3RWHA

Rhesus macaque mhc class i molecule mamu-b*17-mf8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
276
structure length
276
Chain Sequence
GSHSMKYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAESPREEPRAPWVEQEGPEYWEEATRRAKEAAQTHRENLRTALRYYNQSEAGSHTIQKMYGCDLGPDGRLLRGYHQSAYDGKDYIALNGDLRSWTAADMAAQNTQRKWEGNRYAERFRAYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTEFVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I
publication title Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system
total genus 71
structure length 276
sequence length 276
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3rwhA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3rwhA01
3G08B 3JTSA 1HHIA 4LLMB 1WITA 2YBRB 3LZFL 5IM7A 3MXVH 3OXRB 1XF5B 5L2KB 3HRPA 4LSTH 1AGFA 5T1MA 1ZT7B 1FV1A 1XIWB 3GHBH 5T1LA 5DS8B 1MH5B 4RMQA 1FIGH 1I9RL 4G8IB 3VWJC 2YN5A 5DUML 4Y88A 1DBKH 3I85A 1CGXA 1KXQE 2VLRD 5DJ8B 3SDDA 1ACYL 1PVHA 1UWGL 4JFPB 1U8LA 2AV7A 1NMAL 5EORL 4ZUSB 3WHXA 2GTWA 4P4KC 1P4LA 2FIRT 2WBJA 4OQTH 4CU7A 2JJSA 2DI8A 1NC4A 5DRNA 3D2UB 2LU4A 3GRWL 3H8NA 2HLFD 5JA9A 3V6FA 1NCAL 5B21A 3SDYH 3QDJD 1GZPA 2FCBA 2F53E 3QFJD 3L7EA 4NCC2 3TH2T 1RSFA 5J3HC 3NFPA 1C08A 3MXVL 4PLOB 2HMID 5IWLC 1DEDA 1LQVA 5CIPH 1FIGL 5MEOB 3TZVD 4FQQA 1CFSB 4I2XE 4XBEH 3OAZH 5I1GH 3C8DA 1BJ1J 1U8QB 3IFOB 4KKBC 4R0LC 5BV7H 5HHNA 3CXHK 4TPRL 2CLVB 1OM3L 1ES0A 2X41A 1SJHA 3J8F7 4OQTL 2YPVL 4PRNB 1KSRA 4D9QD 1J1OL 3IU4H 1JMZA 3HG1B 5HHMA 2PW1A 5BW7A 1QLEH 4I18B 4H1LB 3SDYL 1DBML 1YZZA 4JFEA 2UUDK 3MUJA 4HJGB 4XVTH 2QEJA 2XTLA 5IT2L 2YR3A 4P46D 1UKSA 4CKVX 2WIMA 2HRPH 3WMSA 4YE4L 3M1BB 5IMOA 1CIUA 2KL6A 1QSFB 2LTQC 3QAZC 4DZ8B 4E41D 2VMFA 5B8CA 3LN4B 2J6EA 2APTA 4K7FA 1F2QA 1K4CB 2J7LA 3OKKA 5GGQH 5LG1A 1RZ7H 1WWBX 3MLSH 5DHVB 1I1AB 2FD6L 3MRLB 4IOFC 1ZVSB 4E42A 2O5XH 2B4CC 2ORBL 1QLEL 4P4KA 1DUZA 1CE6B 3BEVA 2VWEE 1T0MB 5I1KH 1P1ZA 1PW3A 1NC2A 1FDLH 1WIPA 5DJXA 4JN2A 3OSKA 1ZHBA 1IGIH 1H3UA 4WHTB 3QO1B 5SWQB 2D31A 4NFDA 1EJOH 1U42A 4YO0B 4WTZG 3A6BL 3SJVE 3REVA 2VXVH 3TBYA 3WNPA 5IWLA 5GGQL 4MJ6A 3LEVH 4XB8A 3ARWA 4GKOA 5T3XL 1GZQB 2VLRE 1IL1A 2GCYA 1D5IH 2O5XL 2UWEA 4EDXA 4G3YH 4J3OC 1BBDH 1G9NC 4X6BB 2EH8H 5JXED 1MFCH 2DQUL 2UZIH 2ZUQB 3JXAA 5FKAA 5I1KL 5ITFB 5BRZA 1U93A 5FO8A 3O4LD 2FX8H 1FDLL 1HHJB 3BGAA 1G6RH 4NQCE 3QDJE 2JCCE 3G08A 3WLBB 1KJ2H 3HAEH 1XGTA 2YBRA 5I0DA 3BP5A 1T0PB 4K3JL 4U1LB 2GSGB 3PWVB 3VXTB 1UKTA 1EJOL 3QUML 1XF5A 3DO7B 1JGUL 2VIRA 5IHUL 1XIWA 4MB4A 4PJDF 1YMHB 1MH5A 4QRPA 5E7FA 5E6ID 4G8IA 4M6NL 4KTEL 1OWRM 1AQKH 1TLKA 4GXUN 3BKCH 1DTUA 3DX8B 3VGHA 5D1ZB 5GS0C 5JW4M 2VUOA 4ZUSA 4G3YL 1U8KB 1HI6B 3MO1B 1BBDL 3LKRB 1CFBA 4WW2F 1MFCL 2UZIL 2P48B 3QSKB 1H15A 3D2UA 3TFKA 5IBLC 1GOFA 2XKUA 4FFZH 3BRGC 3FT4A 2LQRA 5K9KA 1FFNB 4MNGE 2YS4A 1KJ2L 4JQIH 5D4QA 3ZDYE 1CD9B 4ALAL 1ZGLB 4ODTL 1AO7E 3RDTB 1IBGH 4FQLH 2O93L 1A21A 4KZEH 3DSFH 3H9HB 3MGTB 4L8DA 2C1PA 5EZLA 4NC1E 4DCQB 4MA7H 4XGZA 5F6IC 5MEOA 2PYFB 1CFSA 2XXCB 3CX2A 3MNWB 4LARH 3BKCL 1KEMH 4YDKH 1QNZH 1U8QA 3IFOA 3FN3A 2R8SL 3ZT5A 4PJXF 5IEKA 4JFZL 4R9HA 3CX5K 1CE1H 2R2HA 3IFPA 5E8OB 5D7IF 4PRNA 1SHMA 4PIRF 4PRDA 4U49A 3EW3B 1J5OH 1INQB 4I18A 3EOAA 5HSFA 2FR4A 1U8OB 3H7BB 4HJGA 4JQIL 15C8L 2VQUA 4CN4A 5FV2A 4TTGA 2R0LH 2OI9C 4X4YB 4XCFH 3RIAK 4AEEA 2BNUA 1GC1C 3LHPH 2DI7A 1IAII 3D85B 4YNYB 2HTLC 3AB0B 4MA7L 1E4KA 2Y5EA 2X05A 3EDDA 1V8HA 1QSFA 3IGAB 4KMTL 4DZ8A 3CCHB 1KEML 3LN4A 5T33H 1K4CA 3KLAB 1GPOL 1KTLA 5MI0C 1CE1L 2NXYD 5DRWA 2ADIB 4LGSB 5EIQA 5HDBF 5SX5H 1ZVSA 3BAEL 4X4MA 3ULVF 5JHLH 1J5OL 5D7JB 4XPGL 5GGVY 3VGGA 2IH1A 2NX5A 4XPAH 1MI5E 1AFVH 3QQ3B 1T0MA 3D69B 3MROB 2J8UE 2R0LL 1QTYT 3O4LE 1T03H 1QOKA 4JFQB 2NY0B 5F7MC 1CF8H 3OV6A 5I1CH 1GGIL 1U8MA 2XYCA 3DIFB 2VXTH 2PXYC 2OCFD 4KHTH 5FM5O 4IRZL 5SWQA 2BVPB 5FB8B 5DVLA 1IQDA 4LFHD 1PJ9A 3P3YA 4XX1G 3OKOA 3MLXH 4H26B 2UYLB 5D7LB 1FNEA 5DD1H 3PXJA 1IAOB 1UFUA 1NCUA 5E70A 5ALBH 1XMWA 4UBDC 1ONQA 2ZG1A 4GRMB 2WIIB 5ITBH 5T3XD 5JHLL 2Y07H 5JDSB 2QQKH 4X6BA 4EEEA 3ZE2F 5HPMB 2VLJB 1AFVL 5JW5A 1M7XA 1NBZB 3FO2B 5ITFA 3R4DA 5DTFA 4L8SB 1SYVA 1T03L 5FECB 3V4VH 3PGCB 1MUJB 1RFDL 1AGEB 1F4YH 4P3CH 3RTQD 1CF8L 1XR9A 3WLBA 5I1CL 3VGBA 4ONOA 2VXTL 4KHTL 3NGBC 3ZYIA 3DO7A 2ADFH 3BZFB 5FHBL 2Z8VC 3MLXL 1EFXB 5DD1L 3T3MF 4F33B 5F9WB 1U2CA 1TCRB 4ZXBD 2BXYA 4KQ4H 1IAKB 3CFEB 3DX8A 1U3YA 5B39G 5CJOH 4K94C 2GW5A 5ESAB 4OT1L 1KTRL 1YJDC 4UTAH 3L95A 5MEQB 4KWUA 4AH2A 3B9KC 3UXFA 5E9DE 3V4VL 1I8MB 1F4YL 4KJWC 4WW2C 3O3UN 1FFNA 2I26N 2E7MA 4TSAL 3N1MC 2PO6B 3RDTA 3DUUB 1VFOA 1RIVH 2HT3C 3LKOA 3RAJH 3RHWF 3H9HA 3QXDB 2PXYA 3KYAA 4FXKB 4MA1B 5ENWA 3RRQA 3Q2CA 2PYFA 3VI4F 1B0GB 2EDRA 2NTSP 3TT1H 4G8GA 4KC3B 2EDXA 3NIFF 4L3ED 3X3GL 2B2XH 2OS7A 5CJOL 1CXIA 4IDJH 5E4EB 5E8OA 2VDQH 4EKXA 2Z93B 3BJLA 1FPTH 3PWPA 4G6AC 2D9CA 1GGTA 3DX7B 2VXQH 3OKEB 3NTCH 4NN7C 5JIIA 4ZTOH 3EAKA 2QBWA 4NO0B 1RUQH 4RZCB 2AKRB 1RIVL 5EZOH 3S3SA 4WHYG 5D72H 5E94B 3BGFB 3AREC 1R24B 2NY3C 3IYLW 4XRCB 1B6DA 3UJTL 4OGAD 1R6VA 4HS3B 4PJCE 3IGAA 4XNUH 4YHNB 3JWOC 3TT1L 1V7NH 2Z8RA 2B2XL 5F89A 2FIKA 3KLAA 4IDJL 2HFFB 4QOKA 5AD0B 1NBVH 2EIZB 2ZSWA 1A1MB 2ADIA 5C0IB 2VDQL 3NIGE 3IXAB 5T3XE 2ENSA 3MJ9A 3IS1X 2VXQL 2Q7NA 3IDNB 3NTCL 3QFDB 4OV5A 4PGEB 3D69A 3Q5TA 2AAVA 2PETA 3MROA 2YWZA 3ULVC 4U6TA 1RUQL 3AXLB 2AI0H 3FFCE 2HYMA 2GFBB 1F4AA 5D72L 4U1SB 1FL6B 2BVPA 5FB8A 3KPOA 4XNUL 3SBWA 4C55A 3WEXB 3BW9A 3P0GB 4RX4A 4UAOC 1IEHA 4YHMH 3T0DA 2MPAH 3SDXB 4QHLB 4ETQB 2DLTA 1NBVL 3ARGB 4NWUH 4GRMA 4X6FA 2NY6B 3JUYA 5HPMA 5I8CB 2VLJA 3B6SA 3MRJB 1NBZA 2EKSB 3FO2A 4RFOL 1KN4L 3S36H 3CDFA 3G6JB 5FECA 3PGCA 3VFUA 1MUJA 4P2OD 1LHZA 4YK4B 1A1OB 4KDTC 2DTMH 4KRMB 4NQSB 5EBGA 3UZQA 3PDOA 1E4XL 3EOTH 2CD0A 1NEZA 2R9HD 3BZFA 4BSVB 4PTTB 3GIZH 5H2BB 4N0CA 3AREA 4QHKI 4YHML 1KG0A 4F33A 3T08A 2EDEA 2SEBB 3CFEA 1MPAH 2AK4B 4L3EE 4YC2B 4UINH 5GRVL 2Y6SD 3H9ZA 3OG4B 4M7LT 1BWWA 4PB0H 4ODUB 5F21B 4NM4H 3STBA 4KK5D 3E6FA 2BC4A 3NOIA 3NZ8A 3E2HC 4Q74A 5JLZA 1T89C 1KCRH 4ZUUA 1C1EH 2DTML 1OW0C 5HGDA 1KTDA 4AEFA 3WE6B 4E0RB 2UV3A 3DUUA 2BHUA 3T0EC 1NH6A 4LU5L 1N59A 3QXDA 3TVMD 3C5ZB 3NABH 3TA3B 4P23B 3BQUD 4D0BB 2VO5A 3NFNB 1JPSL 5I9QC 3EO1B 4QGYA 5FGCE 2NXZB 1MHPH 3OGCB 4X9BA 4D9LH 1BHGA 1BIIA 1MHEA 1JWMA 1TQCB 1S9YA 2AJVH 4HC1H 3QXUA 3QWRD 5I74C 3ZO0A 4RGOH 4Q0XH 3ME0A 4KV5E 3DX7A 1NLDL 1I8KB 2UZXB 1C1EL 1N4XL 3OKEA 4WI2A 2CPCA 4CDHA 4EI5C 1UA6H 1NSNL 3DHJA 5KS9B 4Y5XB 2ZJSH 4CN6A 4RRPG 3BRFA 4KK6C 3W11D 5EOCJ 4PRID 2ZCHH 1V3JA 1N0XH 2PYEE 3MV8B 2DWEB 3NABL 4XRCA 1DVFC 4HS3A 3FCTA 1HN1A 1T04A 3DJ9A 1MHCA 5IUSA 1NCAH 4X7CC 4Z6AT 2HFFA 1KIPB 3QUXC 1LO5B 4XNYH 1QBLH 4ZTPH 4UNUA 1U95B 4RGOL 4AQ1B 2ZOKB 4Q0XL 5HHXL 3VXQB 2E6JA 1NEUA 4CMHB 1EGJA 1LDSA 3IDNA 1MEXH 2JB6B 3QFDA 2WMPA 2ZJSL 4M1CC 3C2AH 5FXCH 2C1OA 3ZKMC 3L3HB 4J4PA 4HJ0C 4BSJA 2JLLA 2AXFB 3VXRD 1F90H 4HG4J 2RR3A 2BSTA 1K8DB 4QT5B 2XXMB 3MUHL 5F7LB 1R3JA 5L8JB 5D2LF 1LE9B 2DYPB 4ZO6A 4C56D 2DLHA 4U6YB 3P77B 5D2NC 4YIQA 2VB5A 3ARGA 2XKNB 4ELKA 3HZKB 3MJ7B 3OWEA 4XNYL 4ZTPL 4WUKH 4F3FB 3VXSA 5FUZL 1G9MC 2MFNA 5LJYH 3S8WA 2ESVD 1MEXL 3MMEB 3MRJA 3U0TB 3X13B 3R0MA 5B4MC 1MVUB 2Q7YA 5D6DA 3V0VB 3G6JA 3C2AL 4JHBA 4I3RH 1A1OA 2OJZH 2XOTA 1F90L 3EKCA 3LAFA 2RIKA 3JWDC 1IARB 4G7VL 4D3CH 5JTWA 5H2BA 3FQWA 1N64H 3HMXH 1EEZB 5T5FH 2ICEB 1UXWB 5F93C 3T8XB 3T1FA 3QNZB 3G5XB 4I5BB 4ZPTA 4GG6F 1SM3H 4ODHH 4ODUA 1N6QH 1X4ZA 3GMMB 4JY6A 4Y5VB 4PJ8A 5DEGB 1MFEL 35C8L 3D3VD 3QEGH 3QUXA 2VE6B 5ERWB 4AJ0A 3FT3B 4EUPH 5J7CC 4MGXA 4HQQH 4L8BA 2OJZL 1RULH 1TMCB 4NFBA 3IDIB 3WE6A 9CGTA 3IRPX 4OZGE 3DI2B 3GGWA 4D3CL 5KSAB 4PRIE 1OP5K 3TJHC 3C5ZA 4HWBH 2X70A 4P23A 1N2RA 5T5FL 4ERSH 4D0BA 4X8XA 2A38A 3NFNA 5ALCL 3EO1A 5TPWL 1SM3L 1ZMYA 4B41A 3V6ZB 3O2VH 3QEQD 3TIEA 1N6QL 2YK1H 4JVWA 1MLCB 4MQTB 5DD3H 1UGNA 3QEGL 5CFHA 3GSUA 3L3DA 2GQHA 3N85H 4NKIH 5FDYA 4AT6B 3LRSB 1JTTA 3V79C 4NQDD 1QFUH 4BK5A 4FG6D 4HQQL 3MBEC 4YHYB 2P46B 1ERNA 3RY5A 5EBLB 2C5DC 3DBXB 3VWKD 4NPYB 1A6TB 1YQVH 5GGRA 4FQXB 3CFIC 4HWBL 3T0WA 2DWEA 3RVWC 1EEUA 1KYOK 5F3HB 2D7PA 3SE8H 3NCFB 1AXIB 4K8RC 1Q94A 1B2WL 3ZDZF 4C56E 3RWCA 1QBMH 4ZFGH 3O2VL 4OZIE 3K1DA 2YK1L 1KIPA 2MCG1 2QKIA 2PF6A 3N85L 2C3VA 4NKIL 2GJ6D 4M61B 1GL4B 4P48A 4PJ9B 5FKPA 2KUTA 2UVFA 3BEWB 4ODWA 2ESVE 5TQ2H 2JB6A 4UT9H 4PG9A 3GSNA 3EOBA 5FUOH 1CDIA 2F19L 1YQVL 1JWSA 1OT1A 4MB5A 2NCMA 4OCXH 1YY8B 2GHWB 4G8EB 3WHE1 5DRXA 2AEQH 1RIHL 4PJGA 3IDYC 1L9MA 3CU1A 4PY8I 2D4FA 25C8H 4NUGL 3SE8L 4JM4H 3TJHA 1LE9A 3QEUA 3SKJH 3P77A 3UYRL 2XRAH 4ZFGL 1MIMH 4O02L 3QDGE 4PBXA 1QYGH 2JJWA 1WUNT 3VI3F 1F3DH 1G0YR 2EC9U 2R29H 3KPQA 2XWBB 4LSUH 4X80H 4UT9L 1MVUA 1OOAA 4UIMB 4KU1A 1OAKL 1NGYB 1IQWH 1T7YA 2J6EH 3QUZB 5INCA 2ARJQ 4GRWH 4OCXL 2X4UA 4WI7A 4UDUB 2FZ3B 2AEQL 1E28B 4O4YH 2P7TB 25C8L 4ZSOE 3RUGE 3ARTA 1WCQA 5F7HA 4QRUA 4DEPC 5ESQA 1JZ7A 3SKJL 1HQRB 3NCJH 4X0KB 2XRAL 4KI1A 1MCIA 3B3IB 4NC2B 2ICEA 1UXWA 4PRAB 2X1OA 5HGHA 5IFHH 4KTYA 5H35B 4GLRH 4X6DB 3QNZA 4Q58C 3QEQE 2ZWLT 4JRYD 2R29L 4FOMA 1VADA 2CJUH 1UQSB 3BUYB 4X80L 1NLBH 2VE6A 3DMMD 1UADC 1IQWL 2XZZA 5J57B 4NQDE 2J6EL 4HUMB 5KJRH 2MQ0A 1LO0L 1A2YB 1MOEA 1YUHA 2IAND 1AQDA 4XMKL 1LEKB 2QHRH 1KCVL 3MV7A 3PDDA 1HHGB 3C60D 4O4YL 4JY5H 1S7UB 5KSAA 1RJYB 2DLFL 4YDJA 3CFBB 5IW1A 5T1DL 4ZUVB 3SE9H 2V5YA 1OLZA 3VXMB 4Y4HA 4OUUB 1KEGH 3BSZL 5IFHL 1UVQB 2F54E 3EFFB 1VDGA 3V6ZA 1T0NB 2CJUL 4NO5B 3TEUA 1NLBL 3OR7B 3RVUC 1INDH 3LIZH 4AT6A 3MLUH 4LLDA 5KJRL 2F74A 1QACA 2FJFB 4LCCC 1JN6B 1JV5A 4L4VB 5KSBF 4AIOA 2EXYD 5EBLA 4NPYA 1NUNB 1T2XA 4FQ1L 4LKCA 5C1MB 4I0CC 3CSYA 1B0WA 1KCSH 2V5RA 3R0NA 4PYGA 3JTTB 3RWGB 2GKIA 3K7UA 2NW2B 1KEGL 2B4CH 1GGBL 2W0FB 3LPWA 2VXUL 3BH9B 3FQTA 2VC2L 4PJAB 3BGMB 5EIIB 5GRWA 3UEZA 3HE7B 4MS8C 4TULL 5DR5H 2BY0A 4XWOC 3I3BA 4K3GA 4F58H 1INDL 1T20A 3LIZL 4M61A 3IU3A 5ECJE 3I6KB 4PJ9A 3K0WA 1FNHA 4Z9KB 1TJIH 4BELD 2WUCH 5T1LD 2WAHA 2FEDD 1NBYA 2B39A 1CFTA 1YY8A 3VG0H 3SDDD 1FC1A 2DKMA 1OAXH 1RY7B 1JRHH 4AG4H 2BFVH 4NHUA 5HYJB 4O9HL 4APQB 2GI7A 2B4CL 2WBJD 5DMIH 1G9NH 3IXTB 3MLTB 5F8QC 1NC4D 4C57C 4OM0L 2E7HA 5D7SH 3OKNA 3BN3B 5DR5L 5FA3B 1J1XH 1FFQA 3DV4B 1BMGA 4MJID 3TBSA 2Q8AH 4P5TB 4XNMA 5DSCA 4F7MA 2JF1A 4JRYE 1QFWH 1TJIL 2XWBA 3G04A 4JHWL 1F00I 5E24E 2YRLA 3RKDD 1NGYA 2JJTC 3V5DB 1UM5H 1YEGL 2CR6A 1UCBH 32C2A 4WU5B 1H0DB 3O2DH 4UDUA 3VG0L 2FZ3A 4LCCA 5FCUH 1OAXL 4XAKD 1G7QB 1BVKB 1JRHL 4AG4L 1E28A 2BFVL 2VAAB 4IMKC 1M71B 3ARPA 4QTHB 4NCC1 8FABB 5GS0H 2P7TA 2JIXA 4RA0C 1GOGA 3PUCA 3TCLB 1Q38A 5GZND 1S8DB 5HHMD 4X0KA 4P2RE 3B3IA 5D7SL 2DL9A 1P84K 3RVVD 3MACH 2X4TB 4P4RA 2BMKB 1J1XL 4Y2DC 3REWB 5H35A 3ZT6A 1TQBB 5GXBB 1YPZF 3MRGA 3IDGB 3O2WL 2V2XB 5I0ZA 2MOVA 4GBXD 2AV1A 1JYNA 1UQSA 3GI9H 2H6PA 5EOQH 4AIXA 4HJJH 4EQ3A 3HR5B 5B39A 1M1SA 2DS4A 1UM5L 2EEAA 2OR9L 4CBPA 5DJDA 3QT2A 1YEFH 3MREB 5IQ9B 2VDOH 1HHGA 3DETD 2X6MA 4JDZA 4PS4H 3UTPE 4MCYA 3CFBA 3T3PF 2I25N 4QY8A 5EU7C 3VRIA 4G42A 5I6XC 1PYWB 3Q3GA 1J0HA 4NKOB 3VXMA 4W4OC 4ZYKB 2DD8L 1NDGB 2A6KA 4UV4L 3EFFA 1YDPB 1RJLB 1X5ZA 3EYFA 5FYJL 3RGVC 1NC2D 1T0NA 2BNRE 1GC1H 3GI9L 5C0CB 4HJJL 2IPUK 2A2QT 3QIBD 4JFFE 3NN8B 3AAZB 1RZIA 1WZMA 3HNSH 2ZP0T 5AWNH 3P0VH 1JN6A 3PF2A 3WUWA 4L4VA 2VDOL 2AJZB 1J87A 1CFQA 4PS4L 3EJJX 3S36X 2GY5A 1B0RB 1H3GA 2DI9A 5L9DH 1JPFB 3ARVA 4Y16B 1NMCC 5AAWA 2HVJA 4IMKA 1BD2D 3U82B 4GW5A 1OSZB 3CFKB 4NYLB 1K8IB 2NLJB 4M8QA 5BRZD 1LMKA 4YUEH 5D93C 1N0LA 1C12B 2NY4D 4HWZB 3DV6B 3HE7A 2DN7A 5KAQG 5HGAB 4MJIE 1A5FL 1I85A 3H0TB 1SY6A 5HYSB 2B20A 3VRJB 3HNSL 3SGKA 3F6LA 3MFFB 1DQJB 5AWNL 3AC0A 5L2KD 2O61B 4QRSA 1WWCA 1JL8A 1XIWD 5FF6B 5L2JB 3U6RB 2H2SC 4KI5D 1KIRA 3BPOC 3MRDB 4PJ5B 1S7QB 2YA0A 5T3ZH 1N8ZA 3HLAB 4LEXL 4U0RC 5SX5K 3RIFK 4XAKE 5L9DL 5J9PA 5D5MB 3RIAF 3RWEB 2GJZB 5JZ7C 4MXVF 5DVMA 5KOMC 2XTJC 4OZHE 2RFXB 4CVUA 1D9KB 1GGCH 4IEFB 1YY9D 4ELMF 3NVQA 1OTTC 3IXTA 3MLTA 4LLVB 4YUEL 3D2UD 3TFKD 2OR7A 1WBXB 1ZTXL 1XFPA 4W4OA 3VFTB 5FA3A 2YKLH 4WY7H 3DV4A 5C6PB 3FMGL 2CRYA 5D71H 1CL7L 5DT1L 4NSKB 3RGVA 2HJKA 3NH7L 4A6YB 1NFDF 4YZFF 1LE5B 1F6AA 4JE4B 5DC9B 4HAGA 5C0AE 4G6KH 2Q86A 1H0DA 4WU5A 5D6CA 4P9MH 5D8JH 1WCBB 3KR3H 1DLFH 5T3ZL 4PGZA 4LVNB 4RIRA 3W2DL 1NL0H 5EIVA 1BQSA 5GGTA 1G7QA 2UVEA 2YA1A 5C71A 2VAAA 8FABA 5LGKA 4I4WB 1RZJL 5IJVA 3MJ9H 4HXAH 1GGCL 4J2XA 4K94H 1JPST 1Q9KA 1A7NH 2KQMA 5KSBA 1DBBH 1S8DA 3FT2B 3HG1D 5HHOB 3F6IA 3NACH 1QRNA 3HA0A 2YKLL 1ADQH 2X4TA 2BMKA 3REWA 1EHXA 2DQGH 4MQXC 4LCUB 1FJ1A 5J1TC 5DEFA 4FTVB 2V2XA 3PXHA 4IS6B 4WI6A 1R0AH 4Z7WE 2D03H 3LKSB 5IESH 1XGYH 1F45A 3HR5A 2W0PA 3UC0H 4ZAKB 4PUBH 3O8XB 4G6KL 1WIUA 1MJ7H 5D8JL 1QSFD 3KR3L 5JQ6L 1FGNH 1U8IB 1NL0L 1PGRB 4JPVH 3UPRB 1T3FB 3VD4A 3MJ9L 4RDQG 3VRLF 1I1AD 3AY4A 1A7NL 3EYVB 1SEBB 4PJEF 1BD2E 3NACL 3T4AA 4OGXH 4Z7OE 4ZYKA 3LRHA 2ZG3A 3DGCR 2MQ3A 2W07A 4FQJH 1KIQA 3KDMB 3IF1A 2DQGL 5AUMB 1J8HE 1RJLA 3KPSA 1CXKA 4KAQH 3GMQA 1HH6B 3U46B 4RGNC 1S7SB 3ZDXE 1XGYL 5CCKH 1NAMA 2CQVA 4OAWB 5FYJD 3S4SG 2QSQA 1UG9A 4TRPH 4PUBL 3AAZA 5L2KE 1MJ7L 1CXLA 1I7TB 1FGNL 4O58H 2OI9B 4I1NB 3O45B 1A8JH 1H5BC 1MELA 3GMPB 5FM4A 3JWOH 4KI5E 3INUH 2P45B 43C9A 2ZCLH 1UZ8B 3L6FB 2W60B 1B4RA 4H88H 3ECBA 5EWIH 1JPFA 2EEDA 4Y16A 2OJEA 4OGXL 4Z7QF 1EHLL 5K59F 4NYLA 3F7YB 1K8IA 4LHUA 2NLJA 2YEZB 4MHHG 5TDOA 4L1DA 4KAQL 5MI0B 3KPMB 4LLYA 3ULVH 4HBCH 2K3TA 5HGAA 5CCKL 4M48L 3FRUA 4X99B 3E3QA 2IFGA 4TRPL 3V6OE 3VRJA 1AIFB 3MFFA 4F7TB 1CLOH 4GJTB 4MDIA 3TBTA 1VHPA 4CU6A 3MRDA 1S7QA 4Z5RB 2VDRH 4LLWA 5D1ZD 5EWIL 4JZJC 3RWEA 2GJZA 1CTOA 3P11H 1ZANH 3DUSB 4R4ND 2VLKB 5EU5B 1D9KA 1T4KA 4V1DB 5ID0A 4GKNA 3FRPA 1XF1A 3HG1E 3B8YA 4YDLB 1EUUA 1WBXA 4MMXC 3VFTA 1A6UH 3OBAA 4POZC 5KG9B 2X5PA 2QADB 4XCEA 1LK3H 4YAQA 5FUCE 3RDTD 1A3LH 1CLOL 4LQ1A 5TDNA 3S96B 4HIXH 5J8OA 1IMHC 1N6UA 1ZXQA 2DQEH 1WCBA 4KPHH 3LH2H 4G8GD 4L9LB 1YN7A 3ZHKA 5GRVK 5BZDA 3P11L 4OSUH 4WVRA 2M1KA 5CZXC 1CFNB 1ZANL 4I4WA 4YBQC 5T3ZD 2DWDA 5C08B 1Z9OA 2ED8A 1EGJH 5HHOA 1O7SA 4JCMA 4HIHA 4N9GB 3SGJA 2HFEB 1A6UL 4OGYH 3RI5K 1LK3L 5GS1B 4LCUA 1NANI 5E6YA 2AXHA 1A3LL 1B6UA 1RQ5A 1ZVHA 4QWWD 4FTVA 4IS6A 1TPXC 3B9KB 3D85D 4QYOA 5FYJE 1A3QA 5F70A 5KVMC 4JQVC 1UJTA 4ZAKA 5JHDE 3OL2A 4WW2B 5L88H 5IFJA 3O8XA 2CO6B 2FATH 1VGEL 4KPHL 3LH2L 1U8IA 3G5YB 1JFMA 5SWSB 2BSSB 4QOKD 1A7QL 4M3JA 4YFLI 3EFDH 4KJPC 3VCLB 1SEBA 1K6QH 5TE6H 5EC2B 5ADOH 3QISA 1IFHL 2R2EA 5D7JD 5F1NA 3WNLA 3WIHA 4WV1B 4PD4J 3LKQB 1T1XB 3DTXA 5L8KB 1NGWA 3IKCA 1UH2A 3O81A 4DAGH 1QSZA 3U46A 1CG9B 4LP5A 5T1KB 4HX1B 2NY0D 5DGQA 1ZKAA 1VEOA 2VDML 3MRIB 4M5YL 2ZCKH 3FQUB 4XTRD 4URTB 4HUXA 2FATL 5D7KE 3W5MA 5D7IB 2FX7H 5H94B 3P4OA 4LFHG 4K9EH 4RX4D 3O45A 3GMPA 5D7LD 5KVEH 5ACZB 4HKBA 3MYJA 3LKPA 2P5WB 1VFAB 4XZUB 3K2MC 1G7LB 1URLA 1CDGA 4WWKB 1FSKC 3QPXL 4JPKH 3ROLA 2R2CA 3GJFB 3BD3A 2VLJD 3I3DA 5DUPL 2H2PD 4GS7B 3MGAA 4PJIF 3BH8A 2W65A 1P6AB 3KPMA 3LSOB 1OB1B 3EOYG 3UJJL 5EULV 4JRXA 2BK8A 4X99A 1XGPB 3GIVA 2MSPA 2ZCKL 1AIFA 4CVZA 2FX7L 1KXTB 4N1CA 2X2YA 4QTIH 4JR9H 5DQ9B 4K9EL 4LMQE 1F4XH 4P57B 5IHBA 4N0CD 4BYHA 5KVEL 1EFXD 5HYFA 4NZTH 3W82A 3KPLA 4XPFH 5AZEH 4HPYH 3C6SA 3QUYA 3QIWC 2WK2A 3EO0B 1J18A 3KYOB 3QQ9C 2ARJB 3DUSA 5K9JL 2GAZB 1UWXK 2VLKA 5EU5A 1OGTB 3ZE0F 2MHAA 3F62A 4S1DD 4V1DA 1CXFA 1G9MH 1MY5A 2VABB 5BZWA 3KXFB 1IGJB 4Y1AE 5KN5B 1WTGT 1E0OB 4BFBD 1AHWB 5L6YH 1MQKH 2Z4QB 1IM3A 1MRCL 2IG2H 1LP9E 3BE1L 3EJZD 3KPRA 2PO6D 4PJEA 4J7RA 4MAYC 4QNPE 2XA8L 1TFHA 3KPNB 1BWMA 4AIZB 5I8EB 1YNKL 3VFGL 2QJDA 1F4XL 1EXUB 3JWDH 1CD8A 3HUJA 4JN1L 3QG7H 3QCVL 2PUQT 4PV9B 3SGDH 1BZ9B 1DL7H 4MHHI 3X12A 2EDKA 4H8WC 4UV7L 5CEZL 1S7WA 3MUGB 4UT6L 5EN2A 2NY2C 1WQVT 2C4FU 2VJXA 3VW3L 2X40A 1IAMA 4OQ1A 3DVNA 4NQXA 4OB5H 1CFNA 5T5NG 5C08A 1KT2A 4OUOA 2QSCL 3DXAB 1CU4L 4OLEA 5HGBA 4IJ3C 3QH3A 3WNNA 2HFEA 3GSNH 1JNHB 3PHQB 4N5EA 5KAQF 4TUOB 5L6YL 1MQKL 2EXWD 4D0DA 1O7VA 5GS1A 1CGVA 4NO0D 5DFTA 2DQJH 1S9WB 3VXNA 3BMVA 2Q20A 4QXUH 3RX8A 5CSGA 4QRTA 4ONFL 1U8JB 3ESUF 1KB5A 4FNLH 3FB7A 4JEGB 5FO9A 1OCWH 3QG7L 4FZ8H 3GM0A 4BZ1H 5IMLB 3QQNA 4BUHA 3GUTA 1MJUL 5D7LE 3HCVB 2IPUG 4PJHE 4OB5L 2HAZA 1EIBA 3P73A 3P9WB 1RZFH 3V8OA 5DMKB 4PGBB 3NCBB 2FO4B 3TT3H 4PFEA 3TYFB 4UUJB 3HKFA 3GSNL 4OI7A 1S5IH 1T1XA 1AE6H 1JPGA 2VLJE 5HD8D 2JCCF 2W92A 2P5EA 1MRDH 3NZHH 1FZKB 2V9TA 4YFLF 1RUPH 2DQJL 3V7MA 1CG9A 4HX1A 4JFDB 5I74B 1CDJA 4J4PD 5A3IC 5JIPA 4D8PB 5F72S 4FNLL 3VGDA 1MWAB 3MRIA 1OCWL 2XKSA 2YHGA 4ZODA 4AEIL 5H94A 4EI5B 1Y0LB 4X7SH 3IRZA 4AQOA 1FL3B 2KKQA 5ACZA 5LQBH 3JZ7A 4K8RH 5J6HA 2LAAA 1VFAA 4I3SH 1RZFL 4XZUA 4EN3C 2IADA 1MIEL 3ARGD 3D6GA 2FLBT 1NFIB 1PQZB 3T4YA 3TT3L 5TDPB 2NY6D 3SPVB 4NO2B 3WFEH 3VXSD 1AE6L 5C8JB 2BSED 5ESVB 3NZHL 1DQDH 3ZDYF 5JW4Q 4LK4A 3LSOA 4NBYB 2XFXB 4S2SB 2A1WL 3QI9C 1UXSB 2YUXA 4PGCB 5GZOC 2YSSA 4KZDL 1XGPA 5FHAL 3N9GH 1WC7B 2CK2A 3L3OA 4ZOEA 3GI8L 5FYKU 3DARA 5HHPB 4R97C 4OLWH 1RIUH 4XP4H 4K8RL 1IEBB 1Y6KR 4RDQF 3ES6A 3MRPA 1RUKH 1FN4B 4HKZB 3G5ZB 5HDLA 3EO0A 1I8IB 3GMNB 3Q6FB 4WNQB 4HCRA 3SJVB 3KNBB 1BQHG 1OTSD 1ROWA 1OGTA 2JJUA 3MLRL 4BH7A 4FXLA 4PJ8D 1KFAH 4HW6A 5D2NB 1DQDL 1I9JL 3V0WL 5L0QB 3TNMA 1BGXL 4M6MH 2B1HH 3G5VB 3MUY1 3ESVF 4LVHB 1AHWA 2GK0A 3CH1A 2Z4QA 4U1JA 1MCFA 5FAAA 1KJ3H 4KY1H 1M4KA 1J9CT 3MCG1 3N9GL 4NNYA 3KPNA 1RMFH 5I8EA 3P0YL 5IJKC 3C5ZD 4PJ7E 2G2RB 4OLWL 4YXKH 5C09E 4XP4L 5DC0A 3TA3D 4P23D 1BZ9A 4L29B 1MCLA 3RWIA 5B38A 2CRZA 1FIEA 1RUKL 2RAMA 4DVBB 3ALPA 3I02B 2XZAL 2NXZD 2DBJA 5FGBC 3L3IA 4RFEB 5EO0A 2ZOLB 5CEZD 3CH8A 4RFNB 4PDCE 1MCRA 1UJ3C 1SJEB 4ZQKA 3HE6B 2J8UF 4M6ML 3PHQA 2B1HL 3S88L 1QBAA 4KY1L 4HULB 3T2NH 1S9WA 5BQ7A 5C9JB 1NPUA 3HZMA 1RMFL 3QI9A 4ODBD 3U36A 1JUFA 2F53A 3L7FA 1I8LC 1QUNA 4Q9CA 5ISZE 4GRLB 1KLFA 2V7NB 3SDXE 2X1XR 4FQPA 1IGFH 4BZ2H 2R1YB 3T04D 5FOBA 1P4IH 1UB5B 1RK1B 1PEZA 4Y5YC 1RUML 4PGBA 5F1OB 3V5HB 1QQDA 3TYFA 1NGXB 2VLMD 2W59A 2VQTA 2APVA 4YXLH 2ITDB 5HJ3B 4HSQA 3T2NL 3MQIA 1FO0B 3SY0B 5I2IA 1IM9B 1PDKA 2HLFC 4JFDA 3BKJL 5SX4I 1GRWA 5LXGH 4LSPH 5I73C 1MWAA 2CLRA 5E00B 1EA9C 3L5IA 3KYMB 4NQEB 4G43A 3MBEB 4K71C 1YMMB 5IJKA 3ARQA 5I8OH 4JFXA 2DYPD 2ZKHH 2HMIC 1H8NA 1P4IL 3TZVC 1NFIA 4LSVH 1PQZA 2AK4E 3CZFB 3HC3H 5TDPA 3LMJL 5FDWB 3SPVA 4DTGL 3DI3B 1SEQH 5TFSH 3BDYH 4WFGD 1UJ3A 1AI1H 5TGBB 5J11C 3O11B 4CADB 5JUEH 1N5AA 4WI4A 5C0DB 4S2SA 3H3PH 3O3BB 1DQLH 3W9EB 1MI5B 2VZSA 4GXUM 2QTEA 1MAKA 5DJAA 4P46C 2KQNA 1Z2KA 1EHNA 3DRTB 2ZKHL 2EDQA 1BFTA 1TVHB 3GBMH 1LGVA 2CH8A 4U31A 4YPJA 2F15A 1J7VR 4HKZA 3G5ZA 4LSVL 3TN0B 3U79A 3WN5C 3HC3L 1MFAH 5I1AA 1FZOA 3SJVA 2A9MH 5CEZE 1C5CH 3KNBA 1I3UA 1FGVH 2VLRA 1QPPA 5JUEL 3G5VA 4LPVA 2BRRL 2I60H 2BZDA 3LPGA 2GSIA 1U58B 5KS9E 1HYRC 1HILB 3K81A 5FCSH 5KSAD 3OZ9H 4NQCA 3QDJA 2JCCA 3MV8E 2G2RA 3GBML 3LQAL 4JKWA 3MODH 1YEJH 4Y4HD 1LD9A 1W0VB 3ARBB 3WKNA 4XHJD 1MFAL 3P4NA 3NIGF 2ZOLA 1C5CL 3BKYH 1JTOA 3TBVB 5EB9A 4TSBH 4Z78B 1RAMA 1FGVL 1SJEA 3RFZC 4F37K 2VLME 3K80A 5E2WL 4CNIA 1G7PB 5JXEC 1CXEA 4H20H 4R3SA 5E9DB 1R3HA 3QDAA 5E56A 4HKXB 4FQXD 5KSVA 2CGRH 4MNGA 5IK3A 3L5WB 3WXWH 1PG7L 4P5MA 1U8NB 1AO7A 1KN2H 1YEJL 3MODL 3QQ4B 5E6ZA 4B0MM 4P46A 2V7NA 1RHFA 4L3CA 2DQDH 3HTLX 3BKYL 1T1YA 1EAPB 2R1YA 5E6IC 2OZ4A 1SY6L 3UZEA 1ZHKA 4AL8L 2O5ZL 3V5HA 3VXPB 3RZWA 1NGXA 1QPXA 3B5TA 2DIAA 2IQAA 4PJ9D 2BNQB 1WEJH 2ZUVA 1T5XA 1ZVYA 2VISA 4ODSH 4YBHA 4OZFG 3VFSB 3ZKXC 3SY0A 1TJHL 4LL9A 1IM9A 3QO0B 5F71A 5GGTH 3O3AB 4PP2A 4G7YH 4BM7A 1IEAB 4IBLT 1KGCE 3K74B 3WXWL 5JW3H 4PJFF 1IGCL 2CIKB 5FO7B 4O2CA 3C09C 4LLAA 2DQDL 5T5NF 2OLDA 2APBA 3UYOD 3TESA 5C92A 3GO1L 4Q6IC 3CZFA 5FDWA 1WAAA 3WL9B 1WEJL 4M7ZC 4HZLA 4Q9BA 1CGUA 2FYYA 4BKLB 2X4RB 4M9PA 4ODSL 1GHFH 1V3LA 4HPOH 4G8FB 4OI9A 3O11A 2Y25A 1TVBA 5C0DA 2EZ0D 4U1HB 2R56L 3W9EA 1MI5A 4F8TA 5JW3L 2JB5H 1MFBH 1A6WH 1FFPB 3O4LA 1U6AH 4S1SH 3FFCB 5M95B 4X5LA 3DRTA 2UUDH 4E9LA 2DQCH 1AD0B 4YHIB 4S10A 4AK1A 1ZGLM 4M7KH 4HIEB 5IVZA 3TNNB 4HEPG 4KUCD 3PABA 1NAMH 4KHXH 3W0WE 3ARFB 2HA1A 4KV5F 2JK5A 2NXYC 1FYTB 4HPOL 3P9MA 4ZG1A 3MA7B 1JF1B 4IMLA 5F6HJ 3SE3C 3BWAB 4Y19E 5CD5D 2FJHA 3MRFB 2JB5L 4PRPB 5EOCH 1A6WL 5TF1H 2YOCA 1RJZA 3GSQB 1P4BH 3AM8A 4FQ2L 3ARDB 4HFWB 4UTBL 5E03A 3D48R 1P7KB 4N1EA 3VXMD 3GMRB 4MAUH 1W0VA 1S7TA 2ADGB 3OKYA 4CGTA 4ODXB 1I7RB 1EV2E 4WFFD 3JTCA 1KB9K 5EO9B 1NAML 4R90L 3OX8B 3TBVA 4BK4A 3RIFF 5IB4B 3WO3B 3MRHB 4TSCH 4JO1L 1AGBB 4P5KB 4Y2DB 4HZAA 5A43C 1E4XI 4U6VH 3TF7A 1G7PA 4NRXB 4L4VD 4HH8A 5DK2B 5EOCL 3HNVH 2J5LC 5E9DA 4EUPG 5TF1L 3RTQC 2I5YH 4YHPA 1P4BL 1X5HA 2IJ0C 3SKOA 3L5WA 3TH3T 4LF3A 2ADJB 4YGVB 3S98A 4BH8A 4NQVB 4M4PA 3VD7A 3VFPA 2R69H 3QDHA 2CDEB 3UPCA 1RZ8B 3HE7D 1FNGB 4ZD3L 2OMNA 4HS6A 4X5WB 4ZXBC 5HVHB 1LO2H 3VXPA 1BAFH 4KVCL 2A74B 1DZBA 4KH2A 2XY1A 4X7DC 4GKZA 2VXSH 3X11B 3HNVL 3O3EA 3O3AA 3MV9E 4TVPE 2I5YL 2LABA 4KGJA 5KW9L 1F02I 1KELH 2PTVA 3ROOA 4K3EH 3WDIA 4RMTA 4Z0XB 1OAZH 4GMSH 2CIKA 1NJ9A 2VL5A 5FO7A 1II4E 2ICWI 43CAB 1KPUB 5I1IL 4PJCA 1LO2L 4X6DE 3H7LA 2G9HA 3WL9A 5EDXA 5SWZB 1KBGL 3S3PA 3SDAB 1WBYB 5D93B 4G8FA 4X6CF 5KBNC 4ZUTB 3F7RA 2NY1B 3B2UD 1X9QA 2HT4D 3BO8B 4U1HA 3WJLC 1ZT4B 3U7WL 1KELL 3O6FB 3C6LB 1I1CA 3HI6L 4L5FL 2W9LA 2FO1A 1OAZL 1OT2A 3WIHH 3FFCA 5ACLA 1K3ZA 2E7LA 1U3HB 2IMNA 1ZLUK 1AC0A 4PBWD 3VXME 4OGAC 4LCWE 2D7TH 4Z7UB 1DDHB 4GAFB 4WFFE 3TNNA 5DJYB 3QUMA 4LNVA 3ARFA 1IILE 1S3KH 1AXTL 1FYTA 1BPVA 2DBLH 2DQHH 3CIQA 2I07A 3K8KA 2FSEB 3BWAA 5FGRA 2W1NA 3V7AG 3MRFA 5F7NC 1C5BH 4NT6A 4F7PB 3GSQA 1TZHB 5LGHH 3HI1B 2A6JB 3UTOA 3RP1A 4HFWA 2UY6A 2X42A 1HXYB 4LIQH 3GMRA 4OZIF 3BT2H 4IIQC 2Y06H 2HKFL 3Q0HA 1MCOH 5HI4D 1YYMH 1YEKH 4PJAE 4NRYB 5JW4R 1U8PB 1L6XA 1ZLWK 3OX8A 1S3KL 2AVGA 4OD2B 4O5LH 5IB4A 4LKXA 5C0CD 1YC8A 2W9EL 5CBAA 1JE6A 4YFDB 3WXVH 2DQHL 3AMLA 3MRHA 2B1AH 4JPWH 4OCMC 1AGBA 3LKNB 4PV8B 1L0QA 4MSWA 1IT9L 3QCUH 1T5WB 4N0YH 2FB4H 5DK2A 5DJ2B 1JCKA 3Q5YA 1C5BL 1Z9SA 3NAAH 1KCGC 1WFOA 4ZNCD 3KJ6L 4P2OC 1I3GH 2N7BA 2P47B 1HXMB 1YPZB 4H5SB 12E8H 1CICA 3OB0H 4Y16D 5E2TL 3STLB 4LIQL 5HYJE 4PJBF 4R96B 3RL2A 3RZCB 2R9HC 2D0FA 2AJ3B 3SKUD 1FVEB 3VFRB 3TO4B 4KTDH 5EA0H 5CLWA 1ORSA 4O5LL 4OV6F 1OY3B 5EBMB 3U83A 5TF0A 2CXKA 2X7LA 1T2QL 3WXVL 5J1AA 2B1AL 2Y6SC 4JPWL 5I1HL 3BFOA 4XCNA 4TQEL 3VXOB 3QCUL 3QZWA 3KLSA 4N0YL 4KK5C 2FB4L 3UDWA 3JSSA 3NAAL 5EUOF 3PGFL 4JG1H 3RI5F 4PJ5D 3VH8A 1I9EA 1ZEAH 3MLYL 5BVPH 1BZ7B 3BISA 2FHCA 3CPLB 5D1QC 5A1AA 1NCCL 4F15C 4JVUA 1D9KD 4KRPC 3CLFH 1H5BB 1QR1B 1IC7H 3CUPB 4RAUB 2Y23A 3NIDF 3TVMC 1B9ZA 2PYEA 4XCYB 3BQUC 7FABH 4MJ5A 1CR9H 3V4PH 3D0VB 2AJSH 1OHQA 4YFEA 1KB5H 3M17B 2X10A 4QF1B 3BZEB 3QDMB 1WBYA 3R06B 2AJYH 5IHLB 1XGUB 4LDLB 2H45A 3LD8C 2J8HA 5IMMB 5DEZA 1J0KA 2LVCA 3I6LD 2A0LD 4JG1L 4Z18A 4DVRL 1Y18A 5IG7B 1ZEAL 5BVPL 4O00A 1MFNA 5TH2B 3MBXL 3W11C 5I76B 4M1GH 3CLFL 4YHOL 1IC7L 1S7XB 1OD9A 1PLGL 1U3HA 3O6LL 5HHOD 1R3IH 3MRCB 4NRZB 4X98B 3QNXB 4Z7UA 4R4FH 1DDHA 3H9SB 4JZJB 3V4PL 5EZIH 2AJSL 4ETYA 2D7OA 1KB5L 1IE5A 2ERJB 3ILQD 4FTVD 3OJDA 2H32H 1AGDA 4FFVD 2AJYL 1NCDL 5C0CE 2CKBA 2LU3A 1KXVC 5B3NA 1F3RB 4ZAKD 5TQ0H 3O8XD 1EAJA 1XF3B 1A6ZB 1FNLA 1HNGA 1Q9OB 4H8WH 3PWUA 5DMGD 1RPQA 4MD4B 4F7PA 4JKPH 4M1GL 1TZHA 4I77H 4OD1L 3ALXA 4DJMA 1HXYA 1NFDB 3F7VA 4W6XB 1Q72H 1KNOB 4ORZC 2C7UA 3DX6A 4ZSOB 5EZIL 3RUGB 3IB4A 5IB5B 1QP1A 2G5BB 4NRYA 1V05A 1PSKH 4N0FA 1U8PA 4OD2A 1W72A 3E3QE 3U4AA 1HKLH 3THML 1ZT1A 1A4JB 2VKWA 1G1YA 1A7PH 5EZJB 1T5WA 1I1RA 1ETZB 4QEGA 2UZYB 1A7OL 4EQ2A 2IPKB 5LAXA 5HHQA 5F7KC 4PJ5E 4JKPL 4HCRH 2XWTB 3IDMA 3EYSH 4I77L 5D5ME 4J8RB 3STLA 5HDQH 1Q72L 3RZCA 1R5WB 4OZGA 3LCYA 2IALA 2AJ3A 1PY9A 3DWTA 4PRIA 5HDOA 4Q9RH 5C07B 1U9KA 1WZLA 1VA9A 4ZDHB 1HCFX 1L0YA 5DI8B 5EBMA 4WU7A 2RJMA 2VDKH 3DVGB 1SVZA 5FYLE 3AVEA 1CLCA 3GJEB 4CJ0A 2CXGA 2F54B 1UT9A 5C9KA 3RPIB 4HT1H 1A7PL 1MHHB 3OKMB 1EEYA 1H9VA 3EDEA 2A6DB 1I4FB 2K9UA 2CIIA 5C2BH 5LWYL 5JW4N 4GAJL 1FCGA 2E9IA 3QUYD 3V2AR 1G7JB 3EYSL 5KVDL 1BZ7A 1HHHB 1JBJA 3V4UH 3CPLA 1YEIH 1QG3A 5KVGH 5HDQL 3DRQB 4OCYH 1OSPH 5DD0L 2VLKD 3GK8H 1JGVL 1QR1A 3CUPA 4V1DD 4RAUA 2LV4A 1XGQB 4Q9RL 3A6OA 1P6FA 3UTQA 2CKNA 3WO4B 2XN9E 1FSKB 2VDKL 4P2QB 2QADD 3SQOL 4Z7VF 2YPKB 4I3GA 3WFBH 3M17A 4C56A 4FTVE 3BZEA 1UZ6F 1H3WM 1VEPA 3R06A 1Z3GH 4OZIA 4RWHA 4EIZC 1GGUA 3C8KB 5C2BL 2EYTB 3MSPA 2X4OB 2AQ1A 4FG6C 4XPBH 2ESVA 1KJVB 5E2UH 1QSEB 4GFTB 3V4UL 5KVGL 3T2PA 2XPGA 1J11A 4OCYL 1OSPL 5C08D 3VWKC 1MCBA 4DK3A 4J23A 5GJTH 4W68A 4NRZA 4X98A 5IBTH 3QNXA 2HLAA 4N5ED 3T65B 1CFVH 5F7DA 4N90E 1DFBH 4JHAL 3TCXA 3QG6B 4WHCA 3WFBL 2B0SL 3UTTB 1MWAH 2EEBA 5F7EL 3C9NB 1Z3GL 1QD0A 3B9KD 4U05A 1NGZA 5DLMH 3VFVB 3QDGA 2EDBA 4F80A 2X4NA 3H42H 3N1QC 1JK8B 4JDVB 1T1ZB 2XQBH 4MZ3A 1EVTC 4YEEA 4XPBL 4MAYB 1Q9OA 3KGRA 4M1DH 3JV5A 5SWSD 5ID1A 4G9FB 4MD4A 3I75B 3ISWA 3S9DB 3ARXA 5C0JB 3CDYA 4M02A 2DQFA 4LASL 1CVSC 1F42A 3MLZH 3BPLB 1Z5LA 1QLRB 3FO1A 1ND0A 2X1QA 2WZPD 4Y7MA 1CFVL 4NNPH 4ZSOA 3RUGA 1DFBL 2RCSL 2G5BA 4X9IA 1VERA 3OR6B 4GAYB 1MWAL 3IFLH 5DJCB 3GMLA 3KPPA 2OTWA 1HZHH 4HUWB 4MX7B 2HN7A 1ED3A 3QEQA 3WIIH 5EZJA 3WS6C 2DDQH 4LHQB 1YNLH 2R39A 4BFIB 1BEYH 3VG9B 2OL3B 2P5WD 4ZUWB 2DRUA 4NQDA 1D5XA 2XWTA 1JNLH 1HHKB 4WWKD 3KWWB 4J8RA 3HHRB 1IJ9A 2VLKE 1JGLH 1TXKA 4PRHB 4NNPL 1Z0MA 5D9SA 4MVBA 4M43H 4DQOH 4K3HA 1CCZA 2EDHA 1R5IA 4ZDHA 3D0LB 3IFLL 1QEWB 1EZVX 1YNTB 5DI8A 1FORL 2R2BB 5GJSH 2V17H 2YN3A 3DVGA 3LEXA 1HZHL 3GJEA 2F54A 4NJAH 4JQXA 3WIIL 1OGAB 1NEZG 2BSRB 4PBVC 2A6DA 2BNRB 1I4FA 4D9RE 1BEYL 2CO7B 3MCKA 3U9UA 3DMMC 1IC4H 2KH2B 4LGPB 4GRWF 4JFFB 4P59L 4OZFA 3R8QA 5DDHB 2GITB 1HHHA 2LFGA 5CJBA 1QR4A 4I0PB 3C60C 3DRQA 4ISVA 3QIUB 4OD3H 4LVOC 1JGLL 4PG2A 3MRKB 4M43L 3KXFD 4EN3B 4F9LA 2RQ8A 2EDYA 3SO3C 4AM0A 2YPLE 5FEBA 2V17L 3UTSE 1R3LB 1OP5H 2BOCA 4U7SA 4D94A 2V2WA 1Q9LA 2VR9A 4M7LH 3EYQC 1OAYH 4W81A 3VA6A 2UY7A 5E1HB 1Q1JH 1VB9A 1ITBB 1UYWL 3ZYJA 3WNKA 3WFHB 3O0RH 1Z9LA 2EYTA 2X4OA 2CMRL 1JGDA 3HS0B 4G6JH 1KJVA 2YXFA 2OZ4H 3ULSB 5SWSE 2MMXA 2VAJA 2UWEF 5DHYB 1NGPH 1G7IB 1VGKB 3DXAD 4XXDB 4O2EB 4NN5C 3QRFM 3UMTA 1FLTX 2V7HA 2APWA 4JFYA 3T65A 2OYPA 4OZHB 3OXSB 1T6VN 3BXNB 1KF9B 1EMTH 2X1PA 2FX9H 1J10A 4IRJB 1Q1JL 1IGTA 2Q6WA 2YUVA 4NM8H 3CC5A 2YXMA 2Z91B 3LQZB 5D7IE 4JRYA 3QRGL 4G6JL 2FECI 4H25A 1OP3H 1AP2B 4B5EA 2OZ4L 3DROA 1QBBA 4HEME 1RURH 2P5WE 3FOLA 1EX0A 3I75A 2FEDC 4OM1H 4N8CH 5C0JA 5C0AB 1I75A 2ZG2A 1H3XA 3MZGB 1NGPL 3PWNA 3UPAA 5J12C 3VFMB 3SDDC 1YQ2A 2ED7A 1QLRA 5DO2D 1DQML 3C60A 4X9GA 2PW2A 1A7BA 5D96B 1CL7I 4LMQI 4XNZC 2WBJC 5GGRY 4ORGB 3RX7A 2J4WH 2FX9L 4P2RA 4JFDD 1BOGA 1KPRA 4NKMA 2L7JA 4NM8L 4TNVK 3L1OH 4W6YB 4MX7A 4PR5B 4WW1B 5KSUB 5C0FA 5HDBE 3FO0H 2V2TB 4QRRE 3S35X 5CMAB 8CGTA 4HXBL 4S0SD 1K85A 4PGDA 4WI5A 3RKDC 1RURL 4UMGA 3LZFH 4OM1L 4N8CL 1TETH 1BQLL 1AKJB 4LEOB 1X4YA 4HV8B 1ZA3B 4JFOB 4NN6C 2E7CA 4WDIA 2FL5A 2X4PA 3MGOB 4PRHA 2G60H 5DUMH 2J4WL 4HF5H 3KXFE 1A9BB 1IVLA 2X89D 4XXCA 5GZNC 5EORH 1NMAH 4QRQB 1QEWA 3G9AB 1YNTA 5BW7C 4U1IA 2AEPL 2BOBB 4IRSB 4KROB 3L1OL 3ZL4L 5CUSH 1ZS8A 3K2UL 5DA4A 4JREB 4I48B 1J8HB 1FVDB 5JXAL 2AXGB 3FO0L 3GRWH 4Y4KA 4GBXC 1S78D 2BSRA 4ZO9A 4F37F 2BNRA 3ZE2E 4HJ0D 3BX7C 3UJIH 4JFFA 1L7TL 1KPVB 1TETL 2YZ8A 5DDHA 5B8CC 2GITA 4EXKA 4I0PA 3SE4C 1TCMA 5ADPL 3DETC 4G6MH 1P9MC 5SV4A 3SJVD 1INEH 3FN0L 4CN1A 3LB6C 4I0KA 4P9HH 2G60L 4C83A 3DXAE 3TGXA 4HF5L 1U8HA 1U92A 3UBXB 4TPRH 5FIEA 1OM3H 4OBRA 4K7PH 3T3ME 1R3LA 3PWJA 4MNQE 5DYOB 5CUSL 3GSOB 2YPVH 4LSQH 1SYSA 2APFA 4KK9D 1J1OH 1T7WA 3EGSB 1Q0YL 2WV3A 2J12B 2X9YA 4NQCD 5GGUB 1DBMH 3WFHA 4MJIA 3T77B 4NZDA 3HC0B 1NCWH 3QIBC 3UJIL 1QA9B 3K4ZA 1L6ZA 5IT2H 3B5GA 4M6OL 3P30L 1K4DA 5I75C 2IMMA 3RWJB 3GSVB 2ITCB 3STZB 4M93B 2MKWA 4G6ML 1INEL 4KJYA 3PHOA 4YE4H 4Z76B 5DHYA 2BCKB 4P9HL 3V95A 1VCAA 1F3JB 3BN9D 3VU2A 4XXDA 4O2EA 3HE6D 5F7WC 3VA2C 3WN5B 1AGCA 1RHHB 3CMGA 4K7PL 4OZHA 4XNQA 4YDVB 5E8DL 4BA8A 3S37L 4LSQL 1JZ2A 2FD6H 3VI4E 1AXSB 1OVZA 1JI1A 3T2QA 2EIDA 2Y72A 5JPMA 5CBEA 2NY4C 4JFDE 4F7EB 4LCYA 3NIFE 2ORBH 2WINB 3C5SA 5DD5L 2P8LA 1NGQH 3TWCL 3MTRA 1JZ4A 2Z91A 1CYGA 1NCWL 3LQZA 3PIQA 1AO7D 5HI5D 1MRFL 4GBXA 4GRLD 3ZZ1A 1NDMB 1XIWC 1OTUD 3OTTA 4FQCL 4XBPB 4KI5C 5DJ0B 2QSTA 5C0AA 3CGTA 3MNVA 3VFMA 3RWDB 1NAKL 3A6BH 3CVHA 3ILPB 4TUKL 2EYSA 2IWGA 3SE4A 1JGEB 1P9MA 3HFMH 1DSFL 3TYGH 5DRZA 3DECA 5T3XH 3DYPA 4KKCC 2X1WL 1YY9C 4ORGA 4WI8A 2I9LB 1RZGA 5JPNA 1IM9D 3TFKC 4FS0A 5B3JF 1E4WH 1XGRA 1TZIB 3PNWB 3ARRA 4EOWH 2DQUH 1NGQL 4PR5A 1J05A 4JGJA 4PY7B 5F9OL 3NPSB 3V6OC 4NQED 5CMAA 1YMMD 1X7QA 4Z7WA 2NY5H 4UDTA 3PWLA 5IMKA 4K3JH 3QIBA 3O6KH 5JHDB 1TNMA 3DPBA 3P2TA 3QUMH 3VFNB 1EHAA 4OJFH 1CQKA 3H3KA 1JGUH 2IPTH 4LEOA 1T1WB 5F9AC 4HDIA 5IHUH 4G5ZH 5LGJB 1ZA3A 4JFOA 7CGTA 2P8PB 3HFML 3GSRA 3HPLA 3TYGL 3MGOA 4M6NH 1VFMA 1N3NB 3GMOA 5D1XA 4KTEH 5D2NE 4OIIH 1C5DB 2R1WB 1FH5H 4M7JL 4A2LA 4QRQA 1E4WL 1BD2A 4WI3A 4I18C 4CAGA 4EOWL 4HG4K 1MI5D 1H3PL 3L3KB 4I48A 5LCVH 1J8HA 4V2BA 2EIBA 1MJJB 5DQDH 3L3JB 2NY5L 3GFUA 4LLMA 4ALAH 4AEHL 1E4KC 5IROC 3O6KL 4ODTH 3OXRA 4H0HB 1MCEA 5L2KA 4OJFL 3TN0D 2EIEA 2IPTL 1S9XB 5HTSA 1RK0B 1ZT7A 1TTFA 4G5ZL 5SX4H 5DS8A 1PFCA 3LEYH 4HWUA 4YBLB 4Z77B 1I1AC 5DJ8A 4OIIL 1FH5L 3N1PC 2R8SH 4JFPA 2IH3B 1WIOA 3UBXA 4JFZH 4PLKD 3BPCB 5LCVL 4UZGA 3EGSA 5DQDL 4L4TB 3BHBB 5JOEA 15C8H 2R15A 5GGVL 3V6OA 3KJ4B 3PHSA 3HNTL 1DUYB 3ARBD 1LDPH 3GSVA 3Q1SL 3LEYL 2P44B 2VRAA 4KMTH 1TITA 4OFPA 5CSBA 3D25B 3ZTNL 1CQYA 1GPOH 2CLVA 4YDVA 3IJSB 5CIPB 2ZUQC 1A64A 1OQOA 1DLHB 3R8BB 1M6OB 1UACH 2C9AA 3DGGB 3BAEH 3HG1A 4F7EA 5A2IH 5E9DD 4JKMA 5BV7B 4XPGH 4Y1AB 4H1LA 5ILTL 3L9RB 1GXEA 2R23B 2OK0L 1EUTA 3H9YA 1LP9B 4NQEE 2QQLL 3B5HA 4KXZH 5MERB 1YMME 1LDPL 1PG7W 4HAFA 1GGIH 4FFWD 3LS4L 3PJSB 4XBPA 2E3VA 1JI2A 4IRZH 3PE9A 5IROA 3M1BA 4U1GB 3WD5L 3RWDA 3SCMB 4HLZG 5D1ZC 1WAAE 4KK8D 2BNQD 1PBYA 4R4NC 1XR8B 3QHFH 5DWUH 1FAIH 5DHVA 1I1AA 4O51B 1UACL 3MRLA 1Q9WB 4LQFH 5F9JB 5HI3D 3TBWB 3ZKSD 3PNWA 5EOTB 2R4RH 3W81A 1CE6A 5IW6B 4PY7A 3GSXB 3RDTC 5HYIA 1RFDH 3TV3H 5JOFB 2ZNWA 3MNZB 4WHTA 3QO1A 3DO3A 5K9OB 3G6AB 1M7DB 5JHDA 5C2UB 1PZ5B 4YO0A 4PTUB 3VFNA 1CGTA 5FHBH 5LGJA 2CKBH 1VPOH 4PJHB 3VFOB 2GUOB 1EO7A 3RVTD 3QHFL 5DWUL 3WLWD 5D70L 1GZQA 1UC6A 1FAIL 3FO9B 4NKDB 3MJ6A 1C5DA 1J86A 1F6FB 2D3VA 3CFDB 4LQFL 1RZJC 4ZXBB 4BFEA 3RBGA 4TUJB 2YD7A 5D2LE 2R4RL 1IZJA 3DHMA 4UIKL 4CMMB 4OT1H 3WUZA 3SGDI 3OB0K 5DXWA 3UCRA 4C4KT 4QWWC 1MJJA 2NW3B 1HHJA 2YC1B 1MREL 5JORB 1NUFA 3FFCD 2ED9A 4TSAH 3TV3L 5E0QA 4LOUD 3AB0C 3DURB 4U1LA 1HINL 2GSGA 3PWVA 3VXTA 4HUVB 1ORQB 2B7DT 5DJ6B 3UROR 1G6RB 1RK0A 1AD9B 1W72H 2CKBL 1KJ2B 1YMHA 3HAEB 3NCEB 1VPOL 4R26L 3ARFD 4Z77A 3R1GH 1BX2B 1FE8H 1FYTD 1QFOA 4Z7NF 3TIDB 5D1ZA 3X3GH 2IH3A 5D7JC 2VLLB 5BVJB 5IHZB 5CZKA 1U8KA 1HI6A 3MO1A 3BZ4B 3LKRA 5MENE 4ACPA 2L7UA 2NZ9C 5DFVD 3BPCA 4GH7B 4PRPD 2OXGA 2IBZX 1X5YA 2NY0C 1F11B 1E6OL 5CJXA 3ARDD 3QUKB 4AZ8A 1ZGLA 4XTRC 3OB8A 4JM2B 1A22B 3SBWC 1FNSL 3HPJB 4WI9A 3T0AA 4ZFFB 3MGTA 1W72L 3MLVL 4DCQA 2YWYA 3UJTH 1PZUB 3BP4B 3R1GL 1FE8L 3MNWA 3F7QA 1EEQA 4JAMB 2WWKO 2W38A 2BNQE 3D25A 5MHSE 3G6JF 4MDJB 2DM4A 4W6WB 4Q6YA 1LNUB 3UZVB 5CP7B 4Z0BH 4QHNB 2H2PC 5IBUG 2RBLA 4L8SC 1J1PL 4WGWB 3WUWG 1INQA 4Y1AA 2XZCL 1CD1B 1EZVY 3E6HB 1U8OA 3HB3D 3H7BA 2E9BA 3MPCA 1CICD 2NQCA 1LP9A 4X4YA 2DL2A 4R6UA 4WTXA 4XVJL 1SJXA 3D85A 4KGLA 4YNYA 3ZHDA 1HIML 4N0CC 2EDNA 3PJSA 4PJ7B 5LBSL 1RUAH 5F9WC 1LEIB 2E8ZA 5C09B 3C87A 4G9DB 1TDQA 1QRKA 4HD9A 3CCHA 5M94B 4IIQB 4WGVB 1XR8A 2QR0B 4Z0BL 2NZIA 4S1DC 3QHZH 4O51A 1RJCA 1RZKH 4OCWL 1Q9WA 5D7JA 2KDGA 5EOTA 1XF4B 3ZDZE 1PX4A 2AEWA 1EO8L 1RVFH 3QQ3A 4RFOH 1KN4H 3EJZC 2PO6C 4JFQA 2E7LE 1MAMH 5JOFA 2NR6D 3DIFA 5C3LD 1D3CA 4P2OB 1E4XH 2PYED 3G6AA 1RUAL 4LNRB 1M7DA 4MA1C 1PZ5A 4PTUA 5DQJB 1FG2B 3BD5A 5ISZB 4OFKA 4EIGB 4H26A 2UYLA 5D7LA 3TPKA 4PJHA 4JANB 5SWZD 5JNYB 1IAOA 2GUOA 4HK0B 3SDAD 1FYTE 4N8VB 3QHZL 1RZKL 1LQSR 1JNJA 4NKDA 3IAQA 2WIIA 2NY1D 1OAUH 5JDSA 3MR9B 1RVFL 2ZUTA 3O6FD 3C6LD 3VFWB 3WJJC 4L8SA 4PRPE 4R8WL 1HSBB 5GIRB 2NW3A 1SBSL 1AGEA 4HIJB 3VI3E 1MAML 1U3HD 1X5AA 5GRZA 4U6HB 1J8KA 3IS0X 1ORQA 1T22B 5DJ6A 2LAGB 1U91B 1G6RA 2AXJA 3SDCB 4LU5H 5D1QB 5EUKB 1EFXA 4KRPB 3MA9L 2AS5M 4JG0H 4TVSa 1UH3A 1TCRA 1H3TA 1L9NA 1JPSH 5FK9B 1IAKA 1FZMB 3TIDA 1ZHLB 1OAUL 1OAQH 5IHZA 5BVJA 5ESAA 5HD8C 5CSZB 3PQYB 4JZOB 4BUGA 4DGYL 2QQNH 5IGXH 5MEQA 4PJGF 2V9QA 1I8MA 1CI5A 1U36A 4FP8H 4J4PC 4U1NB 1NLDH 5GRXG 1N4XH 3LD8B 1NSNH 2PO6A 5J0BA 1HK6A 4JM2A 4X6CB 4XC3H 2EO1A 1VESA 4ZFFA 3O4OB 4HWEL 4JG0L 4FXKA 5A16B 3ARGC 5EU7E 1B0GA 4FFEX 4L9DA 2ZNXA 3PL6B 1J12A 2NY6C 1OAQL 4MDJA 4XP6L 5CD3B 4FXGB 1LNUA 2IAMB 4N0UB 4UU9B 5CP7A 2F8OA 1E6JL 4QHNA 1C7SA 2Z31B 5ICXB 4OZFH 5IGXL 2Z93A 4JLRB 2QQNL 5D6DC 3O6ML 2Z92B 5F88B 2HKHH 5HHXH 4FP8L 4YK4C 3E6HA 5HYEA 5I8KH 1F4WL 4YJZL 3WJJA 5F96H 4NO0A 4O2FB 4RZCA 3RZCD 3I50L 4XC3L 2AKRA 2PN5A 2EC9T 4NIKB 5E94A 4LHUG 3TO4D 3WFCH 1R24A 2CUHA 3BWUC 4PJ7A 4XWGL 5C09A 4L1HA 5FM8A 2BVTA 4K9EC 3VXRB 4RNRB 3BYYA 4YHNA 3KLHD 4YC2C 1MVFA 2ZUXA 5F7FA 3HRZB 5SWZE 3S97C 2MTPA 4WO4B 1OTSC 5GSVB 5AD0A 2EIZA 4RMSA 5EC1B 4PJ8C 1A1MA 4KKLD 5C0IA 4P0DA 3IXAA 4R2GB 5IF0B 2HKHL 2PTTB 1XF4A 3CXDH 3OF6D 4DZBB 1F58H 5FUZH 1UWXH 1UH4A 5I8KL 1X6LA 4PGEA 2R4SH 5F96L 3AXLA 1I3RB 3N1FC 5ELIA 3B8SA 4I13B 3FKUS 2GFBA 5GRJL 1YECL 1YEEL 5HBBA 3WFCL 3C5ZC 2O26U 3F12B 4U1SA 1FAKT 2Z35B 3FRPG 1FL6A 4P23C 2GTZB 3GNMH 4Z7UE 5DQJA 1FG2A 3J7HA 4G7VH 3WEXA 5ISZA 2NXZC 3C08L 3QDMD 4QHLA 3SDXA 2CRMA 3MV01 4ETQA 1TQCC 4N8VA 1R5VB 4F9PA 1KLGB 3VGAB 1FP5A 4J1UB 3O9WB 4FFYH 3MR9A 3MYZA 3CXDL 1F58L 5I8CA 3GKWH 2ATKB 2EKSA 1MFEH 35C8H 2R4SL 4Y5XC 1HSBA 2EO9A 1N6VA 2WWMD 1IRAY 1M7IB 4NQSA 4QLRA 4U6HA 3IJYB 3GNML 1T22A 3OPZH 3H9SD 4BSVA 3VJ6B 2VZVA 4PTTA 3SDCA 2VDLH 3AS1A 2ZSVB 1MFDL 1U3JA 1L7IL 1A3RH 5BCAA 1WZ1L 3U1SH 4UT7H 4XP1H 1VFBB 3QDGD 2SEBA 2AK4A 5ALCH 1K5NB 2EYRB 4HFUH 5TPWH 4FFYL 3EHBD 3PGDB 4X4ZA 3DOSA 4CMHC 1HYSD 3GKWL 5CSZA 4JZOA 2G75B 3RJQB 2R0KL 1K2DB 1YPZE 3U30B 3RNKB 1F2XK 3VE0B 2D9QB 5L8LB 1F4HA 6FABL 2Y36H 2JKXA 4U2YA 2A9NL 3SGEI 4E0RA 3OPZL 2VN4A 4N8PA 1QKZL 2CK0H 2VDLL 2Q76B 5I71B 4BQ8A 1A3RL 3D39B 4Y4FB 5EFIB 4RA3A 3TA3A 3CSPA 5GSRB 3BUTA 1BM3L 5IB1B 3SQBA 3U1SL 4UT7L 4XP1L 1A6VH 3PL6A 1B2WH 4HFUL 3UO1L 1AR1D 3OGCA 3CFJB 4UU9A 3W0WB 2HTKD 4XH2B 2J2ZA 4JLRA 5F88A 2AABL 4KQ3H 2NPLX 3W9DB 2LU7A 1I8KA 2GJ6B 4Y19B 1GGYA 2J3SA 3CSGA 2Y36L 2VL4A 4Y5XA 5KS9A 3LV3B 2IC2A 2F19H 2CK0L 5C07D 4MVBD 3MV8A 4KUCF 1ZOXA 4JRWA 1RIHH 4WUUE 5J6GB 1A4KB 3SKNB 4NUGH 5FYKL 1WLHA 1A6VL 3HRZA 2F54D 3QDME 4LAJH 3UYRH 4WO4A 5IEHB 1GCFA 1OP3K 4Y5VC 5EC1A 4CVXB 4O02H 4PB9L 2CSPA 5I15H 1LO5A 2WLZA 3MRQB 3KYNB 1MCHA 2F5BH 3BVNB 2Z9TA 5IF0A 1U95A 4NZJA 2ZOKA 4KQ3L 3VXQA 1ULVA 2QL1A 4U1KB 3U9PL 4DZBA 1GIGL 1OWWA 5IR1B 1OAKH 2B5IB 1NKRA 3ULUL 5KSAC 3L3HA 3TJEL 2YA2A 2XV6B 1NCNA 2AXFA 4JCLA 2F58L 3F12A 5MEPB 4WWID 4OCSH 1HH9B 4X8JB 3BKML 4Y4HC 3H9SE 1K8DA 4QT5A 1BBJB 1CZ8L 4P2QD 3WS3B 5IVXB 4XHJC 2Y5TB 2ZUSA 2DYPA 1T80A 4U6YA 1G7MB 4Q7DA 4KKAC 4POUB 2XKNA 4MXVE 1R5VA 5I15L 1KLGA 3HZKA 2C3GA 3MJ7A 2F5BL 5DVKA 2DM3A 4J1UA 4F3FA 3O9WA 1HE7A 2VH5H 2IEPA 4RBPH 5CEYB 2ATKA 1QSED 3MMEA 3U0TA 3X13A 5F7UA 4MXQA 1QHOA 1I7UB 3CVHH 3V0VA 1LO0H 3MV9B 3QXAB 4TNVF 4FQXC 2VNCA 1T21B 4XMKH 1D6EB 1KCVH 3A67L 1NFDE 2CLZB 4EXPX 4YZFE 1EVUA 4OCSL 3IJYA 3NCYP 5FOJA 1T6WA 4KDVA 4NZUL 2DLFH 4XPTH 5T1DH 4LVOB 2BJML 4LRIA 3UTTD 1B3JA 1EEZA 2PR4L 2ICCA 5E2VH 1VFBA 3BSZH 3T8XA 3BPNB 3SO3B 2EYRA 4I5BA 3G5XA 4KMLB 4PJ9C 3PGDA 2VH5L 4XAWL 3OGOE 3GMMA 3IAGC 4Y5VA 4MAYD 5DEGA 4FA8A 4G9FD 3CVHL 3UX9B 5ERWA 2GJJA 3FT3A 4NJ9H 4NP4L 4LGRB 1IGMH 4IDLA 3ARUA 4HWNA 3VE0A 2RHEA 1MSPA 1TMCA 5CP3A 3IDIA 5ETUB 4BQ6A 5JDJA 3Q5OA 4FQ1H 2P4AB 4YX2L 5C07E 2WUBH 4Y2OA 4XPTL 4PP8C 4PLNC 1P7QB 5EFIA 1G6VK 2HWZL 4P2RD 5IB1A 3AGVA 5E2VL 5FFLA 4NN5B 4LCWB 3BP6B 1WGOA 1GGBH 3FL7A 2VXUH 3VRLE 2VC2H 3MUZ1 4N68A 1V7MH 1A47A 3Q48A 4X83A 4KJQD 3W0WA 4TULH 4GMTL 4D0CB 5KVFL 1MLCA 2CRIA 1BFOB 1KCLA 4XH2A 3FQNB 1JYXA 2HH0L 1P5VA 3EBAA 4DGVH 5IIEB 3LRSA 4NJ9L 3JTSB 1U3ZA 1IGML 2BVQB 2Q8BH 2BRQA 4Y19A 1TENA 4PD4K 3U0WL 1AGFB 3DBXA 4RGMC 3LV3A 1A6TA 1FV1B 1JYWA 4PRHD 4ONGH 2NYYD 4FQXA 3UTPD 2WUBL 3B2VL 1XT5A 4TOYL 2C3HA 4LSSH 2OSLB 1K3IA 4M5ZL 1A4KA 4O9HH 1TJGH 4P2QE 5F3HA 4HMEA 2AV7B 2GTWB 1MLBB 1P4LB 1V7ML 5IEHA 4Y4KD 4OM0H 4BQCA 5FYKD 1OGAD 4C4KO 5DRNB 2BNRD 4NCDA 3MRQA 3U2SB 3BVNA 2EH7H 3V6FB 4DGVL 4ZS7H 1DR9A 1PD6A 4JFFD 3BEWA 1OL0A 3L7EB 1QSEE 2Q8BL 5CD5C 5IR1A 3NFPB 1C08B 4J3VA 4JHWH 4I0PD 3QIUD 2IBZY 1YEGH 4DOHB 2DKSA 4ONGL 4G8EA 4EBQH 4EN3D 5MEPA 3ULUD 1TTUA 4FQQB 4LSSL 1HH9A 1TJGL 5ABDE 5C0NC 5C6WH 5IVXA 4C54A 3OJMB 3LQAC 2QSVA 4H1LH 2Y5TA 1ES0B 3UTTE 3WDHA 1A7RL 4XVUD 3RKPA 3MJ8B 2EH7L 4ZS7L 4JFEB 3PV7A 3O2WH 5B38G 3RY6A 4G9FE 4UIMA 1I7UA 4LPUA 4KRLB 4YR6B 2OR9H 4DFHA 4YHZH 3QUZA 3MV9A 3QXAA 4WHDA 1T21A 4EBQL 1EK3A 2P8MB 2GK2A 4WENB 5DFWH 5IMOB 5DHVH 2BY1A 5B8CB 1LILA 3HI5L 3HMWL 4GRWB 3OKKB 3TPUB 5CGYD 3EDKA 5E8NB 1HQRA 3VWJB 4IRJD 3HE7C 4PRAA 2DM7A 2DD8H 4E42B 4UV4H 4X6DA 1JHLL 1I85C 2OR8A 4P4KB 5J56B 2EDLA 5FYJH 3SGKC 3HMXA 4GOSA 2DQIH 1P1ZB 1B4JH 3BUYA 5D5MF 4JN2B 4NZRL 1JPTH 1I1FB 5C0AD 4YHZL 1JF6A 1ZHBB 1A2YA 1BF2A 2XNAB 1CT8B 2D31B 2YD5A 1LEKA 2ATPB 2HVKB 4OFVA 4ZNEE 4MZ2A 5I75B 1S7UA 4PRHE 1RJYA 4DW2H 1G84A 4UOJA 1R3KB 1Q0XH 4ZUVA 3CD4A 3L5HA 4P99A 1D5ZB 2M2DA 1IL1B 3EUUA 2GCYB 4OUUA 3SO5A 4FMFA 4LCWA 3BP6A 4R0LB 1UVQA 4FQHB 4DWHA 3L5XL 3ABZA 5FKAB 3EDFA 5FYKE 1OGAE 2DQIL 4NO5A 1B4JL 3NCCB 3OR7A 3FQNA 4R4BB 1A5FH 3ZKND 1JPTL 5IIEA 5KZCB 3M07A 1FNAA 5DC4B 3B2UC 2HT4C 1XGTB 2BVQA 3BP5B 2FJFA 1AKJD 4Q97A 4LBEB 2VIRB 3IETB 4DW2L 4X7FC 5D1XD 3TH4T 5BO1H 4Y0GA 4LEXH 4QRPB 2DOCA 1Q0XL 3QA3B 3ULUE 3JTTA 2OSLA 1CVRA 2ICES 2LTQB 3QAZB 3RWGA 2NW2A 4IRSD 4KROD 2W0FA 4L4JA 4PP1D 1TQBC 1MLBA 3BH9A 4PJAA 1J8HD 1XF2B 3BGMA 5EIIA 3OQ3B 1I1YB 2DLGA 3OMZA 4TN9A 3VXUE 1ZTXH 1H15B 4WFED 3U2SA 3FMGH 2FGWL 3FT4B 3I6KA 5K9KB 1CL7H 4PJIE 5DT1H 3NH7H 3FZUD 3AMKA 4LSTL 1MCSA 4L8DB 2C1PB 3GHBL 5EZLB 1AC6A 4CU8A 2EDTA 5BO1L 3AY4C 3MXWH 3W2DH 4XGZB 2FECL 1DBKL 5HYJA 1YA5A 4APQA 1RZJH 5HI4C 4NQUA 5IEKB 2R2HB 3IFPB 4PRDB 3MJ8A 4PLJD 3T0VA 3ZE0E 1H3VA 4P5TA 2JELH 3EOAB 2EKJA 2FR4B 1PAMA 2BNUB 4FMKA 4YR6A 4XP9H 3V5DA 2VR4A 2EE6A 5JQ6H 3MXWL 3OKDB 4KMQA 2P8MA 4LPXA 1BVKA 4XBEL 4Y16C 1M71A 4QTHA 4CUCA 5I1GL 5BV7L 1A9EB 3TCLA 3TPUA 2O5YH 3P4MB 3C5JB 1KTLB 5E8NA 3VWJA 4WEBH 5DRWB 2VR5A 3IU4L 2XN9B 3E3QC 2IGFH 2IH1B 2JELL 2NX5B 5E7BA 3IDGA 4XVTL 1J0YA 5IQ7H 2V6HA 3WFDH 4U2ZA 4DUXA 5H8DA 3G6DH 4NFCA 4G6FB 4XP9L 1I1FA 1U8MB 2XNAA 1CT8A 2B8OT 2HRPL 1DN2A 3MREA 3QJHB 1JWUB 4UOW1 5IQ9A 1IQDB 2ATPA 2HVKA 3E1F1 5CJQH 5DVNA 4Z8FH 5E4IA 4K7PY 4JHZA 1D9KC 3OKOB 1WVZA 3ARSA 1FNEB 1R3KA 2O5YL 4X4XB 1RZ7L 4AENB 3MLSL 5F6IB 1ONQB 2MKLC 4WEBL 1PYWA 1D5ZA 4GAGH 1EHLH 4NKOA 3AFLA 3BDBA 1NDGA 2XT1B 4R0LA 4FQHA 2IGFL 3HUJF 1YDPA 4RAVB 5JW5B 5F7YC 3K4DA 1Z0NA 5DTFB 5IQ7L 2YD6A 2WQ8A 1SYVB 3WFDL 4WFEE 5C0CA 3G6DL 4R4BA 4M48H 4N9OB 4LPYA 2V5MA 3NN8A 5JHDD 1XR9B 4U6XB 2A0LC 1NMBH 1IGIL 3QFJE 4LVNC 2DJSA 5CJQL 2AJZA 4Z8FL 4LBEA 4HBQA 3IETA 3OJVC 5FA4B 2VXVL 1B0RA 4DGIH 2H8PB 3QA3A 3LEVL 4IOSD 3SGJC 1W0WB 4GAGL 5EBWB 1G0DA 1OSZA 3CFKA 1D5IL 1I7ZB 4CRPA 3B9DA 4B7IA 4JFHD 1MCWM 2C4FT 1XF2A 2EH8L 1ZE3C 1C12A 3ILQC 4HWZA 1I1YA 3DV6A 1ZLUH 3L95B 4D9QE 2FEEL 4FFVC 4AH2B 3V9FA 1FC2D 2FX8L 1G6RL 4ZAKC 3H0TA 1CXHA 5HYSA 3O8XC 1DQJA 1NMBL 2PKDA 5D7KD 3RVXD 2O61A 4XMPH 1D5MB 1BVZA 2E9JA 3UP1A 5FF6A 1B90A 5L2JA 3U6RA 5DMGC 3LKOB 2VZ3A 1X5FA 3ELAT 4FHBD 4PJ5A 3KAAA 2HT2D 2PXYB 2HJFB 3HLAA 4DGIL 5GHWH 5ENWB 5D5MA 4E41E 1AQKL 4G8GB 2RFXA 1NKOA 5C0GB 2XQYK 1BFSA 1EH9A 4LLVA 4DN3H 4L4TD 3H3BC 1CBVH 3PWPB 5K33A 3KVQA 2HFGH 4FFZL 2W9DH 2XIDA 4NSKA 3CFCH 4A6YA 1ZLWH 5J13C 4XMPL 1LE5A 1IBGL 4FQLL 2EDJA 3VDCA 4KZEL 3DSFL 2E6PA 3UAJD 1VGEH 5I66B 3OKDA 5GHWL 3NGBB 4OTXH 1OPGH 4DKEH 1KACB 4LARL 4YDKL 1QNZL 1A7QH 1A9EA 5F89B 3O2DA 2FIKB 3CDGB 3P4MA 4QOKB 3C5JA 3FT2A 4DN3L 1DQQB 1IFHH 2ZSWB 4Y1AD 4NGHH 1CBVL 4PJDB 2XN9A 2YPLB 1WISA 3UTSB 2HFGL 2OTUB 5B22A 2W9DL 3KS0H 3CFCL 4H0GA 4PPTA 4OV5B 4QHKJ 3LKSA 3MOAH 4XCFL 5C7XH 4OCRH 2VDMH 3LHPL 3B9EA 4M5YH 2P1YA 4RMRA 4S0UC 3SCMD 3QUYC 3QJHA 1JWUA 3KPOB 4OTXL 2WBWB 1OPGL 4DKEL 3BW9B 3UPRA 1T3FA 5L7XH 5T33L 2R1XB 5K9QG 1RI8A 4X4XA 3EYVA 4YDLC 4AENA 3QPXH 1UM4H 3AS0A 4X6FB 4NGHL 5DUPH 2QADC 2YMXH 5I1DB 1W8OA 3KDMA 4JFHE 5AUMA 4RAVA 4XPAL 1HH6A 3B6SB 3U7YH 4YDIH 3ARYA 3O3DB 4DN4H 1S7SA 1OARH 3MOAL 1KIUA 3UJJH 5C7XL 4OAWA 2A83B 4PJXB 3VFUB 4OCRL 5DMYA 2D2OA 2K7QA 2IBBA 4U6XA 3IDXH 4NN7B 3FB8B 3PDOB 1HQ4B 1I7TA 1ODAA 4L9LC 2OI9A 4OKVB 1NEZB 4YLQT 1UZ8A 3L6FA 5FA4A 3AREB 5L7XL 2W60A 2NY3B 1KG0B 2H8PA 5ALBL 4NHCH 1UM4L 5J06A 1W0WA 5K9JH 5EBWA 4N5EC 2HJLB 5ITBL 2A6IB 3F7YA 2YMXL 2YEZA 1I7ZA 2Y07L 5GS1C 2D0HA 2QQKL 3U7YL 4M00A 4YDIL 4L4TE 3E6FB 3AU1B 4DN4L 4CL7A 1OARL 2BC4B 3NZ8B 5JLZB 1MRCH 5E99H 3BE1H 4P3CL 5F8RC 4ZUUB 2HG5B 3IDXL 1MCPH 2XA8H 2YD1A 4B50A 4F7TA 2KPNA 1X5IA 4QRRB 5HGDB 1YNKH 1D5MA 1KTDB 3VFGH 2BVEA 2ADFL 4JN1H 3QCVH 1N59B 3QBTB 2HJFA 4Z5RA 4UV7H 5CEZH 1BJ1H 4UT6H 2OM5A 3LRGA 3VW3H 4NHCL 4KQ4L 1U0QA 4WV1C 4LSDA 4UAOB 2WP3T 3QP3A 5C0GA 2FDBP 2QSCH 1CU4H 1BIIB 1MHEB 1JWMB 1NCBH 1S9YB 3RPKA 4UTAL