3B3IA 4OIIH 5HHOE 1FE8L 3QIUB 1A7RL 1GGUA 1LO4L 2GW5A 2B7DT 5EA0L 4K8RL 1MY5A 1S5IL 4HFWA 4FQLH 2I9LB 1BZ9B 1FHGA 2PYFA 2OSLA 2VLRE 3QQ4A 4H25A 5GRYA 3BE1L 2PO6B 3KLSA 3IJHA 4IJ3C 3L3KB 3B9AA 3A6BL 3GSWA 2ATKB 3G5YB 3AVEA 5E8DH 4D9LL 3SDAD 2DIJA 3T08A 2WAHA 2DIAA 4O2EA 5FK9A 4FQPA 3ZKND 4TOYH 3U9UB 1J18A 2B4CH 3BSZH 2NNAB 3E2HC 1IM9B 2W0FA 4X9HA 1ZV5A 1A21A 1K4CB 1N4XH 3ZDXF 4QNPF 2O5YL 1BFSA 4KGLA 3KGRA 4JRXD 3C2AL 3QG7L 5B8CA 5ICXB 1MELA 5DSCA 2DMCA 1D6EB 5DZNA 1IEAB 3TYGL 4YH6A 2XFXA 1CU4H 1I7TB 5BCAA 2WBJD 4HMEA 3B5GA 4DVRH 4BSWA 4ONFH 4QT5B 3MGTB 1EV2E 3GUTB 3TT3H 4Y4FB 4R7NA 4UV7L 3RVVD 1PG7X 3DWTA 3ZHLA 5I66A 4NQXB 3RX8A 2WMPA 3AB0B 1U8QB 4KK9C 2XQYG 3OHXA 3BIBX 5CP3H 1JK8A 4X7SH 1QSEA 4TSAL 4CMHC 4MA3B 5D7IA 4MZ2A 4P5TB 3F8UB 1KTRL 1KYOK 2IMNA 2E8YA 1FZKB 1YQVH 4Q6IA 1Z9LA 4F57L 3BP7A 4G9FA 5DEZA 1G9NH 3CX5K 1MVFA 2OTWA 3DUUB 4N0YH 3ZMRA 4IOSD 5B8CC 1J0IA 3Q6FB 4X6BB 4YDVB 3TBTB 5DJ8B 1JN6A 5FOJA 2IBBA 4GAFB 2FECL 2YD1A 3S5LG 1ZGLB 3T0XA 4WY7L 1DDHB 3A0OA 3MRPB 5EU4B 4QHNA 5KVDH 1IC7L 1RUMH 5IV2B 4K2UH 5IQ7L 4PJEF 1DQLH 1MVUB 4G80B 3D5OF 3T3ME 5FCSH 4U49A 4QXUH 1QFWH 2AK4E 3OAUL 1V5JA 2NY5H 1QR4A 3CLEL 4X80H 3QHTC 4KGJA 1U8LA 4HDIB 5FA4B 5C2UB 5L9DH 4X7TB 3MGOB 3FCTB 5LCVH 1QFHA 4KKCD 3QHFL 5DTFB 4WU5A 2OI9A 4MXVE 3BEVA 1DBJL 3BQUD 2B1HH 4JY4B 5T3ZH 3MODH 3ARPA 3FB6A 1TITA 4PBXA 5CHNB 1T89A 1R3IL 2VLKA 3RTQD 2OZ4A 1A7OL 1CCZA 1O7SA 2QSTA 1IZKA 1I7UB 3QDJD 1QUNA 1TXKA 5F97E 1OTSC 2CLZB 2VAJA 5BOPA 1RD6A 3SE9L 1U8KB 1IGMH 5F70A 1B3JA 1J1PL 1P7QD 4RX4D 4U1HB 4WGVB 5CEXA 1UYWL 3PG2A 5ICZA 4V1DE 3ES6A 1FLRH 2X4SB 3UBXI 3WIHL 2WINB 1NMBL 3T0BA 2GJJA 1RPQA 3T1FB 5J6HB 1MFEH 3MRQA 3MFGB 3HR5B 5F9OH 1FVCB 4PJ5A 4NQCB 1UWEH 4BZ2H 4AIOA 3HLAB 4OCMC 4Z7OF 5DJ2A 4I18B 1J5OH 1RZ7L 1PBYA 3QULB 5CJXA 3DVFA 1JRHL 4PRHB 5IMOB 5J7CC 1BQHG 2AK1L 3LRHA 4JJHA 5F9WB 1T89C 3SE3C 2K7QA 3GBLA 2I9LA 5HHVL 1PAMA 1BZ9A 4E41D 1BZ7B 1U2HA 5TE4H 3WO4B 4JAMB 5T1MB 5IBLC 3QG6B 4PB0H 1VENA 4I2XE 1LNUB 5EOCJ 2Q87A 1FNFA 5D7JD 1WWAX 3L3KA 4M1GL 5HBBA 3O9WD 3TJEH 3LKSB 5C0RH 2ATKA 3P0YH 2Y5EA 4OV6F 4XMPH 15C8H 4Z95H 4XHQA 5EOTA 4KJQC 5DQ9B 5IEKB 2NNAA 3J7HA 5EBWB 1IM9A 1RUKL 3P9MA 2BCKA 3SHSA 3EO9L 1S7SB 1S9YA 3PWPA 1K4CA 3QWRA 2VQ1A 1A5FL 2JIXA 5F3BB 1I9EA 2KQMA 4ODSH 1OARL 5ICXA 4X99B 1D6EA 2BVQB 1IEAA 2F54B 3PWJB 2IGFH 2MTPA 3E3QE 3EDDA 1S7UB 5GRUL 4Z7QF 1I7TA 1J8KA 1VFBA 4PFEA 4U6XB 1OSPH 4NC1E 4FQIL 3QIUC 4PV8B 5CJXC 3HR6A 1XIWB 5EU7E 1XF1A 4QT5A 2NZIA 3MGTA 4JFYB 4Y4FA 3O11B 1SJVA 1KBGL 4HAGA 5F6IC 4L3AA 2Y9RT 4NQXA 1U8QA 2PO6C 1N64L 4MSWB 4B50A 3FT4A 3KXFB 3GIZL 4MA3A 5I1LB 2V7NB 5AYUL 1F8TH 3SEPA 2O26U 1N5AB 4EQ2A 5SWZD 4WEBL 2QSCL 5DUPH 5H94B 2XY1A 1FZKA 4CU6A 5DHYB 3PL6B 4RZCB 4XVJH 5JTWA 1TPXC 5D1QB 1I8IA 5I30L 3DUUA 4KJYB 1IT9H 4XC3H 2BNRE 3DX8B 3INUL 3Q6FA 4OLYL 2LVEA 1FG2B 4X6BA 1RUPH 2NLJB 4YDVA 3QIWB 1ORQB 4UU9B 3TBTA 3WFCH 1GGBH 2EICA 1N6VA 1OGTA 1BX2B 2VXVH 4D3CL 4YHLL 1ZGLA 4DFHA 4BFBD 1DDHA 1ZMYA 3MRPA 5EU4A 5IV2A 4NWUH 4EDWH 4P57B 5HHMD 4Y4FC 3O6FD 1MVUA 2LTQB 3WKMH 3CU1A 3IFLL 5T3XE 2B0SL 2VZOA 1MRFL 3W11D 3W39A 1YEKH 2BVOA 3QUXA 5BW7C 3QEUB 2AP2A 2EDTA 2JJUA 3NABH 5FA4A 4X7TA 3ZTJH 2VXTL 4LCUB 4P5TC 1JHKH 3FCTA 1I8MB 2HA1A 2YPKB 5DTFA 3ARGD 1DLFL 4OD2B 5A3ID 3GK8H 1AO7E 1MFDH 4JY4A 5E2VH 3UXFA 4DKFH 3ARWA 2FSEB 5CHNA 4J4PA 2UZIL 5TE6H 5A2IH 1UKTA 2D4FA 4PJHF 1I7UA 3PXJA 5C0GB 3L5XH 1MFNA 2FO1A 2Z0BA 1AIFB 2CLZA 3QDHA 3HMXL 1ACYH 3HG1E 4LARL 4GG6E 4R26H 7FABH 4U1HA 5C3LD 3V0AC 1YY9C 3O8XA 3LKQA 4OLUL 5L2KD 2H1PH 4OQTA 4KPHL 5KVMC 3U0WH 5INCA 1CD8A 1LK3L 3QDGB 1G7MB 4XPBH 2WINA 4PJBB 3DSFH 3T1FA 1T21B 1F13A 3WD5H 5A2JH 3HR5A 1FVCA 1EFXB 1KJMB 5D1ZD 1G7QB 1VPOH 4YEFA 1AXSB 3CCHB 3HLAA 4G42A 2VDRH 4I18A 1Z9OA 2D7QA 4JQIH 3SKUD 3QULA 4OKDA 4QRPE 4PRHA 2XQBL 4NO3B 5IMOA 1MQ8A 3B2VH 4YXHL 2XRAH 4J4PC 3SY0B 3QCVH 3U2SB 1BZ7A 1RFDL 4JAMA 5T1MA 3GMNB 3QG6A 4X4ZA 4LCWB 1LNUA 5F9DC 4PGCA 4MJ5B 3QDME 1IVLA 2FB4L 3GJFK 2N56A 2C7UB 3ZLQC 4MDJB 1JGUL 4GS7B 5EBWA 4WV1A 2K9UA 1UZ8B 4Z6AT 3W2DH 4I13B 4HIIB 3C60B 1IKNA 1NDGA 3S35H 5F3BA 5TDNB 4UUJA 2LVCA 3L7EB 2EDXA 3DMMA 4X99A 1T5WB 2F54A 1NQBA 1M71B 4I18C 1S7UA 1NGXB 3D6GA 1Z0NA 4WHDA 4Z8FL 3QXUA 4U6XA 1ONQB 1YN7B 4PV8A 1XIWA 3M1BB 1KULA 1U92B 1OWRM 4JFYA 4XWOD 3TCLB 4M5YH 5F9WC 5C0IA 5CILL 1KJ3L 2OX5A 1E4WH 2ZUYA 3O11A 1VFMA 5CJ5A 3X3FH 3WO4C 5E2JA 1MHPL 1CDYA 1EMTH 3UJIH 4Z0BL 3VXSE 5EU6E 4MSWA 3I9GL 4LLWB 1PGRB 3KXFA 2CSPA 1P4BL 5FM8A 5GJSH 4KVCL 12E8L 2FDBP 5I1LA 1KXQE 3MXVH 4JHBA 4BQ9A 2V7NA 1OB1B 3OR7A 1N5AA 5L0QC 5H94A 1RZFL 1D6VL 5HYJB 3PL6A 5I1KL 2J6EH 4RZCA 3O41B 2ADGB 1IKNC 4U6VH 5JUEH 5D1QA 4PB9L 1CXEA 2OR9L 3ZE0F 4K9EH 4KTEH 4KJYA 3LKRA 3RNQB 3H9YA 4XP5L 2XTJB 5IJKC 3DX8A 3IRZA 3TPUB 1MQKH 3KPMB 1X44A 1OAXH 4FFZL 4EUPH 2HRPL 1FG2A 2NLJA 3QIWA 1ORQA 3HCVB 4UU9A 2A6JB 3BP4B 5HI5C 1JGVH 3HZMB 3VH8B 4OBSA 1OAKH 1NMCB 5DUML 1BX2A 4EN3D 1XIWC 4YBQD 4LLVB 4QHUB 2JJVA 3BJ91 2AEIT 4P57A 4PRAB 4G5ZH 2AXJA 3TBVB 3QT2A 4ELMB 3ULUH 2VN4A 4LHQB 4BFIB 4G6AC 1X5JA 4QRRD 2WANA 3QEUA 5E5RB 3QWOB 2DTMH 3T3MF 3OXSB 4H0GA 4P59H 3PABB 1KN2H 3JBG7 1I8MA 3WBDA 4N0CA 4UT7H 4U1GB 2H32B 4OD2A 4L9LB 4CN6A 5T33H 3PL6C 3OAZH 2NY1D 3LQMA 1KCUL 2QBWA 5D1QC 2FSEA 5FOBB 2AKRB 3FN9A 4AMKL 1YPZF 3FQUB 3DLQR 4D9RD 3B2VL 1CFVH 4XCYB 3QIWC 5T3ZE 3NCBB 5F1NB 3CMOL 4O9HH 1AIFA 4FTVD 3T0VA 2JLLA 5LBSL 1S5HB 5CSGA 3S96B 3VWJC 4X7FC 5D2NB 3NIDF 2XA8L 4U05A 1AI1L 2LTQC 3HUJB 1YYLH 3QDGA 2E7LC 1G7MA 1DQDH 3U46B 5CD5D 4N5EA 4ETQB 4BQ8A 1SJXA 2MMXA 3AC0A 3LD8B 4PJBA 4M62L 1ZLWH 4EEEA 1T21A 3PJSB 4LPUA 5GPRA 3OGCA 1EFXA 1KJMA 1JZ3A 1G7QA 1CICB 1AXSA 1QHPA 3C6SB 3CCHA 3F65A 1YY8B 3JVGC 4OM0L 2L4OA 3R8QA 4M1DH 5F6HI 5E9DE 1P7HL 2A73A 4NO3A 3GI9L 4ODUB 3H2WA 2QQNL 5TF1L 3SY0A 1KYOJ 3BJLA 3X11B 4HH8A 3U2SA 3VI3E 4LCWA 2P5ED 2R0WL 1QBBA 3TH3T 3NCCB 4LIQL 1JE6A 5I1CL 5JPMB 3IAGC 1KLGB 2DIBA 3PE9A 2C7UA 2DI7A 2J5LB 1OTUC 4MDJA 4B53A 1QFUH 4KI1A 4ZUTB 5ADOH 1C5CL 4RGMB 1OAZL 2FX7H 4WDIB 1JPSH 4YBLB 4HIIA 3C60A 5D5MF 2XA3A 1QNZL 1JZ8A 4YGVB 2GIYA 3EJYD 3KHOA 2XZQL 3C5ZB 4WFFD 4XBGA 4JFDE 1RULL 1U6AL 1M71A 1KACB 4XNXL 5BZWB 3SGEI 2YPLB 5ISZE 1NGXA 4CUCA 4Z7UB 3O2WH 4CNIB 4RISH 3DVNB 1PEZA 1YN7A 2ENYA 1NBVL 4LSTL 1U92A 3L3GB 4HKJB 4R4FL 3TCLA 3KJ4B 1BMGA 3VRLE 4YPJA 5HDOA 3OKDB 3FZUD 4ODHH 1OM3H 3WYRA 2AJVL 3WNNA 4LLWA 3IB4A 2NY7L 4AQ1B 1ZTXL 1MHEB 4LMQE 3P11L 1OB1A 4KK9D 2J88H 5HD8C 4GS7C 1LVEA 4KRPD 1QR1B 3D3VB 5HYJA 1YEDA 4AM0B 4ZYKB 1X3DA 2ADGA 3C60C 1JHLL 5DQDL 4PJGB 5CEZD 4LLMB 3FT3B 1BF8A 3RNQA 3S98A 1SBBA 4KKAC 1EHLL 4OF7A 3TPUA 5JMOC 4XH2B 3P4MB 4JREB 5JXAL 4EOWH 4O2FB 3HCVA 2BHZA 2L7UA 5D71L 3BP4A 4EI6B 2AJXH 2ZOLB 3HZMA 4OFKA 2ZUTA 2NZ9D 2Z9TA 2NY2D 1I3GH 4I0PA 3U4EB 4OZHB 1B0GB 1P84K 5F9AC 2X40A 4JDTL 4M4PA 3LQAH 4D9QE 3ZT6A 4QHUA 1MREL 2FYYB 4RWYL 4PRAA 5IT2L 5HI4C 4XI5D 1D9KB 3TBVA 4ELMA 4L4VB 3KJ6L 5FECA 2G75B 2BJML 1YEJH 4BFIA 1MFBH 1V3KA 1TJIL 2NY4D 4IRZL 3QWOA 3P0VL 3OXSA 1XF2B 1I8KB 1N6UA 1Z6JT 4OUUB 1YMHB 3QEGL 3V6FB 2H32A 3TFKA 4L9LA 3LH2H 3T04D 5DD1L 2VDOH 4FQJH 2X70B 2YK1H 4NKDB 5FGRA 1ZT7B 3P4LA 4WENB 4TUKH 5AEAA 2AKRA 4XPHH 3FQUA 2XTJC 1S7XB 2EDQA 3O3DB 3MRFA 4YPGB 5DI8B 3TV3L 5LGHL 4XCYA 3DO7B 1YUHB 5F1NA 4PREB 4PJFB 4HIHB 4OF6A 1K9TA 1B2WL 1NMCC 4HWBA 5DWUL 3GSOB 1OT1A 2JELH 3WHE0 1UZ6E 4X7EC 5JHDA 5D2NA 4HSQA 5CBAB 4RSVA 5K9QG 5IWLA 4WGWB 4U1MB 2X09A 3TGXA 4H88H 3HUJA 3K7UA 5T5FL 4DEPB 4ETQA 1JFQH 4OZFA 3H3PH 2XXCB 1BD2D 2B39A 4OIAA 2O5ZH 1BVKB 1CICA 3OV6A 1QD0A 3C6SA 4Y4KB 1LQSR 1YY8A 3I75B 4U1GC 4L9LC 4I3SH 2H45A 4YNYB 5C0AB 4ODUA 2AXGA 4Z78A 4QOKA 1VFAB 4UOW0 3X11A 5K59F 4JGUA 4M6NL 3KPPB 4JPKL 5MHSD 4XPFL 5JDSB 3CFBB 4P4RB 4M5ZH 4UBDD 4OT1L 3IYLW 1ERNA 5JPMA 1NANI 2EDYA 1OM3L 3QSKB 1RZKC 2A2QT 4LLUB 1KLGA 3UTOA 5IBLD 1KG0B 5IWLC 4YR6B 3V8CA 4Y8DC 1VFOA 4ZUTA 3CK0H 4X0KA 4XXDB 2DQEL 4FQXB 1OPGH 4WDIA 3ETBF 1T2QL 2DI8A 2E27L 3LD8C 5JW3L 4KJQD 3ZTJG 1IBGL 1CBVH 4QHKI 1IILE 3KPRB 2ESVE 3KPQB 3TNMB 3C5ZA 1CICC 3GSNH 5IFJB 4JRYE 5BZWA 2YPLA 2Z31B 4Z7UA 3BUYB 2OTPA 4PJ5D 3QPXL 4GO6B 3L3GA 1HCFX 4HKJA 4PJCF 4HIXH 1WTLA 3AS1A 3S7GA 1E4XL 5FYJD 2W59A 3OKDA 1T2JA 2ARJB 4ZTPH 4UIMB 1QKZL 1FFNB 4OCYL 3CLFH 5F7WC 3MZGB 5F7YC 2NY0D 4XRCB 5EC2A 5CIPB 2XQYK 2VH5L 4F2MB 3QUYD 1MHEA 5EZLB 3T0WA 2J5LC 3GFUA 2CQVA 3VW3L 2F9BT 1JNNL 1QR1A 3D3VA 5F88B 4YBLC 4AM0A 4P2RB 4ZYKA 4ZNEE 4RDQG 4PJGA 3BGMB 2VOTA 4LLMA 3FT3A 2IQ9H 4XC1H 1IM9D 2VR9A 5JOFA 1G9MC 3C5ZC 2D7MA 4H1LH 4XH2A 4XZUB 5FUOH 3P4MA 4O2FA 3PWPD 3MLSH 5EORH 3LEVH 3QWRD 1GC1L 4EI6A 2ZOLA 5HHQB 2JIXD 2OXHA 1QFWM 2IG2L 3MRCB 3SGKA 1B0GA 5ACLA 3OGOE 3HTLX 2FYYA 3KJ4C 1MCKA 1Q9OB 2AXFA 3FQXB 3S4SB 1D9KA 2AVGA 1ZK9A 3TNNB 2G75A 2DYPB 2WLYA 4QTIH 2D03H 1ORSB 1BJ8A 4WO4B 2P8MB 2Z91B 3IFOB 2DB8A 4KAQL 4Y4FD 2OLDA 5L6YH 1XF2A 1I8KA 1T7XA 2HWZH 4OUUA 3ULUE 1YMHA 5C6TH 3F62A 3V6FA 1IFHL 4FQQB 4YE4H 4DK6A 1INQA 4NKDA 5ID1B 5AWNH 1ZT7A 4F7PB 4NFCA 2BDNL 2Q6WA 2DWDB 4UB0H 4JY5L 1S7XA 3O3DA 1T7WA 1RQ5A 4YPGA 5DI8A 4HHAB 3DO7A 1YUHA 4PREA 2VJXA 4NUGH 4PJFA 4HIHA 1FPTH 3ECBB 2A83B 3CVIH 3DI2B 3RU8L 4P2YA 2AEQH 3ROLB 3RBSA 4YHKL 4LAQH 5CBAA 1CDGA 1VDGA 1H8NA 2E9IA 4U1MA 3DRTA 3HNTH 3OJ2C 3SO5A 1WBYB 4LF3B 1LE5B 1D9KC 4HEME 1KJ2B 2PETA 3OJDB 1RJYA 1HKLL 3SGEH 4GRMA 4L8CB 2MWCA 3BKJH 1NEZA 5FHBL 4WU7B 2DLEA 1BVKA 1IGCH 2E8ZA 3QI9B 4YHNB 4Y4KA 4XPGL 3KPTA 3I75A 2CR6A 2EE6A 1IE5A 3QUXD 4KK6C 5DFVD 1IL1B 3I50H 1QYGL 1S9XB 3L5WA 1CF8L 1QBLL 4YNYA 5HGDA 3CUPB 4EUPG 1VFAA 4HWUA 2UUDK 3MR9B 4XNUH 5IB5B 3OR6B 4M6OH 3UZEA 4JRXE 4J3OC 4K94C 2CJUL 4ERSL 5IVXB 3JV4B 4TSBL 3CFBA 5JDSA 1GOGA 4P4RA 3WSQH 4DN3L 5J9PB 4HMCA 4XCFL 1TZIA 4J4PD 1G1CA 4NKOB 5GS0L 2EKJA 3UBXG 4LLUA 3C2SA 3X14B 1I9RH 5FUZL 3ULVC 1KG0A 3P9WB 5DJYB 2D7TL 4M6ML 4YR6A 2I60L 3N9GH 3N1GC 3CXHJ 4URTB 1Q94B 3T4YB 4XXDA 4FQXA 4HG4K 5I1IH 4WFHD 5IVOA 4DEPC 4RGNB 3BWAA 1TCRB 1EO8L 3O8XD 4N68A 4PRBA 2OS7A 5L7XL 3LOWA 4YHMH 3KPRA 2EE3A 3KPQA 4FQHA 3TNMA 5IFJA 2VTFA 4Y4KC 4R97B 1B6UA 2OP4H 5CZVH 1A3LH 3QHZL 3UPRB 3R1GH 4FNLL 5JQ6L 3OKEB 2ZUSA 3BD5A 1TTUA 1KIRB 5DGQA 3BYYA 1KCRH 1RURH 2YPVL 1OF2B 3ZT7A 3QEQD 2ARJA 4UIMA 1FFNA 1KC5L 3F58L 4ODWB 4PRHD 4WTWA 4G6ML 2ITDB 4XRCA 3LN4B 5I76A 1QLEL 1HHIB 5CIPA 5EZOH 5GGVL 4F2MA 5GGUB 4LRIA 5EZLA 1Q72H 2D0GA 4MVBA 3OZ9L 4A2MA 1OP9A 1FVDB 4FQXC 5GXBB 2CUMA 5GGQH 4P2RA 1M05A 3BGMA 4JFHD 4OGYH 1T03H 4OAWA 2IBZX 1T66C 3EYOB 4K3JH 3HE6B 2CUIA 5EUKA 2JJSA 2WQ8A 4GAGL 1YECH 3GKWL 4DGIH 4BZ1H 5K9KB 2I26N 1ZEAL 2Z31C 1KXVC 3MRCA 4HXAL 1PZ5B 3DMMD 1W72H 2ZKHL 2F54D 5E6ZA 4UIKL 2OL3L 2R56H 3RDTD 5HI5D 5JW5B 1Q9OA 1NAMH 3S4SA 1PG7H 2Y06H 1KB5A 2D2OA 1XIWD 2DYPA 1TFHA 1ORSA 3GEWB 3QDJE 4WO4A 2P4AB 4HPOH 3QJFB 4MB5A 2P8MA 2Z91A 4MJ6B 3U36A 2I07B 4JO3L 3LDBB 5HHPB 2ICCA 4F7TB 1DBML 5F72S 5FUCE 4F3FB 4KFZC 3MXWL 2CIKB 4FQQA 2BNQB 4YDKH 3O3BB 3O0RL 1FLTX 4MMXC 5ID1A 1W0WA 4F7PA 1A14L 2DWDA 4KKNA 1VGEL 2JJSC 2VZ3A 4BA8A 1NUFA 1ZVHA 4HHAA 4EQ3A 2R69H 2IADB 1AKJD 4I3GA 3GZKA 4F9LA 3K8LA 1NCNA 5BMFH 5IQ9B 4U1LB 4LSSH 3ECBA 5DC0A 2A83A 4M43H 4HUVB 3F12B 3RI5K 3ROLA 5FO8B 3EUUA 3BRGC 3QIWD 2GAZA 1F3RB 4LDEB 1WBYA 4LF3A 1LE5A 5FV1L 1UJ3C 3QCUL 5DRNB 4E41E 1UZ6F 3KS0J 3ESUF 1KJ2A 4Q2ZB 4OFPA 3OJDA 4HV8A 4I1NB 1L9MA 5IJVB 4WO4C 4PGBB 4HPYH 1A6ZB 4R90H 4L8CA 2E7MA 3FKUS 3HA0A 4GBXA 4PJ7F 2WIIA 4WU7A 1A6UL 1BJ1J 3CFDB 3FL7A 3QI9A 4YHNA 3SKNB 4XPAH 4IBLT 2IH1B 3MA7B 4CBPA 1KELH 1SMAA 3BAEH 1IL1A 3QZWB 1S9XA 4HUWB 4LASH 2DKMA 2RB8A 2B5IB 4RMWA 3CUPA 4N0CD 4RMUA 3VGDA 4RDQF 2WBWB 1XCTB 3MR9A 5IB5A 3OR6A 5JIKA 2AERT 1CDUA 2NX5A 3JV4A 1HHGB 3MUHL 4F9LC 5J9PA 3KWWB 2CLVB 1RZJC 4NKOA 4Z7VF 2AJSH 3X14A 1WFTA 5DJYA 5FHAL 4EDXB 5C86A 4G8IB 1BAFH 1X5IA 4UZGA 2GJ6B 5FDYA 1FV1B 1Q94A 5E08L 1P84J 4K94L 2IWGA 3S37X 1VESA 1IC5H 3DYMA 2FEDD 3TIEB 4F7CB 4LQ1A 1TCRA 5MERA 1OTUD 4KUZH 43C9B 2JB6A 2QQLL 1I85A 4HBQA 1EH9A 2XNAB 2ZPKL 3QDGD 3TM6A 4K7PX 2VC2L 4N5ED 5ERWB 5CEZH 4FG6D 5SWZE 5ID0A 1TVBB 1FORH 3UPRA 1FO0B 4Y1AB 1FFPA 3OKEA 4GXVL 3C8DA 2FJFB 4S1SL 1KIRA 1Z9SA 4PJDE 3W9EB 2IAMB 4UINH 1W0VB 4DJMA 4KI5D 1OF2A 3O2DL 5C0JB 1T7YA 1F3DH 5J1SC 4L1HA 2CXGA 5GZND 2J2ZA 4Q97A 3CXDH 1KCSH 2Q8AL 4YHOH 2ITDA 3AU1B 4FZ8L 3O6KL 3E0GA 3LEYH 3LN4A 4ZFFA 2YMXH 1HHIA 3OG4B 1J9CT 3X3GL 5GGUA 4LCWD 1PKOA 2WIMA 3BP6A 3QAZB 4JFXB 3HFMH 1GVIA 4WTZA 5GRZA 4HULB 1FVDA 5EO1B 2ICES 3FMGL 4RGNC 5E6IB 2EYSB 1FL3B 1L7TL 5HD8D 3C09B 4JANB 3EYOA 3HE6A 1I85C 4ZUWB 1UXWB 3PP3K 3DROB 3U7YL 4R97C 5K9KA 3G5ZB 5D93B 1AP2B 2IQAB 1NBYA 4OI9A 1F11B 3VGGA 5J6GB 5I18H 2C26A 4K3DH 4DKEL 4IRJB 1MCBA 5EOCL 5JW5A 4LSVH 3V4VH 1FNEB 4FXKB 5F7KC 2GFBA 1A47A 1S7VB 3QJFA 4GRWB 4MJ6A 1NFKA 3QA3B 5HHPA 4ZFOL 4F7TA 2KKQA 1WEJL 2FD6H 3L9RB 1PDKA 2EXWC 5HHNB 4NC0B 4QLRA 4F3FA 1RZGB 1JI1A 1K2DB 4BJLA 2CIKA 1AXTH 2BNQA 2X4RB 3P9LB 4JFZL 4G59A 4Z7WA 3W5NA 3O3BA 4OF8A 1A7QL 2COQA 4DTGL 3PNWA 3MLTB 2CMRL 1U41A 3MLZH 1QSFD 3CC5B 4P0DA 3HE6C 4YWGH 3HPJB 4ZOAA 1RIVH 1KGCD 4XCEB 5SWSB 2IADA 3OKMB 1TCMA 4TPRH 4WFGD 5IQ9A 4PY7A 5LXGH 4U1LA 4P3WA 2XZAH 1DBAL 3MLUL 5GGTL 5ADPL 5FYKU 3ARFB 3F12A 5FO8A 3PV7A 5GRVL 3KPSD 4KHTH 3VJ6B 3C08L 1UADC 4XVUC 4JO2L 5TQ2L 4CMMA 2HFTA 2BP3A 2OZ4H 4I0PD 4G8FB 4ODBD 5DRNA 4M8VA 1S3KL 3OBAA 1NLDH 3GNML 3RWGB 4Q2ZA 4P5KA 5IJVA 1BPVA 4PGBA 4J1UB 1MFAL 1A6ZA 1RU9L 4C57C 3LDBC 3I6LD 4KDWA 4PYGA 2WLZA 3V8OA 4YDJA 3PWNB 1MUJA 2YUZA 2IH1A 3MA7A 4PRPB 2X10A 5JW4N 3EYQC 3KPOB 3QZWA 5DRZB 5IP4A 4HUWA 2MKWA 3JXAA 4Z7NE 4H1LG 3VI4E 1JPGB 1YDPB 1GGIL 4JKKA 4PV9B 4XBEH 3TFKD 5I75B 4QXWA 1VKXB 3JWDC 4JO1L 3MX0A 1HHGA 1GCFA 2ARJQ 4POZC 4PLOB 2DI9A 2R0KL 5FYJH 1V3LA 4C4KO 4P46B 1DP0A 1J05B 3NVQA 2R29H 4EDXA 3T0DA 4G8IA 4OJFL 4IMKA 2GJ6A 5CZKA 1FV1A 4MA8H 3JWNC 3KAAA 2IPTH 2GTZA 2FNBA 5JHDD 3TIEA 1FNSL 3UJTH 4F7CA 3O6LL 43C9A 4YLQT 2E6JA 2X4TB 2P46B 3QISA 2XNAA 1ZSDA 4PBVC 5ERWA 4MB4A 1XF3B 3NPSB 4JM2B 3FO2A 4B0MM 2AJUL 4Y1AA 1C5BH 2R0LL 5ITBL 2BSSA 2FR4A 5I1EL 4XP4L 4FFEX 4G6KL 5IB4B 4Z0XA 5HYSB 3W9EA 2IAMA 3TO4A 3L1OL 1W0VA 3V0WH 5C0JA 3JWOC 5KS9F 3BI9X 4LPTA 5H8DA 4YHYB 5F1SA 4QY8B 3PHOB 2EDLA 5FCUH 4D0DA 4QOKD 5FA3B 1I1FB 3GMRB 3AU1A 1OAUL 5L8KB 2BC4B 3SDXB 1FGVL 4HQQL 4F80A 3JV0A 2Y36H 3Q6GL 1MRCL 2HRLA 3QXAB 1HQ4A 3EGSB 2YOCA 4IMKC 3CFCL 3ZE1F 4JFXA 2FZ3B 4HK0B 4AG4L 5HGHB 1SBSH 5EO1A 5HJ3B 1KFAL 3MPCA 5E6IA 1FL3A 1URLA 4QRRE 4JANA 2ITCB 3QDAA 3RVXC 3LKOB 4ZTOH 3VD9A 5DJCB 1FRGH 3D25B 1UXWA 2YD4A 1A8JH 3DROA 4DFIA 1REIA 5EN2B 5KJRH 3ILPB 1LDPH 1AP2A 1NFDB 2P47B 2O93L 2IQAA 1F11A 3GSQA 4LQFL 5J6GA 3C5ZD 3U1SH 5GSVA 2EYTB 2YPLD 2IAMC 2A9NL 3QNXB 4LDOB 3VCLB 1MNUH 3EAKA 1IC1A 4FXKA 4D9RE 1NC2B 2R2BB 3WHE1 4ZO6A 3QRGH 1JYWA 1DE4A 3QA3A 1IGIL 3OKYA 1I8LC 3L9RA 4R2GD 4X5XB 5DEGB 5HHNA 2G2RB 1RZGA 2ED9A 3HI1B 1K2DA 3QAZC 3P9LA 2X4RA 4NHUB 2G9HB 3MJGX 3OKLB 3FOLB 4BUHA 5E6IC 2DQIH 2B2XL 4P2CG 5C2BL 5I1JL 3C09C 3CC5A 5FGBA 1NL0H 3E6FB 4O51B 3HPJA 4MQ7B 5SWSA 3CVHB 3OKMA 1DVFB 3EYFB 5D93C 4UT9H 3ORJA 1F4XL 5C8JB 1G7PA 1KV3A 4X6CB 5IBTH 2FGWH 2MKLC 4PJ9C 3RGVB 1EAPB 4DZ8B 3VJ6A 4IRJC 4PS4L 4G8FA 3TJHA 2DBLH 1HOCB 1L7IH 5CZXD 1DSFL 4FQ2H 5CEYB 3RWGA 3WNPA 3MRKB 2VDLL 4D94A 2H3NB 4KQ4L 4LSRH 4WW2F 1MJ7L 4XP9L 3UJTL 2HH0L 1S8DB 1RVFL 3MV7B 4HK3J 1PX4A 2A9ML 1CD0A 4PRPA 3ARBB 1QTYT 1AQKL 5DEFB 4YIQA 3U82B 4OQTH 1W2KT 2HTKD 3QB7C 1MCOH 5MEOB 3BO8A 2VDQH 3R06B 3VD5A 1WITA 4GW5A 1CL7I 1JPGA 4KK6D 4PV9A 1O5DT 5EUOB 3VFPB 1KTDB 4WFFE 2R8SL 1WJ3A 4N0UB 3SO3B 3QEHB 3FN0L 3ARFC 5KVGH 1EZVX 4P46A 1J05A 1D5XB 4PG2C 3T0EB 4ZS7L 4PRIB 1TZGH 5I0ZA 3EHBC 3MTRA 3P30H 4RA3A 3DIFB 3JWDL 3I3DA 1MWAA 3X13B 2ADIB 2X4TA 5DK2B 2H2SC 2XN9B 4OI8A 2AGJH 4PJ8B 5DD3H 3IXTA 3VGAB 1XF3A 4PBWD 4JM2A 4HH9B 4O02H 4OLEA 1JGLL 4OTXH 1UG9A 1YZZA 3ZE2F 4Y4KD 1WZ1H 4DGVL 1RJLB 5J1AB 5CEZE 5IB4A 5HYSA 4Y4HA 4UDTB 1IQWL 4UILL 5I75C 1A6AB 1WC7B 2P49B 3H3BC 2CK0H 3PHOA 5FA3A 2QQKH 5E2UL 4YX2L 3GMRA 3U7WL 2BC4A 8FABA 3SDXA 2HT4D 2VZ1A 3QXAA 4C4KT 1J0HA 4RCAA 3EGSA 3V52H 4D8PB 4I9WD 4GH7B 2FZ3A 5HGHA 1J1XH 5HJ3A 4CAGA 4IOFC 2IPUK 1OP5H 4HS8L 1TLKA 2J4WL 2YS4A 3BEWB 2ITCA 5HHXL 3LKOA 4L8BB 4ODXB 5DVLA 5DJCA 4FQXD 5I15L 3D25A 2F19L 5EN2A 3UYOD 3ILPA 1NFDA 3NPSC 4JM2C 4KKLC 4RGOL 3WFBH 4TSCL 5KW9H 1T66D 3KPRD 4XMLH 1QSEE 3OQ3B 4NCDA 5D7IE 2FBJH 2YD7A 1DQJB 5F9JA 5C70A 3FO0H 2EYTA 4OB5L 4XWGH 5FM4A 1L4IA 5CUSH 1F00I 2F53B 3D85B 3VCLA 4WI2A 1MF2H 1BIIB 1NC2A 4MAYB 2R2BA 4YHYC 1HKFA 4G9FE 3NTCL 3F6LA 4CVZB 4I3RL 1C16B 1NBQA 3TN0D 1FO0L 2HKHL 3WS6A 1TETH 3JUZA 5J89A 1AGCB 3HI5L 1WAAF 3VMOA 2G2RA 3HI1A 3ZTNL 4K23L 3PDGA 4W6WB 3VXQB 4JCLA 2DQDH 4NHUA 5C08A 2G9HA 4I77H 4O5LL 4JPWL 3ALWA 3OKLA 2A74A 3U7AA 4JFEB 4MVBD 5KTEL 2LABA 4O51A 1OCWH 4G7YH 4S0SD 4P2RD 4PLJC 2IBZY 3B5TA 3CVHA 4PJEB 3SQBA 1DVFA 3EYFA 4MNGB 1CXFA 3EOAB 2DJSA 5C8JA 4GMSL 5I1AB 3RGVA 1EAPA 4DZ8A 1EGJL 2AQ2A 4TNWF 1W0YT 3R0MA 1U9KA 1T6WA 2DKSA 2HAZA 4RFOH 1HOCA 4HS6B 5CEYA 2E6QA 3MRKA 5MHSE 1WBXB 2F58L 2EZ0C 3H42H 5C71A 4S1DD 4M61B 2VLKE 4OSUH 1T1XA 4R0LB 2HLFC 4A2LA 4D0CB 1S8DA 4KUCF 5F7EL 3QP3A 3MV7A 5B4MC 3O6ML 2YXFA 3C5JB 3AY4A 4WO4D 3L3HB 3ARBA 1YEFH 2AEWA 1CQYA 3R06A 2ID5A 4ESKA 1IAMA 3LHPH 4NP4H 5EUOA 3VFPA 1JF5A 1KTDA 3MCKB 4U31A 1DVFC 4N0UA 2PYEA 3QEHA 1H5BB 4CW1A 2B1AL 3HE7B 4PJ5E 4KH2A 3UJJL 3T0EA 1D5IL 4PRIA 1QSZA 1A7NL 2Z35B 1OGAB 43CAB 5FYJE 2APBA 2VWEC 2OJZH 5JQHC 3QUZC 4NYLB 4WI3A 3RHWK 3X13A 2I5YH 2ADIA 5A43C 3W82A 5DK2A 3TWCL 2XN9A 32C2B 5TE7L 1N7ML 4GAJH 4DZBB 4PJ8A 2V5YA 2O61B 1GGCL 4GRLA 3ZKMC 4GBXD 1DQTA 5HGGS 3KR3L 3OAZK 1NCWH 3QI9D 1KIQB 1B6DA 4ZUSB 1RJLA 5J1AA 4YXKH 4BK5A 3S88H 1S9WB 2V2WA 5E8OB 3V5DA 1PEWA 2IFFH 1NC4D 3MRHB 1BWWA 1S7WB 4LSUH 3VFWB 1F90L 2E9BA 4BH7A 5GS1B 3PWPE 4NKIL 5EZJA 4AIZA 4PJIF 2FEEL 3RIFF 4MHHI 4UV4L 3SO3C 2YA2A 5DURD 2W9EL 2NX5D 2X2YA 5DD5L 4D8PA 3T0EC 3F7RA 1OW0A 1D5ZB 1NUNB 4CJ1A 3ARYA 3ULSA 4GUPB 5J06A 3RVTD 4UNTA 1UM5L 3R0NA 3BH8A 4R9HA 2ORBL 4OCWL 1UC6A 1CGXA 3BEWA 1FZOA 5J11B 3BIKB 3MCLH 1K85A 1ZLWK 1Y6NR 4H0IA 4L8BA 4ODXA 5JPNB 3TBWB 2EKSB 4U7KA 3BKYH 3BGAA 4PJ8C 3CFEA 3VGAC 1MEXL 4MNQB 5FM5M 2UZYB 3VXRB 3CDGB 4K7PY 3WIIL 4X6DF 3V7MA 1PZUB 5FKAB 1A1NB 4HD9A 3VFSA 1DQJA 1L6XA 1NSNH 4G7VH 2F53A 3D85A 4JO4L 1BIIA 4MAYA 3UPAA 2CD0A 1J1OH 3QPQC 4IIQB 4CVZA 4ZOCA 3WJJA 1C16A 4TVPD 3DETD 1MCPL 3E6HB 4A6YB 1EJOH 1NCBL 2W65A 4HBCH 1OW0C 4XNQB 3VXQA 3L6FA 2CKBB 5B39B 4JG1L 5EBMB 4WI4A 2MCPL 3LMJL 1CL7H 2PR4L 4L29B 3PDOB 3HAEB 3WFEL 4JFEA 5KSBB 1QA9B 2HJLB 1NLBH 3ZDYF 5DD0L 3GRWA 3STZA 5C7XH 3MOBH 5GZOD 3X17A 2HG5A 3GO1L 4MNGA 2H32H 2KZ1B 1V8HA 1EBAA 3V7AE 3EOAA 3SE8L 5C9KA 2YKLH 3EYUL 4NJ9L 4L8DB 4JN1L 1CE1L 4J6RH 2X1XR 2DDQH 1G7HB 4LIQE 1A6WL 1KPVB 1HDMB 4HS6A 4MAYC 1BBDL 1N2RA 1Q0XL 1WBXA 4JB9H 4Y19B 4O58H 4LLDB 4HWBH 4M7JL 4GOSA 4XVUD 3JTSB 4M61A 5AUMB 1RZKH 4ZSOB 4D0CA 4V1DD 4KK5C 4LLYA 5JA8B 5J13B 2CUHA 2MQ3A 5DR5L 3VD3A 3C5JA 3L3HA 2GT9B 4PJHB 2FX9H 4PTTB 1CLYH 4ONHB 4KTDL 3G04B 1DEEB 4YFLI 1FYTB 4PLNC 5BZDB 2BNQD 4OZFH 5L8LB 1Z2KA 1QSVA 3EYQD 2Q76B 3IU4L 4AEHL 3MCKA 3VDAA 1UWGL 2JTDA 2DD8L 3FFDB 2BRRL 1H5BA 4YO0B 1FCGA 5CMAA 5BS0B 4XX1E 2HN7A 1GIGL 1MPAH 2AQ3A 1OTTC 4CU7A 1E6JL 2Z35A 2WP3O 4POZD 1HH9B 4S1QL 43CAA 3B9EA 1N26A 4NYLA 4PRHE 3Q1SL 3U4AA 2A77H 4PD4K 4YK4B 4R4BA 3MO1B 4NZTH 4BQCA 4MAUL 4R0LC 4JPVL 2NXYB 32C2A 5EFIB 4DZBA 5I17B 5HPOA 1MRDH 1JWSB 2O61A 3VFOB 4NQSA 2IEPA 5I8CA 5JMRA 1B0RB 1IKFL 2GSIB 5IFHL 1LO0H 1H3GA 1ZT1B 3RY5A 3V7AG 1KIQA 4WI5A 1QQDB 4YBHA 3CJJA 4ZUSA 1DBBH 4JFHE 1S9WA 5GQBA 3MYZA 3SCMB 3S5LB 5BRZB 3MRHA 2V5TA 1G9MH 4FP8L