3RWMB

Crystal structure of ypt32 in complex with gppnhp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
MGYDYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGLERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The activation cycle of Rab GTPase Ypt32 reveals structural determinants of effector recruitment and GDI binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords GTP-binding protein YPT32/YPT11
total genus 63
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2011-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rwmB01
3IQWA 2CNWA 2VYFA 1SQ5A 2CDNA 1CF4A 3EA0A 3RNLA 1R0YA 2ZAOA 1OXXK 2IEZA 4N1AA 2GHIA 4M1TA 2ZS9A 4CVNA 4MRSA 2BJWA 1WE2A 2OBLA 4DDTA 1GL7A 2Z0MA 4YLGA 4P3YA 3TGPA 4V0LA 1ZCAA 4JVLA 1BH2A 1VHLA 3LD9A 3SBEA 1K5DA 2P6UA 4LV5B 4XVQA 4V0NA 2YWGA 3CLVA 2R6GA 3V4RA 2WJHA 3OE7D 5TDHA 1CS4C 4U02A 4BE7B 4QGHA 3EG5A 4A8JC 3CB4A 4LI0A 2IYXA 4TWZA 4DLUA 2WIAA 4N0EA 1E2QA 3CRMA 1W44A 2HXYA 1SULA 3NC0C 1GWNA 1MABA 2F6RA 3AP2A 3I8XA 4G5RA 3AF0A 3QIAA 1IAQA 5BXQC 3U7FB 5F9FA 4DCSA 1N25A 4R98A 4C2UA 4CDGA 2IS2A 2ZS7A 2SHKA 1W4AA 2EFHB 1JNYA 2GXAA 2VP5A 5IF9A 4B34A 5CIQA 2RGXA 2ORVA 3O47A 2JLQA 5HCIA 1GKYA 3OESA 5FPTA 3IBYA 4JLDA 1GILA 2ZI5A 4Q9LA 3BORA 2DWQA 4L9SA 3DOEA 1GM5A 3EC2A 1AK2A 5DE3A 3W6OA 1S2MA 4PSVA 4UNPA 3O8DA 3VR1A 2P6RA 2HYDA 3JVVA 5AK0A 5LB2A 1Z07A 1JJ7A 1Q1BA 1T0JB 5L3VA 4U5XA 4L16A 2GBLC 2IYVA 5BW8A 3QF4B 5ANRB 1FTNA 4M1SA 3PVSA 2WJIA 1SVSA 3Q5EA 3PUVA 4B6EA 4EFNA 5EUQB 4IDHA 1YR6A 3CF6R 3RS2A 1E2EA 3D7MA 3RWMB 3TAUA 3A36A 1KAOA 2ZJYA 1OLOA 4PO8A 3HR8A 1NVXQ 1UBGA 5F3WB 3SE0A 4DB4A 1G3QA 1RFLA 4TTRA 1E2NA 2ZS8A 3B1VA 3CX8A 3GJ4A 3GJ7A 4G0NA 5DHAA 5KNCA 3BRWD 3GMTA 1GVNB 3KL4A 3PUWA 1P61B 2R6FA 4URXR 3B9QA 2ZPTX 2XNDD 5H8WA 1G7TA 1DAHA 2QRZA 1NBMD 1NMYA 1NI3A 4XTCS 2FJUA 1KK2A 4NKRA 5EP1A 3IKJA 3LFUA 4Q7LA 3C14C 3FPAA 1F6BA 5L3QA 3NXSA 1X3SA 1Z6XA 5JFGA 2Q9AA 4CEHB 1HQCA 4P4SA 2P3SA 2HUPA 3AF2A 4XJXA 3GEEA 3U44B 3F5FA 4LBWA 5HE8A 3SYLA 4URVR 2VP2A 1KY3A 2ZRHA 2LWIA 1QBKC 1U8ZA 3ICQB 1MH1A 1Z0AA 1CP2A 3U44A 5TY0A 2QBYB 4KBGA 5K8LA 1TEXA 521PA 3BB4A 1W46A 4TQAA 3LV8A 4YC7A 3QKRB 1JQJC 1QRAA 1W7AA 1DAIA 1G5RA 3QVVA 2EQBA 2BKUA 2ZSFA 2GBLA 4JBXA 3VTKA 1HA3A 3EWAA 3KXIA 3FWYA 4UXHA 5AJZA 1G9XA 3GQBA 4D0NA 4PFSA 4Q4JA 4RZ2A 3T61A 4XTRA 1E2MA 3F3YA 4Q01A 3GLFE 2J0SA 4EPXA 3NH9A 4IEEA 1KSHA 2DFNA 4V0KA 1FQJA 3UMFA 5FTNA 1SKYE 8OHMA 1RRFA 4H1VA 3EA5A 2ODEA 2IUUA 2IW3A 4LJ6A 4LJ7A 2QN6A 3CRRA 2J87A 1BMFD 1EX7A 3CO5A 2H7VA 3GJ0A 3Q5DA 4EFLA 2NO0A 4ITRC 3D6TB 2WJVA 2PLFA 2VP4A 1W47A 2W58A 1XTKA 1DO0A 1VG0B 5HE9A 2KBFA 5FBLB 4JLNA 2ANBA 5KDOA 3RRZA 2G1JA 4ABYA 3TUJC 5SZHB 4HAUA 1E1RA 3NHBA 4FCWA 4DLXA 1NVWQ 1R10A 4FMCB 2I4IA 3FMIA 1AKYA 4OHVA 2ONJA 3MMPA 1H8HA 1CTQA 2Z43A 2I1VB 1TPZA 4NP6A 4DLVA 5JEDA 1W1WA 5JCZA 3WBKA 3CM0A 2WOOA 1SXJC 1H8EA 2ZR9A 4RSGA 4W5JA 3BD9A 4JBWA 1UM8A 1Z3IX 5FOTA 2H8KA 1U98A 2AX4A 3T5GA 2G83A 1I2MA 2FFQA 2VTKA 2EW1A 3WNDA 1PLKA 4OK3A 1PLLA 3KX2A 4CF7A 4QJ3A 1W36C 3CZPA 5DSZA 5CM8B 1NN0A 2ZE5A 3C41J 1O3YA 2UZ3A 4Q9HA 1JEEA 3L0PA 2CCJA 4LJ8A 2JLXA 2YKGA 1COWA 1SXJA 2W6JA 2AFHE 1S1CA 4BUJA 2IXFA 3T1VA 1ANKA 1ONBA 2EFGA 2A3RA 1LS6A 3VHXA 3REGA 2BM0A 1ZU5A 4EKDA 3IHLA 1XPUA 3TW8B 4B2PA 1WA5A 3RC3A 4GFDA 1CJTC 1E9FA 4XVUA 821PA 3M0EA 5KUTA 3I61A 3RWOA 1IJFA 1W5SA 3IO5A 1GL9B 5JI3E 3ZVLA 5KNDA 4HAXA 2CHGA 4CZ2A 1R5NA 3D3QA 3AVOA 4TTPA 4BFUA 4B2LA 1ZJ6A 2PT5A 2FDCA 3N2EA 1XBTA 2VHQA 2XSZD 4NCHA 1YR8A 3OEED 2FPLA 3NDBB 1ZNYA 5AJXA 2QENA 4JT4A 3MG9A 1A7JA 1G16A 5GVSA 4LC0A 4BFTA 3THXB 4EJSC 4C0HA 2C9YA 1QHXA 5FTKA 3CWQA 4D6PA 2ZQ5A 2JLVA 1GP2A 3LA6A 2ZUBA 4US0R 4D0LB 3NHAA 3KB1A 3DL0A 5BN5A 2WICA 4PTLA 3TR5A 4EJSB 2KE5A 5HZKA 2AK3A 4OJKA 4HAVA 1FZQA 3MSXA 3SYNA 2KJQA 4ARZB 1AS2A 1NG9A 2FZLA 2WKQA 2H17A 2GDJA 2QAJA 2FX3A 2HLDD 1XX6A 5JI2E 1BMFA 2HT6A 4DXAA 4RD4A 2ZREA 1G8HA 1IXRC 2N46A 5E7JA 3GLFB 3AGPA 3DMNA 1NSTA 4PPFA 3ZYCA 2ONKA 4CEIB 2VF7A 1IY1A 1VKJA 4KAXA 3R8FA 1E2FA 4E22A 3ICEA 2OG2A 4LX0A 4RFVA 3GFPA 2EYQA 1HV8A 1MV5A 1LVGA 1KIMA 3K0AA 1ETUA 4IDNA 5DI9A 2WWXA 3W5IA 3A58B 1NN1A 1XCMA 4WBSA 3KZ1E 5JRZA 2C9OA 1N6LA 3GD7A 4OYHA 4M9ZA 2QROA 4PPGA 4E09A 2ZVQX 5KSZA 1Z47A 5DHFA 4B3FX 2RB4A 3QSYA 3RDPA 1LTQA 2XJ4A 3P27A 1ZD9A 4Z8XA 1NSFA 1K6MA 3THYA 2ZU6A 4MRPA 3NH6A 2JLSA 2WMNB 4JYCA 1E96A 1KO1A 3MWYW 4TLBA 1RIFA 1KO4A 5EE0A 5JWHA 4A8JA 4EIWA 1CJKC 1KI2A 4W5WA 1E79D 1TQDA 1R8QA 2PT7A 2ZRKA 3GLGE 3IPXA 4EAQA 4Q5IA 1ZM4A 4O2RA 4MRVA 3ZQ6A 4MYHA 2WKPA 4D80A 4DZZA 5J4KA 3OFNA 2ZR0A 3FVQA 3J81k 5HKKD 3WHLA 4OK5A 3CRVA 2GNOA 1ZM2A 5BN4A 3AUYA 3EPHA 5B30A 1C9KA 4UJ3A 2FN4A 3RANA 2KBEA 2J7PD 3HU2A 3VU9B 3CH5A 2DWPA 1VCMA 5FUVA 3NVAA 5FUXA 1XRJA 2V6JA 5DO9A 4M22A 5E7IA 1GAJA 1VIAA 1B0UA 4U00A 2P5TB 3PUZA 4A82A 5KDLA 2O52A 4KITB 1GDDA 4ZI3A 2WWYA 1ZBDA 3QG1A 5J4HA 1ODFA 1UJ2A 5CB8A 2W2XA 1JQLB 4HDCA 2WWWA 4B3DA 2CJWA 1OXSC 3I8SA 4M1KA 3ZGXA 3D8BA 4KVGA 4MRNA 2RGDA 3CBQA 3UWOA 2QZ4A 4DSNA 1D6JA 2J9RA 1JR3D 1YU9A 1Q12A 1OYYA 3CNNA 4M53A 3BFVA 4D25A 1DAFA 1ZUIA 2FG5A 2JIZD 1U8YA 2RGAA 3SJCA 2OFWA 4AIIA 4QG7A 1FFHA 1XD9A 3KJEA 1J2JA 3CF2A 3K53A 4D26A 4C0AC 5EJEA 4GBMA 4BQSA 2BV3A 4QKQA 3IUYA 2HJVA 4FD2A 2QTFA 3QQ5A 1GNRA 1LV7A 1N2CE 3CZQA 3LRPA 1TQ6A 4JL5A 5EE5B 1XEXB 2LCFA 3GJ6A 1YHNA 1Q44A 4C4PA 3EZ9A 3MRSA 2GF9A 4IRUB 3H2YA 3T34A 5C4GB 2R44A 1EG7A 3CPJB 2A5GA 1O87A 3U3MA 1E9SA 1T8TA 5P21A 2GEUA 2BEJA 1AQYA 2IUSA 1WP9A 5JHGB 1WMSA 1E0KA 2QE7D 1J8YF 2MMCA 5A5GA 1P9WA 3EIHA 4MQBA 1G6HA 2IHYA 4AK9A 4Q4LA 5CLLA 2ORWA 3THOA 3B2EA 5CK5A 1DBSA 2NPIA 3U5ZB 1JECA 1LFDB 3SI7A 2NMVA 2O0JA 5HPYB 4HEJA 1KYIA 4QFMA 1UF9A 2ORIA 4D4KA 5J5CA 4QRHA 3A4MA 2D06A 4IOJA 3ADKA 1W4CA 2GZDA 2XZPA 1OW3B 4G5QA 2QBYA 3HYTA 4D4JA 4Z1MD 4Z8YA 1M7BA 4RD2A 3WY9A 1Y63A 3QXHA 4NU0A 1E69A 1N5JA 4ARZA 2WWGA 1ZUHA 4D81A 3U3KA 4IDPA 5ELXA 2QY9A 1TU3A 2I3BA 1KJZA 4PPNA 3GLHA 1CIPA 4ZPXA 5J47A 4HLUC 5E7MA 5FR2A 2ZU0C 1JBKA 3UKDA 3LY5A 1JAHA 1Z0DA 3DVLA 4OHYA 3DZ8A 1EFRA 2V9PA 2GRJA 2J5XA 4NYIR 4JVSB 4LYJA 2QP3A 4QGGA 5EXXA 3UWKA 1NKTA 1XFAA 3SNHA 4U7DA 2F9LA 4CT4B 4MDFA 1XMIA 4B3CA 3C5HA 2QL6A 2RGBA 2RHDA 5J4YA 3WXMA 4BZXA 3EZ6A 3K9LA 1OE0A 5KYKA 4TYQA 3BFKA 4QXAA 4F4IA 2R6AA 1ZNZA 2VH5R 4LV8B 3I4LA 4OBEA 2B8TA 2IX3A 1Q1QA 1N3BA 1H8ED 3HDTA 2V4ZA 4TN1A 3WRXC 3SJBA 4BWYA 3X1ZA 4KFRA 1EX6A 5CJPA 3A37A 4GZLA 3A1UA 2F43B 1XWIA 4FCTA 3IHWA 3RLFA 3QF4A 4JJKA 2F7SA 3R9XA 4GP7A 3SZRA 4ZKEA 4RKEA 1MT0A 4HZUB 4HLDA 3X1DA 1IXSB 2BCGY 2W2VA 3L2OB 2V6IA 2BMDA 4LYAA 4BLQA 5FBVB 4B3XA 4DHEA 2I1QA 1W0KA 3BC1A 1BS1A 4PZZA 4G5SA 5EE1A 2ZXUA 1COWD 1XTIA 4RD1A 2FEOA 2EWVA 4M1WA 3U7GA 1S4QA 4Q00A 4OKSA 4NYJR 4UKDA 2YOGA 1U0JA 2GJSA 2YWEA 3QNUA 4JKIA 4NDZA 1YJ5A 3CRQA 2JIZA 3PITA 5G3ZA 4P4SB 1VECA 3FHTA 3PUYA 5F9HA 3N2IA 1ZYUA 1EXMA 1KSJA 1W4RA 2WMOB 2UKDA 4I4LA 1FMLA 6Q21A 1YZTA 2KB0A 3DKVA 4WZ6A 4NHOA 2A5DA 3C8UA 3QUSA 2CLCX 3WNCA 5L8VA 3TAHA 2GILA 5BQ5A 3U3OA 3KTAA 2CCGA 2FE4A 3B1XA 3VHLB 1L4UA 1NP6A 4PANA 3OEEA 3C5CA 4NYMQ 1DG1G 3R7WB 4JLJA 1Z0IA 5JWOA 1UKVY 1XPOA 1OH7A 4TZ0A 1ZUNB 2VP0A 1G18A 3VQTA 3IBGA 4YDSA 3TKLA 1VPLA 5FI0B 4A92A 4BPBA 4RD0A 1GFIA 3K70C 2D62A 1G5TA 4PAMA 2O8FB 1E0JA 1T0HB 1W2GA 4G01B 3ZQJA 3R9WA 3AKYA 4YDHB 4B76A 4YXWD 1II0A 4ZDWA 2GZHA 2C03A 2IYUA 4FXPA 4EPRA 2OAP1 2ZRBA 3B5JA 3X1WA 4TL8A 3QKSB 4DEXA 1LY1A 2NO9A 3KXKA 2W00A 3DMDA 4MKHA 5K8TA 1OF1A 4QNRA 4DLZA 4Q18A 2DYKA 1P4SA 3LNCA 5G53C 3ND8A 1S9DA 3QXXA 4YMWA 3UMRA 2XGJA 4RKFA 4KFSA 2X77A 1RE0A 5AWFC 2REXB 3K1JA 1RRCA 2R6CA 1XPRA 4LYFA 2PBRA 4KV9A 2B92A 4ZDJA 3KQKA 1TF2A 4URUR 2VPPA 2PCJA 5JS8A 1KMHB 5HR5A 4US1R 1E2JA 2EU8A 4DRZA 2BBSA 1KO8A 4GOXA 4JLAA 1G20E 1ZINA 4CEJA 2A9KA 2BKEA 2EFCB 1N5IA 1YR9A 2BBOA 3AGQA 3SOPA 5FPHA 2ZE8A 4EFMA 2VA8A 2XZLA 2ZSAA 3GLIE 1R5OA 2A30A 2R8RA 4LV6A 1S3SA 1NIPA 2Z4SA 1MO6A 3KFVA 2PZGA 5DI3A 5JECA 4Q1AA 1XXHA 2WWHA 2WSMA 1C4OA 1OYWA 4V02A 2FSGA 4EJSA 2XTZA 4MGZR 3B82A 1D2EA 3WMEA 2FU5C 4PQRA 2ATVA 2CMKA 2ASEA 1G8YA 2XTNA 3UMSA 2XNSA 4PZYA 3GFOA 1VYUA 5L3RA 2G3YA 3ZVNA 4KFUA 2FFBA 4WXRA 2IL1A 4GOJA 3PEUA 4P32A 2ZRNA 3NDPA 3A4NA 2EFDB 1YZKA 2O8DB 1KKLA 1TMKA 2K5UA 2LKDA 2GXUA 1KJWA 2B7BA 3HPQA 3SHFA 1MR3F 3FKQA 4D4MA 2IWRA 1XEWX 3AKEA 4N3NA 1HE1C 3KUCA 4M9SA 1H65A 5IK2D 4MUBA 5FOVA 2QP4A 4ZIRB 4NCNA 5LDDC 2RGGA 2J46A 1D9ZA 5B57C 3DM9B 5DYGA 5KOYA 2HF8A 2YVUA 4OI0A 1JPJA 4JL8A 1TUIA 1YZQA 4AKGA 5HKKA 3EPKA 4B32A 4KJZA 1SVOA 2WAYA 4GI7A 2WTUA 4JMPA 4MKGA 2JA1A 2BMJA 5CLQA 2FWRA 3K0FB 3B6EA 1UKZA 4V0ME 4V0OA 1ESNA 3TMKA 2V7QD 4TLDA 1IJEA 3V9PA 2JLRA 3ZIAD 1Q1EA 1XD2B 3U7HB 3FHCB 2VQSA 3NBXX 4M1OA 4ZCLA 2JAQA 3KQUA 4G5OA 1OKKD 1ZP6A 3KQLA 1XD2A 2CL0X 1IN6A 2OEPA 2VP6A 3F0TA 4X8HA 5D3MA 4EDHA 1MRNA 3GJ8A 4YXWA 2QPOA 1Z06A 4JIMA 3THYB 3RHFA 2OBNA 4TT3D 2GEDA 1N6RA 3HWSA 4QM6A 2Q21A 1BYIA 2CJWB 3UXMA 4A15A 4PC7A 4HLUA 2DHRA 2FPMA 2TMKA 1G291 5JSZB 2BJVA 3CF0A 5TARA 2QAGA 3OE7A 4DLRA 1L4YA 2C9CA 3OIVA 3QF7A 3RRMA 4D0GA 1DAMA 3KKQA 5GJVC 1JALA 2GTPA 1BKDR 4K81B 1OB2A 5CYPA 5IRCD 3TVDA 3R20A 4C0JA 1ESMA 4WZBE 3DO6A 3MAAC 4AI6A 1RVDA 2CHQA 1HY3A 2QEQA 2WVJA 3IEUA 3ASYA 4UNSA 5DLQC 1US8A 1CJVC 1Z6AA 4TMKA 1XTRA 1I4DD 4KFTA 2YC2C 5L3SA 2J0UB 3I5YA 1EFRD 1W48A 4EPYA 1G7CA 2O0KA 5KSOA 4BEBA 3LBNA 5TMPA 2F1HA 4V03A 5EXSA 4KYUA 3O8RA 3LW7A 4KCGA 4BFVA 1YRAA 2F1IA 3TNFA 1Z0JA 2V1XA 4DLSA 1R7RA 3FOZA 2PJRA 1MO5A 2O8CB 2HEIA 1Z5ZA 4DDUA 5EE9A 1E9EA 2WPDD 5FL3A 2H16A 5KO2A 4AWXA 3BJIC 4LUCA 4LZZA 4XD7D 1PJRA 1R0XA 3LDAA 1RYFA 3CR8A 4IDOA 4LC1A 5IT5A 3R8CA 1G8GA 4W9MC 3Q7PA 2JJ1A 2FSHA 1YZGA 1IY2A 4Q4AB 5DN6A 2FFHA 4GMDA 4NCJA 4KYIB 4MKFA 1E32A 3X1YA 2GAAA 1RRGA 4JVMA 1DAEA 2QUZA 2FMXA 1N0VC 2OSBA 4V0MA 2DWOA 2A5YB 3BH0A 1JR6A 3QJYA 2QT1A 4TSFD 2ZVPX 2ZI6A 1RRPA 3LX8A 2WKRA 4HB3A 4C2TA 3QPVA 4DDVA 1Z29A 2ERXA 2IEYA 3I62A 3SQXA 2J45A 4NBSA 1V5WA 1TEVA 4ILEA 1SVWA 1YR7A 3AVQA 1UEJA 2RAPA 2ZI7A 1NJFA 3ZVRA 2RMKA 3A8TA 4HAYA 3SC3A 3I72A 2REBA 3GJ5A 4M0LA 4X8OA 3GLGB 1KI7A 2FSIA 2V7QA 4NZYA 2YOFA 1K5GA 1CXZA 3LQQA 2PZEA 4KLNA 3W8NA 4ZDKA 3RRYA 1U2RA 3MWJA 3BE4A 4GSYA 2QM8A 4FI3C 1US8B 5EZ5A 4IDQA 1HH4A 5CDFE 4A9AA 1FUKA 4L9WA 1GG2A 2J0UA 4KI0A 4QJ4A 1YZLA 4HZIA 1FMJA 1R8SA 1D2MA 3Q7QA 4IVQA 4Q1EA 4R2IA 1LF0A 4JS0A 1ZMXA 2C8VA 3ZD7A 1EFHA 2F1JA 3AKCA 3K8YA 3QENA 1HT1E 4GNKA 4OHXA 1D9XA 2JLUA 4LGMA 2G1KA 2XTMA 2ZRAA 1YZNA 1U0HC 4GRAA 4A2QA 1E9CA 3UG6A 4QBIA 5AJVB 4RFSA 4IVPA 1CR0A 2C95A 1XU4A 2XITA 1I4TD 5FH9A 1TF5A 2CHVA 2EFEB 3CPHA 3ONWA 5FL7A 3TSWA 4F4CA 2C96A 3AVPA 4W7SA 1G19A 4XWKA 1Z2CA 2ZJZA 3CWZA 1GRNA 1NLYA 3MWKA 1NN5A 3ASZA 1IOZA 3OFND 2XAUA 4OQMA 4Q66C 4B43A 2QMHA 4G5GA 4DCNA 4PR0A 1Y3AA 4BEJA 3IPYA 2J7PA 1EFUA 2WV9A 1R0WA 4FMDF 1J99A 4RZXA 1XEXA 1N5LA 3OHMA 2VSXA 4PQFA 1OPXA 2QU8A 2REOA 4BZPA 5B64A 1ZM3A 4TTQA 421PA 1WBDA 1G1MA 2WM9B 1DPFA 2CLSA 4HI0E 4DKXA 3IGFA 4C0SA 2H1LA 4JLOA 1IN8A 2UVQA 2VHUA 3SBDA 1NLFA 4X8LA 4IW3B 4OHZA 1CR4A 2NO7A 4KO8A 1NRJB 1XTQA 3LWNA 3W8RA 4NTZA 2VHCA 2ZUCA 4LJ9A 3PG5A 2DFKB 4CIDA 4YQFA 1CJUC 5JHHB 3WNBA 3PIRA 3W6NA 1XCPA 1EFTA 2F43A 3C4JA 1VDZA 3FMFA 3TBKA 2C5LA 4RCZA 4W5HA 2W2TA 4BFXA 5DN6D 1P7CA 4F7WA 1NKSA 2FA9A 3SFVA 2OV2A 3DKPA 1KGDA 3RS3A 4BFZA 1E2GA 2Z83A 5FTLA 3PEYA 3PJRA 2OXCA 4XSGA 2OT3B 1HT2E 2P67A 1C1YA 3A1VA 1J7KA 1A82A 4DBLC 2WAXA 3OAAA 3GLHB 4MGYR 2B7CA 4ON9A 4LBVA 2HV8A 2WZQA 4OJQA 3BIFA 4Q7KA 3TLXA 2Q3FA 2RKOA 4IFEA 1LW7A 4A0FA 3MFYA 4XSHA 2OCAA 3KFXA 2YC4C 1P2SA 1X8JA 2F3RA 2QE7A 1XTJA 3MJRA 4NH0A 3LW8A 5CK4A 3SS8A 4HUTA 5KSPA 2O8BB 4NCIA 2V54A 5HZHA 3T5DA 1W5TA 3QE0A 4D4LA 4LOAA 2VRWA 1NY6A 2RH5A 1F2TA 2DFLA 3AVTA 3I5XA 4A0HA 1RW4A 1AGPA 1IN5A 1T5LA 1VHTA 2AXPA 2QI9C 4HAWA 3GP8A 3AVVA 4RD3A 2FPKA 1L2TA 1Z22A 4MUAA 3W3ZB 3M1IA 2D7DA 2JDIA 2JGNA 1VCIA 2AFIE 4GP6A 4MYCA 1WCV1 2JATA 2YV5A 2BM1A 2Q0HA 3AQ4A 4TLEA 1XZQA 3I73A 3U3JA 4JJZA 5JJIA 5EQTA 1II8B 2D2FA 3ZIAA 3DM5A 2GWHA 1X6VA 3ZS8A 4US2R 2QGNA 1W4BA 1ZM9A 3Q85A 1E98A 1DE0A 1P3JA 2LKCA 2V55B 2C04A 3E70C 3AB3A 2MSEB 4Q21A 2IT1A 3BWDD 3IIKA 3SDZA 2N42A 4UNNA 1P6XA 2BDTA 3RSLA 4ZI2A 5LD2B 2FF7A 1U81A 1R0ZA 2GJAA 1M2OB 3WRYC 3WMFA 1P75A 2PX0A 4B35A 3E2IA 1GRQA 4AKIA 4M1YA 1IBRA 1UBFA 1SHKA 2GA8A 3QXCA 4K8OA 3WP0A 2KWIA 4QL3A 3T1TA 2XZOA 3P4XA 4TLCA 2IYZA 1N5KA 4I81A 1L8QA 4B3GA 3CONA 3ZZ0A 2WBLC 4XIGS 4M2LA 2W0SA 5F2EA 4I1VA 1E2PA 2PX3A 3K9GA 3C15C 1XMVA 1G64A 2NQ2C 3CKLA 4AURA 3KJGA 1U9IC 5KSYA 3LBHA 1VCOA 2G77B 1TX4B 3BAFA 3KQHA 1M7GA 3W6PA 4TT3A 2F9MA 1W0KD 2QNRA 1E2DA 2G88A 3CH4B 1EK0A 3QPUA 4JSYA 2OBMA 2ZJ8A 5C46F 4DIEA 5GADl 5FUWA 4IHQA 3KQNA 1EWRA 4LHZA 4IJMA 1QHSA 4OI4A 3NEJA 3EXAA 3QVUA 1E1RD 4TMTA 2IS4A 2BOVA 3K9HA 2P5SA 4MYUA 1XDBA 2FZ4A 5J4VA 4KU4A 3A6PC 3QOFA 1AA9A 1S8FA 3PXGA 2ZRDA 3BXZA 2MSDB 1UKYA 2RGCA 4PSKA 2CVHA 4LHWA 4TL7A 3W5JA 3U4QB 2QAGB 4BFSA 1XCGB 1Z6YA 2CL6X 1KI4A 3FTQA 3AP3A 3GJXC 4DUGD 1IN7A 3TK1A 4FMBB 1TU4A 1DEKA 2IYYA 4B6FA 1DELA 1G8FA 2DBYA 2H18A 1A2KC 5J40A 3U3RA 3ADDA 4DLTA 2CE2X 2IYSA 4FIDA 2QAGC 4DIDA 4QGAA 3ZVMA 3I32A 4Q9IA 5C2JB 3FGNA 2IHBA 4TSFA 5AR1A 2FOLA 4N0DA 1S0UA 1UADA 5E3HA 3W34A 3H86A 1QVAA 3B9PA 721PA 2QQ0A 1DARA 2P65A 4XD7A 4C0BA 2GVDC 1JEDA 3CR7A 2AK2A 3TIFA 1CU1A 2WWIA 2GJ8A 2Z4RA 1UPTA 3FMPB 3K0FA 2F1RA 3TW4A 4LWZA 4KSBA 1F60A 3NEYA 1Z63A 2D3WA 1S3GA 2GCPA 1N6PA 4URZR 1F48A 3VMFA 1KDOA 1G8PA 2ZJAA 3C16C 4NYMR 1AS0A 221PA 3NBZC 4AKEA 1Z8FA 2WSSA 4Q9KA 3KTAB 1P62B 3AF4A 3K0EA 4Q7MB 5G40A 1M6NA 5EE3A 2AN9A 4Z1MA 2CNWD 1AKEA 3AP1A 4EPTA 1DAKA 4JL6A 2CXXA 5AUPB 1Q22A 1TNDA 2VF8A 3SN6A 1KI1A 1AM4D 4KBFA 2FNAA 2O8FA 1GRRA 1UEIA 4PHGA 4NYIQ 3OZXA 1QDEA 1P2UA 2AWOA 4NONA 4M21A 1DOAA 2F3TA 2R65A 5D3MB 4O25A 1JAIA 2O8DA 2CK3D 4UXJA 3X2SA 4PHHA 3T12A 5CDFA 4QHTA 1NMZA 1UBCA 2B21A 2VLIA 4RD6A 3TH5A 1TAGA 1GIAA 4A4DA 2IYTA 2NIPA 1XP8A 3RVBA 1YVDA 2ATXA 2E87A 4ESHA 2YWFA 2V8OA 3CPEA 4LBYA 5A4JA 2QSZA 3H84A 2QTVB 3BH7A 1JR3E 4OHWA 1U99A 4FMCF 3MWLA 4IOMA 1E1QA 4FWTA 4OQFA 1II8A 3JZAA 1X8KA 4FCVA 2G6BA 1J70A 1KKMA 2OZEA 4O0MA 3KKMA 1GTVA 2OESA 3MUFA 4X8MA 4JZKA 1VYTA 1XMSA 1QVRA 2AXNA 3UG7A 3VFDA 1ZCBA 3M4YA 1T3SA 1FPMA 3SR0A 3KKNA 5TV2A 1OXTA 4MA4A 4S2EA 2RGEA 5GJCA 1NVVQ 4DSUA 2ANCA 4LJAA 5FL7D 4GL2A 4TZ6A 1T3LA 2Y8EA 3T15A 3SFZA 1MABB 2E9SA 1U0LA 2AR7A 2ZYTX 2A78A 2FEMA 2ZUDA 5EP4A 2ZI3A 4R9UC 4QNMA 3QPWA 3VNUA 1FP7A 2CBZA 1L7VC 3BOSA 1NY5A 2H92A 5AUQA 2NO1A 4IFBA 1CRPA 1CEEA 3U6KA 2HT1A 2FFAA 3DDCA 4BRWA 2ZYWX 4TMXA 1XZPA 4Q4AA 2JASA 1VCNA 4DB2A 4A0RA 5JEEA 1TTTA 1N0WA 1SKYB 2ZROA 5FOUA 1KI3A 1AJEA 4LBZA 1TL7C 4PAOA 1WBBA 1CJMA 1WF3A 2VHTA 2ZE6A 4R2HA 2WJJA 3QXSA 3OF5A 1FNMA 2R6DA 5CJ2A 2AD1A 4L4UA 3A1SA 4P4TA 4AY2A 2AD5A 2QP9X 4QHYA 4YMSA 4O3MA 1QG4A 121PA 3MD0A 5DI3B 2BEKA 1PVOA 3AUXA 3IILA 3THXA 4KODA 2WPDA 5FUYA 4B74A 4E5UA 3CRW1 2C2HA 5JBQA 2OE2A 3KDSE 3LVRE 1T9HA 1E2LA 1D8TA 3ETLA 1IN4A 3TUZC 2WHXA 4TQUS 2ZRGA 3Q8XB 4Q1DA 1U8AA 2X19A 3ZLJA 1Q0UA 3QG5A 3HU1A 4XWOA 2VEDA 1Z6TA 1FUUA 3K0SA 1G17A 2WWFA 1DS6A 1VG1A 2NO6A 3EC1A 2PL3A 1W0JD 4UXIA 3NIBA 3A4LA 4NL4H 2R62A 4PHFA 4PO1A 4GZMA 3P4YA 3QI2A 1RPZA 1OB5A 2HCBA 1OH8A 4B47A 2XOKD 3JZMA 1AGRA 4HYYA 1ZVQA 2DR3A 3K0AB 4Z51A 1XMJA 1KMHA 1IQPA 3TVTA 1UDWA 5KHOC 1P60A 1CBUA 2VHJA 3ZZTA 4PQYA 5FOSA 2OO7A 4LRWA 1UFQA 1BIFA 2FGKA 3GLFA 2O8CA 1EFCA 1KMQA 5FFMA 1HURA 1ZW6A 2GXSA 4KSCA 4F38A 1N6OA 2Q9CA 4MH0R 2Z6VA 1OV4A 4JLPA 3N5CA 2YZ2A 4BLRA 5F98A 4C0LA 3ADCA 2OCPA 4UNQA 3WYAA 1FNNA 1ZC4A 2QA5A 1KY2A 4URYR 1LF5A 1OT3A 1WRBA 3P1JA 4FN5A 3EARA 4LJYA 5IDVA 4F4JA 5FPYA 2AHOA 2IS6A 2OXRA 2ZM5A 4QHSA 3K9NA 2A7QA 1DAGA 2QMOA 2JLWA 1FL9A 4F92B 3GLHE 3DZDA 3AVWA 1Q3HA 2BMFA 1II9A 5FPSA 4CW7A 3UANA 1QHIA 4TYYA 1N6HA 3WMGA 3EW9A 3P20A 1MO3A 3PCRB 1RJ9A 3B1YA 2RCNA 3IO3A 2Q6TA 4Q4HB 4B33A 1U94A 1LS1A 4AG5A 4HLCA 4JLMA 1KHTA 3CW2A 3E5HA 3EPLA 4AKHA 2PH1A 1GZSA 3L8ZA 4PAQA 3S1AB 1N0UA 1FTSA 4UQOA 1QHHB 2ZJBA 3EZ2A 1CKEA 2ZI4A 3WP1B 1NG1A 4FWIB 1PUJA 3S1AA 1KK1A 2XB4A 2ZITA 2IF2A 4LJ4A 2BBTA 1DO2A 5IK2A 2HJGA 1E9AA 1NF3A 1X1SA 2O0HA 4C7OB 4HDOB 1D5CA 1QHNA 2OILA 5EP2A 5EXPA 1QG2A 4KLZA 4TMWA 4A1FA 4DSTA 4G1UC 2XXAB 1RKBA 1AN0A 4B3BA 3TE6A 4F93B 2NGRA 4ZCMA 2YINC 5JWRA 1KTVA 2GK6A 3CX7A 4CEHA 4RFSB 1EESA 3WHKA 1DADA 2X2FA 2W6ID 3P26A 1XB2A 4TL6A 4JLVA 1F2TB 3DPUA 4Q19A 4PC3A 1NLZA 3LXRA 3REFA 3ZD6A 2BC9A 4QOSA 4LHVA 2ZETA 1KZ7B 2NZ8A 5FBRB 1CLUA 1G7SA 2ZSBA 4A6XA 3U60B 5TB5A 1A2BA 1I4LD 1SGWA 3U4QA 4ZV4A 2G0NA 1VG8A 1ZM7A 1GKUB 2V3CC 1P2TA 3GJ3A 2KI5A 3CIOA 2YWHA 2CCKA 4MITA 4F91B 1E9BA 1YZUA 2J41A 3VKWA 3T06B 2HDNB 3RS4A 2ZSEA 3QKSA 2ODBA 2C98A 3O8CA 5D3QA 5LBIA 2A5JA 3TRFA 1R5BA 2IBMA 3L82B 4WA7A 1QHYA 4ESVA 1B23P 1E94E 4ZDIA 3K70B 2E1RA 1G7RA 5AUOB 3Q9LA 2P6NA 1XXHE 2ODWA 3V00A 1TUEA 1Q20A 2VSFA 3LX5A 5HTKA 3AF3A 4R7ZA 3VKHA 4ZIRA 2ZRPA 2R2AA 4BLSA 4DDWA 5EZ6B 1N6NA 1OIWA 2QPAA 2IXGA 2JJ2D 2ODNA 5SZJA 3EIQA 2A2ZA 4BLOA 3GCGA 1CULC 3H4MA 4C7OA 5H1YA 5JRJA 4M4SA 3EASA 2ZRJA 4DWJA 3E1SA 2X1VA 3EWSA 1Q1ZA 2OHFA 2VBCA 2KSQA 3CNOA 5AJWA 3LLMA 2F55A 5J4LA 2RGNC 4ACAA 3K09A 5GJWC 4AC9A 4UJ5A 2FSFA 4A8JB 3AKDA 3RABA 2H5EA 4D2IA 5FOXA 2WIBA 2GETA 2PZFA 5JJLA 5GVRA 3THWB 1E0AA 3M6AA 5B58C 5EUMA 3LXXA 2G0TA 4OQXA 1CR1A 4C0KA 3GLIA 2ERYA 3FYHA 2AL7A 1G3MA 2XB2A 2AKYA 5EXTA 2ZE7A 1A1VA 5H68A 1J8MF 2PEYA 3TUIC 3D31A 3KB2A 3OIYA 1KO5A 1SXJE 4CEIA 3AVYA 1FX0A 4JLBA 1LNZA 5TVKA 3U2QA 1RYHA 4XWAA 2UZIR 3PR1A 4TYNA 4EPVA 1Z0FA 2DFTA 2IXEA 3CX6A 3O8BA 4TMVA 4BFYA 1EGAA 1PLJA 1UBEA 4UNRA 4YMTA 1OH6A 3AVXA 1RJ9B 2W83A 2ZJ5A 1NNEA 2IYQA 4B44A 4RVCA 1I2DA 4HATA 5JZVA 1E9DA 3V4FA 4ASUA 1S96A 2GCOA 4HUQB 621PA 3B13B 1YE8A 1SKQA 2GESA 4KHZA 5SZIA 2D2EA 1NVUQ 1QZXA 1ZNWA 2QTHA 1DTSA 2O8EA 2ZR7A 2BVNA 4L15A 1HUQA 1ZIOA 2DPXA 4YMUA 1J90A 3VR2A 1OHHD 1Z2AA 1E3MA 4A2WA 4OK6A 4RJLA 1G6OA 1KNXA 1U9IA 5KPJA 5E4FA 2GK7A 3QXJA 4G3XA 4FINA 2YHSA 4C30A 4CYMA 1JI0A 2GVZC 3W9YA 3FDIA 2IA5A 4DJTA 2XXAA 1Q21A 4H1UA 3VX4A 3PEWA 1XJCA 1OXVA 5FTMA 5JSZA 1GSIA 3ZZUA 3RYTC 4B71A 5K8UA 4LPKA 5GJBA 1U90A 3IEVA 4DT1A 1YRBA 2CEAA 3BGWA 3DEFA 3PQCA 3K0CA 2XSZA 1FX0B 3CNLA 2RHMA 1GL6A 1WQ1R 4WXPA 4OI1A 3ND9A 1K8RA 3AEZA 1NIJA 4L8GA 4MGIR 5E95A 4EUNA 5LD2C 3B85A 4I1SA 3B7GA 3Q3JB 5DYIA 1OKKA 4DLWA 3EZ7A 1GKIA 2IF0A 1AIPA 2ZRMA 4TL9A 5DGXA 5BYKA 4I1UA 4IXNA 1GOTA 4LYHA 3MGCA 4QBFA 3EX7C 2ZEJA 4XVRA 3VNVA 1E4VA 4B2IA 1AS3A 4WZAE 2Q9BA 3QEOA 3RS0A 4MKIA 4PSAA 4RCYA 4URWR 3VX3A 3ECCA 1OIVA 1WDTA 1VMAA 1ZNXA 4DCUA 3UPUA 1X86B 1Z08A 3NBYC 5UKDA 1KK0A 1OJLA 2EVWX 2AKAB 2IK8A 2XEXA 3N70A 1E2KA 5IHPA 3LAWA 4LDJA 2YNMA 4MRRA 2L0XA 5SZKB 1OFUX 2YYZA 2X2EA 3KUDA 3AH8A 1OH5A 2QG6A 2CLDX 3ADBA 1EWQA 4XOIA 1NL3A 3OAAD 4J0QA 1W49A 3IQXA 2ZTSA 4OI2A 4Q47A 2NPFA 1A5TA 3QBVA 1G3RA 5JLJA 4JT2A 5L3QB 1CR2A 1T4GA 4FMDB 2VIIA 3SYKA 2OM2A 2HCJB 1X1RA 4Y0AA 2CK3A 3GFTA 3FHOA 1GNPA 2BMEA 4S35A 3R7WA 2HLDA 1HEIA 2XNDA 3TR0A 1FQKA 1XF9A 4OQNA 4GOKA 3I3SR 1IXZA 4QM7A 1W36B 3NC1C 3VR4A 2BIFA 3B78A 1NBME 1NMXA 2A5FA 3EIEA 3HPRA 1M1YE 1OFHA 1XJ0A 4PC2A 4WW0A 2XX3A 4M8NE 4O2LA 5FR1A 2GEVA 1W2HA 4DCVA 1S9HA 1SXJB 5CB6A 4BASA 1RC8A 1FP6A 2XJ9A 1E6CA 1SVIA 3AF1A 1XEWY 3LH5A 1SZPA 1ELOA 2ZI9A 2JCSA 4M9QA 1NN3A 3I1FA 2ZYUX 2ZAMA 1DG3A 3QKTA 1GNQA 2HXSA 2WJGA 2D74A 1P5ZB 1ZRHA 4IOKA 1ZU4A 2ECKA 3PEVA 4GPTA 4LCBA 5AUNB 2OUKA 4Z54A 2FGJA 5FBQB 5BN3A 1GUAA 2Q3MA 4IKEA 3T35A 1E79A 2IYLD 4HZUA 4Q7JB 1KDRA 3EZFA 1ZAKA 3G5UA 4GMXA 3H0KA 4WOPA 1YQTA 2OCBA 3BB3A 4BFWA 4TMZA 2ZSDA 3MJHA 3HJNA 1KSGA 3Q72A 3R9IA 1XD8A 2DY1A 4XH9B 2JDID 3NWJA 2BBWA 3GEIA 4BLTA 4QC2A 3SQWA 5G41A 2H57A 5C4MA 4EQ6A 4P4UA 1A4RA 4A0GA 4BLPA 3FMOB 4Q4HA 3IIMA 1HQYE 1VIYA 3MCAA 3TQCA 3VAAA 3HYRA 4DEYA 4I99A 1D2NA 3DHWC 1KSFX 3EAQA 2IYWA 2VP9A 4PO9A 3OEHD 1V43A 3A1WA 2GAOA 3P32A 1PZNA 4FW9A 4JKYA 1ZD1A 4A36A 4JVNA 1KOFA 4PPQA 4M1MA 3AM1A 4AYTA 5JS7A 4Q03A 1N6IA 1R6BX 1BOFA 2ZRLA 4CT5A 3U7EB 1P73A 1JR3A 2ZJOA 5DISB 4MYTA 5A0FA 1MOZA 4RZ3A 4DCTA 3HP1A 3W3AA 1M7HA 1KZGB 1XEFA 2NTYC 3PFIA 1NVVR 1QHGA 2ZJ2A 1M8PA 4LJ5A 3K70D 2JJ8A 1UDXA 4DSOA 3H1TA 1F5NA 3NG1A 2ZYVX 3B1ZA 2QT0A 4EPWA 2PLRA 4PX9A 4ERNA 2PEZA 1SVKA 2OAQ1 4QJ5A 3IIJA 4AG6A 4GDFA 4CEJB 1XTSA 4HB4A 4KXFB 2PMDA 3L8YA 2FH5B 4DC9A 3G82C 4R71A 2OLKA 1WXQA 3BS4A 1X8LA 3SJAA 2NG1A 2W0MA 4I1OA 5KTYA 4Q1BA 4AYWA 1E9RA 2WOJA 1XXHB 1VTKA 1F2UB 4JYBA 3TQFA 4E03A 3U61B 4MDEA 2O8EB 1ZIPA 2BWJA 3MLEA 5K8IA 4LY6A 3LQRA 1T6NA 2GXQA 4A2PA 4BGDA 4M9XA 4H9GA 2OFOA 1SHZA 3NTUA 2XOKA 4PZLA 2Q3HA 2OCYC 5LPNA 4NMMA 1MKYA 4E07A 4P33A 2YOHA 5L3SB 3VKGA 3BBPA 4DLYA 3BK7A 4AD8A 1KJYA 2J59A 3RAPR 3LVQE 4II7A 1G41A 1P72A 1SVLA 4GT1A 2R9VA 1OFIA 2CL7X 4K46A 1AZSC 2VL7A 3RRNA 1MRSA 2O8BA 3HU3A 3LO5A 1BYUA 1T91A 5KNBA 3T1OA 5M04A 2IS1A 1F2UA 1T3HA 5AJYA 4DT1B 3WBJA 4JLKA 1NBMA 3ZDQA 2X8AA 4TQ9A 1E99A 2PCLA 1RZ3A 4DUGA 1G3IA 2QMEA 3FKSD 2J0VA 2GCOB 3PENA 2ZIAA 4LSGA 5G3YA 5JJKA 4HB0A 1OSNA 1KI6B 2ZRIA 3SJZA 1T8UA 1VYVA 2JLZA 4WAUA 4LHXA 1FW6A 2C78A 3VU9A 2P0EA 3KJHA 4PXAA 3UIEA 5LB4A 4ASUD 1GITA 1KNQA 2C99A 2D7CA 3RS5A 4HSEA 5FOWA 3ZH9B 2QGZA 2HYIC 1AZTA 5TXGA 1UAAA 5C18A 2VSOA 4LK2A 3BH6A 1Z6GA 3WYGA 1P9NA 1P2VA 3KKPA 4QBHA 4BECA 2V1UA 3I92A 1MO4A 3OIUA 2D4HA 4ZO4A 5DNYB 4C3ZA 1KI9A 3G0HA 1ZC3A 4KVAA 5EP3A 4B48A 4CRWB 1OHHA 4WIAA 1G21E 4MGKR 4ACBA 2N1BA 2OLJA 3TSZA 1LB1B 3L0OA 3FFAA 3KXLA 1OIXA 5FBWB 4IOLA 2EYUA 3QY0A 1G5PA 1F3OA 5JCPA 3WYFA 4P0TA 3OEHA 3GPLA 1KI8A 1OFTA 3SEAA 3FB4A 4TYPA 4B73A 3EPJA 1UKEA 1E1QD 4IXMA 4PHTA 4Q1CA 4PC1A 5KU1A 2ZANA 1E2HA 1IY0A 3GEHA 4EQ6B 4BRUA 1BO6A 3IDQA 1Q57A 3L0SA 4QBGB 2B8WA 3QKUA 3LLUA 4QGFA 3FE2A 1IHUA 4JBYA 4NPHA 5KPDA 3RS7A 4B75A 1M74A 1AQUA 2AWNA 3GLIB 5JMTA 3FFBA 2GF0A 2BCJQ 2O5VA 4Q02A 3RC8A 1G4AE 1KK3A 1SVMA 1KDTA 2OFXA 2QMUA 4DVGA 3L0IB 4HDQB 4Q48A 3L43A 5DIFA 5CIWA 2QM7A 5CYOA 1QHHA 2QSYA 4BZQA 4NCKA 4HLQB 4Q1FA 1E0SA 2ZRFA 3NBFA 1JJVA 1TQ4A 2FV8A 2MMGA 3T1QA 3JVUA 4AYXA 4D82A 5C1BA 1KO7A 1JPNA 4POAA 1Z83A 1YKSA 3SHWA 1Q3TA 4RY2A 1JB1A 3THWA 2RGNA 1QF9A 3AVUA 1TADA 1PV4A 1OXUA 4JSTA 2J1LA 2GJ9A 1M34E 2GJKA 4YMVA 4HB2A 2NZJA 4HUQA 4TYWA 4RZUA 4ZCIA 1N6KA 5BWMA 2JEOA 4Q9JA 2QQEA 1E4YA 3DOFA 4L5BA 1S1MA 2WJYA 1Z0KA 4OQLA 2DB3A 1TF7A 3VR3A 1JXOA 1PUIA 1H8HD 3NKVA 2J3EA 3UK6A 1KI6A 3ZS9A 5CITA 3B8HA 3QKRA 1IONA 1XJQA 2B6HA 3BERA 3KKOA 4TLAA 2DCUA 5FI1B 4C0QC 3QEJA 2Z5FA 3BB1A 1G4UR 1KDPA 2W6IA 4A6PA 2IUTA 3B60A 2JJ2A 2JJ1D 1Z28A 2EWWA 3FKSA 4WVFA 4ZKDA 1IM2A 4Q4JB 1TQ2A 5BYJA 3ZJYA 5FPKA 1FOEB 4PC6A 2G9NA 1DVRA 3X1XA 2CE7A 1W36D 2PJZA 2IYRA 1CRQA 1HTWA 2QPTA 3QBTA 5FTJA 2IC5A 3W90A 5DH9A 2GZAA 3C7KA 3BFXA 2ZRCA 2HF9A 3TSOA 3UATA 3TJZA 1KAGA 5CM9C 1SXJD 2W6JD 3PUXA 2BHRA 1XNJA 3VR5A 2JLYA 4Y0VA 2PMKA 1NJGA 2VO1A 1E2IA 4HAZA 5KDDA 3U6BA 3GLGA 2J0QA 3CUEF 1VG9B 3A1TA 1HYQA 4IVRA 1W0JA 4CGZA 2C77A 3K0CC 3AV0B 3OIWA 4P31A 3VR6A 4OL0A 4IEIA 1T5IA 2GCNA 1WB9A 3RSOA 2QORA 4YONB 2QRNA 2CVFA 5B2ZA 1G3UA 2GKSA 4NYJQ 3KJIA 2IWHA 3HR7A 4NE2A 5H70A 2J7KA 3F8TA 4LHYA 2MSCB 4LPSA 4C9BA 1R4AA 2P2LA 2YJTD 2NOAA 3LBIA 1HE8B 1P9RA 1ZD8A 2WSSD 3K09C 5HCNA 3PV0A 1R2QA 3B1WA 3SU8A 1JXMA
chains in the Genus database with same CATH superfamily
4Q3NA 4EUKA 3UHFA 1SQ5A 2CDNA 4NQRA 2G17A 2GEJA 5ESRA 1CF4A 3M8KA 1LKZA 3RNLA 5LP6A 1CY0A 4XWWA 1CD5A 3RVKA 3VU8A 3M6XA 5F2OA 2HJ9A 1FYEA 5KB3A 5HFJA 4EW1A 5CFLA 4M1TA 1XZBA 1U0OC 1WTAA 2GWRA 1WE2A 2E7ZA 1GL7A 2BFMA 2PGOA 2BFAA 3D64A 3PFNA 1YQDA 1YR2A 3COYA 1UFOA 4HG2A 3Q1KA 4P3YA 3I09A 3K6SB 5TJHA 4KGZA 3UH0A 1XVAA 3BRCA 3EQ7A 3HB4X 4IIBA 4GI5A 4R1NA 3HG7A 1DCFA 1O96A 1DB3A 3CT4A 3DV2A 4RV9A 4YAFA 2IPMA 2BGJA 3UUWA 5L4LA 2D13A 2YWGA 2V4MA 4KUEA 3A6EA 5BSEA 3RAEC 1JWAB 4HYQA 1DQSA 3CNQS 3HA7A 3DE1X 3LZ6A 4U02A 3EG5A 3B2NA 1LFAA 1TZMA 2XVZA 1L7PA 4A03A 2X3FA 4LI0A 1RXIA 1Y5NA 3CC8A 1E2QA 1YB2A 3FVTA 3GLKA 1EHIA 3WWYA 1A8SA 1SBZA 2HXYA 1E5DA 2H5JA 2GB4A 1RZVA 2F6RA 1LBHA 3AP2A 4G5RA 1ZCFA 2EIHA 2R11A 3AF0A 4MVWA 2HHLA 4PYOA 3RK0A 2VTBB 3IQHX 1QVWA 3LCCA 3V1TC 1CQJB 2JBAA 1N25A 1U2PA 4R98A 1XRQA 2IS2A 3V2IA 1A71A 1W4AA 2EFHB 1PJSA 2C4KA 3BDIA 4KAFA 3U17A 3HBLA 4CKEA 3AINA 3HP7A 2WLTA 3DVRX 2PRJA 4XDHA 3GGPA 4B34A 5JVDB 4XB1A 3LRXA 5DX8A 4K9NA 2GN9A 2IODA 2TMGA 1NBEA 4TLMB 1EB8A 1FRFS 1GKYA 1ZH2A 4UM7A 4WFQA 3SC4A 5HP4A 2ZI5A 1R50A 3RG2A 4L8WB 2DFPA 4M8SA 1L0BA 1RBMA 4FYKA 5IW8A 2XWPA 3EC2A 1GM5A 5BUSA 1R5JA 4MVJI 5LQUA 1IAVA 1J07A 1ZISA 1AKUA 5LP6C 3ZV3A 5LB2A 4V38A 4AMVA 1Z07A 3G0IA 1T0JB 1V26A 4QT0A 2I7CA 5IAOA 5T4HA 1I7SB 1RABA 2IYVA 4UW9A 3U4IA 1FTNA 4M1SA 4WJLA 2J4DA 2YNMD 3SGLA 3ZXXA 2IV7A 5CX1B 3A2MA 3QYPA 4K2AA 2AVDA 1YR6A 5EUQB 3CF6R 3OTOB 1YZFA 3HR4A 3P71T 1KAEA 1R4MA 3D7MA 2IIQA 3EAFA 3QLVC 4QYXA 1GTL1 2GPSA 4RPKA 4WBXC 3H11A 3A36A 3TAUA 1KAOA 1OLOA 3E7DA 3JQRA 1U2GC 4LF4B 3P2IA 1M76A 1E6KA 3HR8A 2OV6A 2QJTA 3LHDA 2F62A 1GRVA 4G9BA 3IVCA 3D7SA 4HWSA 1ZIDA 4PG7A 5F3WB 3GG2A 5KTRA 3B1VA 4G0NA 4DIFA 1NURA 2XF2A 3O4IA 3HV0A 2VTVA 3BRWD 4DR4B 3KL4A 1QGDA 1P61B 1BFUA 3P9KA 3BN3A 4WESA 2VRNA 3B9QA 1CEXA 1YXMA 3H3JA 2HU7A 4WACA 1YD7A 3U9SA 1PIWA 5HXAA 5JSFA 1G7TA 1BEZA 1DOZA 3L1HA 5TR9A 5H8WA 4LMRA 4XTCS 1E8NA 1HZJA 1W5FA 5EP1A 1KK2A 4NKRA 3ZE8A 1GTRA 1CK4A 4GI2A 3C3CA 1FUYB 1HEUA 4Q7LA 3T6KA 2WKWA 1YT5A 2Y0DA 2GYYA 1F6BA 2PWYA 3NXSA 1X3SA 1Z6XA 4FGZA 1XHFA 2Q9AA 3HJRA 1JQAA 3MOSA 4P3PA 4XIFA 3PNPA 2YVQA 1T8RA 3N2YA 3BD7A 1X7XA 4KN9S 1M2VA 2HUPA 3O90A 3T4PA 2IY7A 1HOTA 2OV3A 3Q15C 5K8VA 3GEEA 1T2FA 4QOGA 5AVQA 4LBWA 2W6PA 4M9CA 3AW9A 4GBED 5BWNA 2VP2A 4G89A 5FWNA 3UMMA 4ENUA 1QBKC 2Q5JA 1U8ZA 1MH1A 5E1MA 1EGHA 3C24A 1TJYA 4H7KA 3U44A 2ZTHA 2BZ0A 1VHQA 3T99A 1TEXA 4BNHA 3G5LA 2HPHA 16PKA 2ZB8A 3EXEB 3BB4A 1W46A 3AUTA 4NZ9A 3FTDA 4LAFA 3NV9A 4NU8X 3KQSA 2JFNA 3DVSX 1RWOA 4ZA2A 2ZJ1A 3ZHVA 2OAGA 2FQ1A 1YZYA 4QTYA 3TI9A 4OF4A 2F4VB 3WNZA 3P0HA 1LRKA 3EWAA 3GJQA 3GGSA 3KAKA 3KXIA 1AGYA 5IBPA 2ZWOA 2CT8A 2VSYA 1JEAA 4LDQA 4LJRA 4PFSA 2E6UX 4RZ2A 4OMFG 3UYLA 1E2MA 4F21A 2J0SA 3ANXA 3OOYA 3T9BA 3U7IA 1CUZA 4D9HA 1Q84A 1TMYA 2J9YB 3PIIA 1KOLA 4H1VA 3IV9A 2ODEA 2FZGA 3WAGA 1POXA 4BVLA 2YWDA 3BKXA 1AOXA 1XXLA 2IW3A 4LJ6A 1CUFA 4LJ7A 1EE1A 2H2DA 4ZCQA 1A27A 4I4TB 3CO5A 2J3QA 3M83A 5C7OO 2FRXA 2Q46A 5K3DA 4Z4HA 7REQA 4EFLA 1MDBA 3GGGA 1AK9A 4ITRC 4EEXA 3D6TB 2XNCA 4WH0A 2C5FA 4IDGA 3WV4A 1NM5C 3AILA 1KR5A 3L9WA 1W47A 1XJWA 4X1OA 2W58A 3D6MA 1C1DB 1EVQA 5DTMA 1Z8DA 1XTKA 2ID7A 3M49A 3OX4A 5E6SA 3U9TA 5L45A 4B3MB 2V4UA 1Q3KA 4JLNA 2FE1A 2YXNA 1O94A 3HHEA 3MRVA 4KQXA 4DNQA 1R9JA 4M6WA 5SZHB 2WAOA 3HV2A 4FCWA 2CV1A 1SUBA 4R84A 4WPGA 1CFJA 4QU0A 4B9AA 2UUAB 2I4IA 4IGFA 4LOJA 1AKYA 4IG4A 5JDIC 4RULA 3MMPA 3I4FA 3GA7A 1WSWA 2Z43A 2NW6A 4CM5A 2IKSA 3NGLA 2JVKA 1CUEA 1ONSA 2BCEA 4PLFA 2R48A 4DLVA 4MRMA 1QH9A 4JP8A 2ZJ6A 4R6WA 1QRTA 1SA0A 1C0EA 1QHEA 5EFZA 1SXJC 4BO3A 1H8EA 1RXCA 3WL3A 2GPNA 3UEOA 2HQ1A 3JQ9A 5FOTA 1IE3A 4DYVA 4L5IA 3T5GA 4IMPA 4H4EA 2G83A 5KYUB 3N28A 2VTKA 2EW1A 3P2JA 2IZ1A 3ZWQA 3IERA 3TECE 1MFZA 1NXPA 1P39A 4AJIA 4QJ3A 3DGFC 5LOVF 3CZPA 3IAS6 2V7GA 1YS9A 4A5OA 1WSBA 5CM8B 1ZMTA 1NN0A 2ZE5A 3CJRA 1DHRA 2PY6A 1GZUA 1JG4A 1O3YA 4YCBA 1R16A 1W88A 3BF8A 1COWA 2P9CA 2GEFA 4J0HA 1S1CA 4BUJA 1WXFA 1E5TA 4XB6B 2M6SA 4YJDA 2BUCA 1F0NA 1J33A 1LS6A 2A3RA 2HPZA 2JGEA 5CDYA 2FEAA 2EFYA 4V1CA 1BXGA 1EXWA 2E21A 4D3YA 3A4YA 3EF1A 1WA5A 2M2IA 3R6DA 5LDHA 3V1MA 3ZE6A 1CJTC 4X7RA 2OG1A 4XVUA 1Y6FA 4EKNB 5ITSA 3PDHA 4FYPA 1GV0A 3FR7A 2C7VA 4Z4FA 3EY4A 3FSGA 4ZZIA 1PHRA 3DMRA 2IHKA 3LFTA 5AW3A 2IUFA 1CVLA 3HFRA 2YXDA 4Y6LA 1M83A 1N78A 2GAFA 4IJUA 4QOEA 2X7JA 3EXHB 4OQYA 5KNDA 5IFKA 2HMAA 2W6CX 4GEGA 4KQ6A 3U1TA 1GLGA 3STXA 5HF6A 2WLSA 5AM4A 2PT5A 2EJWA 4KN5A 4NEHB 1XBTA 4QULA 2XSZD 2NU7B 1YR8A 3OEED 2VDWB 4CMCA 1T2EA 5ALPA 5AJXA 3NDBB 1IWPB 1PL7A 1KEKA 3JZFA 1DIAA 4E2WA 3IB3A 1YOBA 1TYEB 3GFQA 3STYA 4E14A 1LBQA 3AG5A 4MLDA 4JT4A 5JISA 4NFYA 1Y1KE 4WK0B 5EHIA 1JW9B 4FDTA 3O92A 3ILHA 4L02A 2PMEA 1L7OA 2YL2A 5CIYA 3FCSB 2Q28A 4W99A 5CT9A 2IH4A 3LCUA 2POQX 3SQDA 3OMXA 1LNQA 1O9GA 1I4EB 1QHXA 3JAWB 5FTKA 2JLVA 2ZQ5A 4I55B 4C2AA 1GP2A 3LA6A 5DN9A 2TS1A 3V7FA 2QVZX 4US0R 2C42A 3LXMA 4MW7A 1QIKA 4IJVA 3ZTWA 1TAHA 3DL0A 3G9ZA 1HYEA 2WICA 4PTLA 3QLEA 3TR5A 5BN5A 5JOQA 5LXTB 4J4HA 4EJSB 1E6EA 1OROA 1VDMA 2B37A 5HZKA 1USUA 3KYDB 1ZGAA 2AK3A 3WWCA 2RGRA 3I2GA 1Q2UA 1ZGGA 3L18A 2FZLA 4LYGA 2NUPA 4MKZA 3L6EA 3L77A 3N59A 1LZKA 3FUCA 2EW2A 4L7QA 1GU0A 4A6DA 4ZCTA 5C8VA 5SY6A 5JI2E 5IVPA 1RRKA 1XA4A 3PP8A 2ZREA 1XZGA 2J09A 3IJPA 1S7CA 2N46A 4MR7A 3DMNA 5EQJB 4W5OA 2A67A 1QG0A 2ZYIA 3PHLA 1JG3A 1IY1A 3PD0A 1VKJA 1M8KA 3CE9A 1E2FA 1F17A 3L7AA 4H18A 4H6WA 2WQZA 3R8FA 4P0QB 4JCOA 4MQFB 5D01A 1EEHA 3G5AA 1LVGA 3PGKA 1KIMA 2Q8NA 4UHEA 2YXBA 1ETUA 3TM5A 1X7ZA 2WDPA 3ZIDA 3I5AA 4BUZA 4UCFA 3U7RA 4ED9A 3CY6A 5CW1A 4DXDA 1YB1A 3AZQA 1JILA 2FHSA 5MN6A 1XCMA 3IQDB 3EH2A 3KZ1E 3PVZA 4NESA 4RPGA 1KR2A 4OFWA 1N6LA 3HVHA 5LU9A 4H6PA 1PJZA 2P9HA 4LXYA 4ROSA 5A1TA 2ZVQX 5DCYA 3DD1A 4UBOA 4QREA 3TNDA 4BB6A 3EMBA 4B3FX 1QE3A 1LTQA 1XYVA 3UFXB 2GPBA 1ZD9A 4KXXA 1NSFA 4F6LA 3THYA 2ZU6A 4MRPA 1NF8A 2COKA 1K6XA 2LPMA 2XNKA 1E96A 4I1RA 3TZCA 4CCWA 2GPWA 3MEQA 1HX7A 1BQ3A 3MWYW 3U7JA 1YDHA 4B0PA 5ALKA 4L6AA 3IDSA 4A8JA 2JCVA 4BN0A 1ZMBA 5JSYA 1KI2A 3O8LA 3VDQA 1MJ5A 1B93A 2ZXEA 4E6EA 1QIJA 1JKXA 1GNTA 3M81A 5JQGA 1D1QA 4AAYA 2NACA 1GPMA 5J4KA 4C4RA 4D02A 1N2GA 2DUWA 1WCIB 3FVQA 3OFNA 5EJ7A 5KTNA 2Z1DA 4FFLA 3WHLA 5HKKD 3PQEA 2B82A 2GNOA 4POOA 4GQIA 3RANA 4R83A 3GLTA 3WGJA 2ZIFA 2HU2A 2ST1A 4CL0A 2DWPA 1VCMA 1DJOA 1J5PA 2FPIA 3NVAA 4WNYA 3QFFA 3AY3A 4M22A 1M8GA 4EK9A 1GAJA 1B0UA 1B2LA 3ABIA 2VR1A 4ZI7A 1VJTA 5KDLA 4C22A 3DVAB 1YNOA 2NU8A 3K9QO 5J4HA 5COAA 4HDMB 2HDHA 3E3AA 3O3NB 2OL4A 1UJ2A 4FOSA 5EJIA 5BW4A 2P11A 1G5HA 1J8DA 1JQLB 1DAPA 1MB0A 4HDCA 3ZKWA 4B3DA 1SY7A 2OB1A 2G67A 1GZ4A 2Y05A 3E5RA 3KEQA 4KVGA 4MRNA 4RU1A 1QO9A 1KZ9A 2RGDA 3CBQA 3ECSA 4CLEA 2UZ1A 4DSNA 1D6JA 2CUTA 6PFKA 3BL5A 4LQDA 3MZ0A 4M53A 3BFVA 2ZKIA 4OGLA 4KQHA 1DAFA 1VLZA 1DTWB 1E3SA 5E2AA 3LT0A 2BKLA 1YS6A 5EZQA 3RWBA 4N6GA 1ID8A 1XD9A 3CF2A 3R24A 3LSYA 4HBZA 3U4DA 3JQFC 4YP0A 1XQXA 1KAMA 3EBOA 4BQSA 4J9UE 3W9BA 2K6GA 4QKQA 3G68A 3K8QA 5EPUA 2FZCA 2GBIA 4BOYA 2NSJA 4Z0PA 3R7FA 3ND6A 1IY9A 3FIJA 3QQ5A 1FJHA 3JD2A 1EGMB 3HFJA 4JL5A 1TQ6A 4P7FA 5INTA 1J22A 1EJ0A 3AU8A 2LCFA 3GJ6A 4WL0A 2ZUTA 3IESA 1YNSA 2I8AA 3STVA 1Q44A 3MJFA 3MRSA 2C88A 2GTIA 4IRUB 2V9CA 4WNIA 5TMDA 4I3HA 2UYQA 3FPBA 4J1NA 4C76A 2R44A 4Y9DA 1YOVA 4ENWA 4ZOLF 3R6GA 3HNRA 2BEJA 1Y8QB 2IUSA 5BWLA 5JHGB 3FYTA 3HFSA 4EI7A 4NSNA 1ZFNA 3RT9A 1IFXA 3SXPA 1P9WA 4X91A 4CCYA 3WZMA 1A2QA 2C59A 2BSAA 2WE8A 4D92A 5KYGA 3B2EA 5CK5A 2I6QA 2VAWA 4GSLA 3ZUGA 1JAYA 4BQPA 2O0JA 4EI9A 2CFOA 4HEJA 4JFRA 1PWEA 1UF9A 4ARUA 1YMVA 2PBLA 1KE2A 2C92A 3WLOA 3F73A 1D0SA 4E5KA 1I7NA 4KXVA 1FTQA 4WZAA 3PQDA 4U2EA 4B6PA 2A9QA 5TQVA 3ADKA 2XZPA 3L6RA 4YRBA 4MUHA 1MN6A 3HYTA 4D4JA 4RD2A 5F7ZA 4NNJA 4WNAB 1S7GA 4JMLA 4NU0A 4K5QA 1E69A 3F49S 3FA2A 3KR9A 3PFKA 4LXIA 3E05A 3TLGA 4ARZA 2I29A 5IZ4A 4L57A 2QJOA 3G13A 2HA5A 3DCIA 4RYDA 5ELXA 1U6IA 4C6SA 1CIPA 4HLUC 2TMYA 4NK4A 5E7MA 5FR2A 1M66A 2E48A 2ZU0C 3LJKA 4AICA 3FNRA 4JASB 1JAHA 2IHVA 1Z0DA 2Z09A 4XX0A 5DM2A 5BSVA 4OHYA 2V9PA 2E18A 4NE7A 4NYIR 5DDIP 4EOGA 1KMMA 1C3VA 2LR0A 1Q0ZA 5FJIA 4LYJA 4FCCA 4F7DA 1RYMA 3IYLW 2GHTA 9MHTA 3QX7A 1U2ZA 2EKBA 1S8OA 4YYZA 3F98A 1OA0A 2HADA 4RC9A 4HJRA 4EHHA 3IE2A 4TYQA 1GEEA 3R74A 3H5TA 2AFIB 3ZN2A 3FJOA 3DE0X 1ESEA 2VHZA 3I4LA 2B8TA 4YJ2B 1HG1A 1Q1QA 2IX3A 3EVEA 1N3BA 3CSDA 1XN1A 1ZL0A 2BRUA 3CX3A 2CXSA 4MARA 2V4ZA 1WOMA 2XKKA 3QU7A 4CR7A 3RC1A 3X1ZA 4KFRA 4BNZA 4ROTA 3TZLA 3A37A 3VH4A 5CLJA 3JQEA 4G5FA 4FCTA 3IHWA 3RFVA 4BJ1A 4MW0A 2IYEA 1IEQA 5IBRA 4JEUA 3ESXA 4RKEA 2WK1A 4TTSA 5EMJA 1V4BA 1IXSB 1VSUA 1YA4A 2GSDA 4NIMA 2W2VA 3BK2A 2V6IA 2BMDA 5GGYA 3G6KA 4IFTA 3SR3A 4BLQA 2I1QA 1GXSA 2BSXA 3BC1A 4ZO6A 1Y5IA 4KVFA 3R0XA 3UO8B 4IQGA 4RMIA 1C4XA 4NI5A 2VAPA 4L8FA 4OTZA 2XGOA 1KP9A 2A1TR 1WW3A 2WFLA 1MVOA 2Y1GA 1S4QA 2ZWAA 4PLZA 2OQVA 2NZWA 1OAKA 3NHLA 1K8ZB 4MHOA 2GPJA 2NTJA 3AR9A 2Q8QA 4QO7A 5FTWA 4JKIA 4NDZA 1YJ5A 2AI3A 3JD1A 3PITA 2YIMA 4FSDA 4RF2A 3LKDA 4P4SB 2OXFA 2I4OA 2C2ZA 3JSXA 4YJFB 3P94A 5ALFA 4QODA 2B2XA 2GQ0A 4MMXB 3KWLA 4EL5A 5F9HA 3EDMA 1ZJ4A 3WZLA 3ERCA 2OCXA 2Q4BA 4L78A 1W4RA 4CJXA 1QU2A 8ADHA 2UKDA 3PWKA 2PUWA 4I4LA 2KB0A 5DRYA 4E13A 4K3UA 2GEKA 1KEVA 3T7RA 5JU6A 2CLCX 2NP7A 3RGGA 3KTDA 3SS9X 2JFPA 2YJ6A 3AIMA 3CR3C 3BXHA 2GILA 3DHEA 1I2ZA 4PONA 4JQZA 2AG5A 4S1PA 1ND6A 1PR9A 3UXHA 3VPBA 4BYGA 1A9XA 3C5CA 3IULA 2IXAA 1O6CA 1QG6A 3LYUA 5JWOA 4G37A 5F1PA 1UKVY 3BTOA 2JIOA 5EHGA 5SY9A 1XPOA 2VP0A 1G18A 2REQB 1M34B 4YDSA 5IJ9A 1VPLA 3WGZA 3GLQA 1K63A 4A92A 4BPBA 3GLRA 3DNFA 1DX9A 2D62A 3RK1A 3ENWA 2QD3A 3TRDA 1GNSA 2C0PA 1HM5A 3MTQA 3PEEA 4JBLA 4LXQA 3FSRA 3NJ8A 2GZHA 3ZWAA 2C03A 1VJGA 1P1BA 4HPXB 1N4DA 1PJAA 2OAP1 4O5OA 3PNQA 1P0PA 3QITA 4EPRA 3BCRA 2JL1A 1VLHA 4TL8A 3EDQA 2BGIA 4Z9YA 3GVHA 5DTIA 5JVDF 2NO9A 3DMDA 5DMXA 3CUUA 1I7DA 3G7UA 3KYCA 1OF1A 2G71A 1U4OA 4ZMRA 4QU9A 4DLZA 2DLCX 4RIGA 3RAFC 1I6MA 1NVGA 2FCRA 1P4SA 3ITDA 1U3VA 1OLUB 3JAKA 1IC6A 5GWXA 3B89A 1W35A 1S9DA 3ZGYA 2AV6A 2XGJA 1OCEA 1GN9A 4E33A 3KK0A 5LQJA 2HOQA 3HMKA 4J0FA 4W63A 1RE0A 3NYRA 1WBJB 3ANTA 3DMGA 3H4VA 3K1JA 4WLEA 4DQXA 4C7KA 4EBBA 5LIRA 3I01A 1O95D 1Z7EA 3BWXA 5LMUB 4W1RA 4BMDA 2PBRA 4KV9A 4NJEB 1LTKA 4G0PA 2VWHA 4I6JA 4URUR 3DCNA 2PS0A 3N2NA 2EU8A 3Q5GA 1GFWA 4UUPA 3WFIA 4B5KA 4R2MA 4CEJA 3LBFA 1UPXA 3RVSA 1N5IA 4E30A 1Z4MA 5TLSA 4DAEA 1QM5A 2ZSAA 3K4HA 4UULA 2R8RA 4H4CA 4LV6A 1TLLA 1VLJA 3ZBQA 3GJZA 1VJ5A 4CM3A 3L1UA 2FN7A 2QL7A 2WWHA 3KOZA 3H9BA 4MAMA 4UAUA 2ZB7A 3P0IA 3U13A 4M0CA 4PQRA 7GPBA 2ASEA 3TRJA 4K05A 5FHRA 2XNSA 3CNHA 3RJ9A 3AEQA 5I4CA 1VYUA 2G3YA 4KFUA 3GPCA 4DV7B 2IL1A 2GKGA 3PEUA 4OM7A 3UMJA 1R6UA 3BJRA 4ZARA 4JN6B 1RI5A 1XTBA 1VB5A 3ESBA 2CV2A 4CM9A 5BWCA 4R6XA 1L5WA 5FNVB 3HRKA 4CR6A 2J0EA 4B0OA 4DNPA 2K5UA 2GPYA 1GNVA 3AOGA 2GXUA 1KJWA 4TMFA 2H2AA 2YQZA 5IBQA 4A8TA 3SHFA 1GCIA 3HKCB 4D4MA 3PVCA 4DC1A 4C6HA 1XCBA 4QVIA 4G0XA 1ORWA 2PLNA 3AKEA 4OA5A 2E6KA 1HE1C 3KUCA 4N9QA 5IK2D 4MUBA 1BN7A 1C2TA 1L5HA 2IIPA 4NCNA 1ZVMA 2RGGA 1Z4LA 1E5QA 1RMYA 2J31A 5FUBA 4DWOA 1AU9A 3DM9B 5B4UA 3SXJA 1V2GA 2P7HA 3NTVA 1XPJA 2E4YA 2I4LA 1QH1A 2V6BA 5IT0A 1AHNA 1PFUA 2XUPA 4AKGA 4ZOEA 4KJZA 2XADA 2P9TA 3D1LA 1LPMA 4GI7A 2WF5A 4ID3A 2HAEA 1E5LA 2H63A 4BB0A 2VZ9A 4U6NA 5A71A 5BV8A 1QC5A 2XCQA 4CHTA 3LO8A 2IHTA 2GHQA 1UKZA 1AKWA 3GJSA 1I5RA 2C7OA 4AO8A 3V9PA 4DDHA 2ZG6A 1C3JA 3ETNA 4UCXA 3GU3A 3N05A 4REQA 3MF4A 1ZXBA 4B3HA 2B5VA 3ES9A 1L5SA 2ATEA 1DX6A 2XPCA 3EXFB 4HTFA 5JC8A 2VQSA 1OLXB 4M1OA 4E2XA 3I58A 4J0GA 2JAQA 4J7XA 1OC4A 3WLJA 2Q6LA 3HZRA 1KH2A 2SNIE 4JBHA 1XD2A 2CL0X 1IN6A 1UMCA 2VT2A 3BFPA 4H35A 4GZ6A 5B7QA 4QD3A 5BP7A 3GJ8A 4YXWA 4OHMA 1U0TA 1Z06A 4IDDA 4N8DA 2J9FB 3VZCA 4GQBA 3THYB 2OBNA 1BKSB 2G6TA 3NRBA 3DDSA 1J0BA 1Z2DA 3HWSA 3OJWA 1TCAA 1JG6A 2FSVA 2OK8A 2BKAA 3M9LA 3O8OA 4MWEA 5CNMA 4EM6A 2ZM6B 3ZJTA 3VI4B 1PNTA 3E7XA 2BN4A 3DF9A 3VNRA 5JATA 1ODLA 5JROA 2HA0A 4F5YA 4M0PA 1C1XA 1MHTA 1SRQA 1VJDA 1CNFA 3D5EA 1BE6A 2FWNA 3S5JA 2WRZA 4DMUB 1AHHA 3TD2A 3OEWA 3OIVA 3RRMA 1RQ7A 3F47A 3NFYA 3T3IA 6YASA 3WTCA 3IJ5A 3KKQA 1E1LA 1NC3A 3EVGA 1L1QA 1F2DA 4Y6OA 5BPFA 5CYPA 1A76A 2ID4A 3L7MA 3Q8WA 5DX1A 3EH1A 5KYXA 4N65A 2EBWA 1ESMA 4E08A 3BHIA 3DO6A 2YV1A 4IVNA 5AKYA 3WLRA 5B12A 3TTWA 5DMHA 2POCA 5E4TA 3I6ZA 4QPPA 3ASYA 4RMHA 5CGZA 1US8A 1MRZA 3WTBA 4FHGA 1CJVC 4ZTUB 1Z6AA 2AW5A 4R9VA 4KFTA 2YN4A 4FK8A 1R27A 1TVMA 2OYCA 3TINA 3K2QA 5EJ4A 3K9BA 4JP5A 5CTAA 5CDTA 4CF4A 5TMPA 3FNFA 2F1HA 3DXYA 4V03A 1N2JA 3AHEA 2RIRA 3G0DA 4TV9A 1DKPA 3BT7A 4KCGA 5BT8A 3AIKA 1B76A 1D6NA 4DLSA 1R7RA 4EYQA 5EJFA 3MCVA 1Z6ZA 3F2VA 4G25A 1MO5A 4DDUA 4B4VA 3MT7A 1QRSA 3QFTA 4LUCA 1QXSA 2FRDC 1P6UA 1HDEA 1L4HA 3VH3A 3AERA 3W77A 4DAOA 5BQXA 3PDJA 3CR8A 1JZSA 4IDOA 1POWA 4O0LA 3VGJA 4LC1A 4CM8B 1TJ5A 5IT5A 1USGA 1ZK1A 2H4WA 3Q7PA 3R8CA 2Z2XA 3JQCA 3ET4A 2XAAA 1MW9X 2EEPA 4Y2SA 2XMSA 2IP2A 4KBYA 1JKFA 4WERA 3JTMA 3T52A 5CYGA 4JVMA 2X58A 1N0VC 2X9NA 3C8ZA 4AS1A 2DULA 5U9CA 3D6NB 1AMNA 3NXKA 4YP7A 1ZBQA 2CY0A 3CGWA 2A5YB 3PA8A 4CQJA 1ACJA 3O94A 2BFEB 1W6UA 1WUHS 4BNMA 5KVSA 2WKRA 5AQ1A 4C2TA 2VWPA 4DDVA 2EJBA 3GVCA 2DPYA 3ZHQA 1Z29A 4L7VA 1IULA 4QUGA 4M37A 4HVTA 2F17A 5D3ZA 1EVIA 1I1NA 1F9AA 2GR9A 2IZOA 2X14A 3P2KA 3T9DA 4EHJA 3VZSA 1V5WA 4F3CA 3CVWA 4MVJP 3E2MA 1C0LA 1Y8ZA 5DEIA 3DFZA 3BCUA 5EJGA 5G4KB 4EKIA 4Y2VA 4AJEA 2QRKA 1LC0A 2QD1A 4KXNA 2RAPA 4YWHA 3CZ4A 3HUUA 3JASA 5FRDA 3TI7A 2PKRA 1P2BA 2QRUA 2HIHA 1O57A 3B3AA 1JMKC 4R5HA 4YAOA 3TD6A 4ZU1X 4O4LF 4XD2A 1MC5A 4UTPA 2YOFA 5CDGA 4Q16A 2PZEA 4G9EA 4KLNA 4ZDKA 3H7IA 3WWPA 3RRYA 3ZBTA 3ML1A 3MWJA 4GM0A 1ISHA 2QM8A 3LZCA 4RVFA 1KYVA 4GPAA 1GGHA 5HJ5A 4GUDA 3K5WA 5LA6A 3TLAA 4JJ4A 5HJ2A 4ENRA 4DGSA 1D2MA 4F2PA 4JS0A 4D7AA 2Q29A 1F3LA 3TOZA 3AKCA 3FOAA 1ORRA 3K8YA 2LNDA 3F4BA 4GNKA 4OHXA 3PCTA 4EH1A 1ZIXA 4C04A 2G1KA 1SXHA 2W98A 3WIUA 1OXBB 3HDVA 4XX1A 4QBIA 3RRXA 4EJ0A 4HEA1 1A9QA 1U2QA 4L2IB 1CR0A 2C95A 2P1RA 2PSDA 2LZ0A 2AEJA 2XITA 4F3YA 1I4TD 4R9RA 2JI6A 1ODTC 2CHVA 2GYWA 3K72B 4S0XA 3UOGA 4BQQA 4MGHA 1K3FA 4XWKA 1Z2CA 4ID9A 5DHSA 1GRNA 4N5MA 3OLWA 3UTDA 3ASZA 4IDBA 3IVGA 4U0KA 5JCJA 4Q66C 2VC2B 3CZCA 1B15A 1MHPA 1PBTA 2QMHA 3NNSA 3GFVA 4QQNA 5K99A 1UJNA 3JARA 2GT1A 3L8FA 2J7PA 3P0EA 1OX6A 3LCJA 3LY8A 4D8UA 2XE6A 1BU5A 1JWBB 4HNTA 2VSXA 4BO6A 5B64A 4RTKA 1QPBA 3DZJA 5H9VA 421PA 1EH5A 2J9FA 4AZTA 2WM9B 3PFFA 3HB1A 1ZK0A 3TLEA 2XRYA 4C0SA 3E2PA 1GYPA 3LIPA 2UVQA 4HD8A 4NG4A 3WWDA 2ZYHA 3GAAA 4RPIA 2Y2VA 2O7VA 1Q0HA 1J9ZA 3FZNA 3OP4A 5J1TB 3LWNA 3W8RA 4NTZA 3VZPA 3LDUA 2HGSA 3LDGA 1PS0A 5AW0A 4YT2A 4YQFA 1P9OA 4EYOA 3BGDA 5TEVA 4Q0MA 4V1CB 2VVTA 2BTQA 1XCPA 3QJ5A 3HGQA 5CA0F 3NCTA 3OECA 5TRTA 3V46A 5DN6D 1UC8A 4DABA 4HX5A 3DE3X 3P0JA 2AOXA 1P7CA 2OV2A 2JG3A 4PZUA 3RS3A 4BFZA 3AF6A 3PEYA 1HE3A 2Q3CA 4CHGA 1E3EA 3PJRA 2OXCA 4R2JA 1MAWA 1N75A 1NVAA 1TJ3A 1CDZA 3OH8A 3A1VA 4G1EB 4KDFA 3PUHA 3BJZA 2I6FA 4MGYR 2I65A 5CCXA 4ICIA 4ON9A 1JIJA 4OJQA 3BIFA 5DT2A 1V7CA 2Q3FA 2WMDA 3W4IA 1I6WA 4PYJA 1PR2A 5C31A 4WKPA 4GLOA 3KOMA 2OYSA 5G2OA 3TQTA 1RHRA 4LZWA 5DASA 5EJ9A 3HUTA 4WKNA 3TZBA 4HUTA 3SHOA 2PFGA 1R9MA 3HWRA 3PC8C 3IV7A 4JJFA 4NCIA 3ANLA 3SZOA 4DQVA 3KJFA 4PAWA 1W5TA 3I04A 1CUXA 1EWVA 3GXOA 1P4JA 2RH5A 2P7IA 3AV3A 4GICA 3I5XA 1AGPA 4B5LA 2QN3A 2GHRA 1L2TA 1GU7A 4WZZA 2PD6A 5KVCA 3WR5A 5FWAA 4KNWA 1M75A 1CZOA 2DHQA 2JGNA 1P4RA 4OGKA 5KJ6A 2AFIE 2VNIA 3JV7A 4GP6A 5C8DA 1WCV1 4OBWA 1U63A 2JATA 3EVDA 2UV8A 2YV5A 2A0FA 1PSDA 2NAFA 2MT9A 1VHJA 5NLLA 1QFSA 4X6LA 3PB3A 3L7JA 3L7KA 3ABQB 1YA8A 2YY7A 4L28A 1T9AA 3CKKA 4FM9A 2AG1A 4P80A 3Q85A 3V8VA 4XWGA 1KYZA 3MTJA 4TVSA 2LKCA 1N0HA 3E70C 1XAIA 1NLUA 4J3NA 3AB3A 3RVMA 4ZVNA 1ZD2P 1MDFA 3JZIA 1FFEA 3UJ8A 3MB8A 2Q99A 1RCFA 4O8CA 2N42A 3RSLA 5LD2B 3PPYA 8ATCA 2FF7A 3OJFA 4G67A 4Y8VA 5H16A 1TJ4A 1M2OB 3DZGA 7ABPA 2PX0A 3ZU4A 2G70A 1GRQA 1W1IA 4YP6A 4UHKA 5E6UB 1MFPA 2BT4A 1UBFA 1ZWLA 5B4TA 2GA8A 5LL6P 1KJ8A 4YP9A 2HSDA 4QL3A 5FDFA 4KWIA 3DGEC 5B6PA 9ATCA 2P6OA 4HBGA 4ZGGA 5IXSA 3ZZ0A 2WBLC 4JJ6A 5F2EA 1E2PA 2PX3A 2B0CA 1TKAA 4HHEA 5GM2A 1UDBA 5JYEA 4M1EA 1IXKA 3N58A 1G64A 3CKLA 3DPSA 3RHTA 5KSYA 2IOQA 4TV8A 1IBCA 4QXPA 2TRSB 3C7AA 4RGQA 5ELMA 2FYTA 4KJXA 2F9MA 4MUJA 4TT3A 4BXOA 3VBCA 1UC9A 2G88A 3LMKA 4A73A 4F97A 2BFBB 4A0QA 1JDBC 2ZUFA 3FHJA 2OBMA 2ZJ8A 1A5BB 1A69A 5C46F 5EZSA 1R0CA 5GADl 3V6MA 5FHQA 5AK4A 1KOGA 3H2ZA 1F14A 1VKNA 4IJMA 3ZU6A 1XALA 3RT7A 3EXAA 1E3WB 2X5OA 1QH1B 5REQB 2IS4A 1TM3E 2BOVA 3K1TA 2JAPA 1XDBA 1VGQA 3B3GA 4LFCB 3KL2A 2W2PA 4IIGA 3OC6A 3NAMA 1JLKA 3TAXA 2ZRDA 4JBIA 1UKYA 3LT4A 4RTOA 4PSKA 2CVHA 3OUTA 4JDUA 4TL7A 4HMPA 2FG6C 3U4QB 3ETHA 3V8MA 4BFSA 5B6JA 1Z6YA 3FVRA 1XFDA 1F6WA 5A0TA 1Y5MA 4DUGD 3IP1A 1IN7A 1UK6A 1UM9A 4OP2A 3TK1A 3T1YB 4LDAA 4EJMA 4ZVOA 3ZPXA 4BU1A 2I03A 1G8FA 3ADDA 3HBMA 4NS4A 4QDOA 3DBVO 4DLTA 3FI9A 1OLXA 2XD9A 2OFPA 3LU1A 2BFFA 1WOYA 2EXXA 5A7GA 3TSAA 1FFCA 3P9PA 3CLSC 2OBBA 4NWIA 3FIUA 1GUBA 4BNGA 5F76A 2JFBA 1WZIA 4NBWA 1S0UA 3RQSA 1UADA 3L41A 5DT9A 3COJA 4JC4A 4Z2AA 4DQUA 4HDSB 3NBQA 2P65A 5KYYB 3WICA 5EJ8A 1JEDA 1TO2E 3FMPB 1Z4QA 1WXIA 1A77A 3EZLA 3H75A 4C03A 3Q11A 1KF0A 1KBQA 2ISQA 3NEYA 4IX9A 4LWZA 1GA1A 3AOEA 4QTZA 1MJHA 4R9NA 1N6PA 3LUHA 3L5KA 2XDWA 5AQEA 3VAZA 4BNFA 4ZEMA 3C16C 3DA8A 4NYMR 4UMEA 2QW8A 2XCIA 4UATA 3U1BA 1ONNA 3L6CA 2JCYA 4QARA 4AS3A 1Z8FA 2JAWA 2YVAA 3F4KA 3KTAB 2QMZA 3AF4A 3K0EA 4NY1A 5JPDA 2CUZA 3I9V1 1T0UA 1M5TA 1XDZA 4PXYA 4WLOA 1GQOA 2WVHA 1YULA 5FD8A 1SNYA 3S8YA 2BHTA 2GH1A 4J8PA 3AP1A 1I1OA 2IPXA 1O6GA 3AI7A 1RWQA 1J8QA 1HGXA 2IEIA 1TNDA 4QGBA 3WK9A 3QELA 1H1TA 3L84A 4KBFA 4KQFA 2DHEA 4YT4A 1Y82A 1NWCA 4M0MA 2IE0A 3FCYA 4P7JA 2ACWA 5U1PA 1UEIA 1FDWA 5A2QA 1SXQA 2CF6A 1QDEA 1XQVA 3O7MA 3ED1A 3EEYA 2AWOA 4RYLA 4M21A 3WGGA 3SF8A 5CXXA 1JAIA 4JWKA 4UXJA 2Q3DA 4DZRA 4M7PA 1HL7A 2WFAA 2B35A 2DUUA 4QUHA 1EUCA 1XKXA 1LBEA 4DLPA 4WKCA 4PSCA 3NALA 2C5GA 3HSSA 1Y3DE 3DMTC 3MJDA 4LI3X 1JAZA 1VBKA 2IYTA 2Y0CA