3RWTA

Crystal structure of circular permutated red fluorescent protein mkate(cp 154-153)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
235
structure length
234
Chain Sequence
EFLEGRSDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKGGTGGSMSELITENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluorescent protein FP480,Fluorescent protein FP480
publication title Circular permutation of red fluorescent proteins.
pubmed doi rcsb
source organism Entacmaea quadricolor
molecule tags Fluorescent protein
total genus 61
structure length 234
sequence length 235
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3rwtA00
2EMNA 4EDOA 3DQ1A 4P76A 4L13A 3SG7A 3LF4B 3GJ1A 2A54B 5J2OA 3DQUA 2IB6A 2YE1A 4LQUA 2VVHA 4W72A 1YHGA 4JEOA 1JBZA 4TZGA 4EN1A 2GW4B 3VICA 4OGSA 1EMKA 1ZUXA 3A8SA 5EJUA 4KW4A 4HQ8A 4DKNA 2C9JA 3SVUA 3WCKA 3CD9A 1Q4EA 4NWSA 2G6EA 4XOWA 2V4EA 3AI4A 4W69A 4W7XA 1HUYA 4W6UA 1MOVA 3DQJA 4XL5A 2BTJA 3VHTB 2FL1A 4W6AA 2EMOA 2RH7A 3P8UA 4P1QA 2G5ZB 5LTQA 1S6ZA 4DXOA 4H48A 2O24A 4W7RA 1JC1A 3E5VA 5FVIA 4ZF5A 4W6SA 3CFHA 5DY6A 4KGFA 2YDZA 1RMMA 4PPLA 2WSOA 5DPIA 4ORNA 3SG6A 4AS8A 3GEXA 1EMLA 2VZXA 4HQ9A 1KYRA 4H3NA 5DTLA 3EVUA 4DXPA 3WLDA 5DQMA 2Y0GA 3LS3A 2A50B 4IK3A 3S05A 5F9GA 1EMAA 3CBEA 4KW8A 4XOVA 2GW3A 2GX0A 2HQKA 4PFEA 2PXSA 3PJ7A 4GOBA 2OTEA 3BXAA 3UFZA 5BTTB 2ARLA 3NF0A 4KEXA 1EMMA 3DQOA 1Q73A 3DQ8A 3O78A 4Q7TA 1XSSA 1G7KA 3ADFA 2ZO6A 3SG2A 4DXIA 2WIQA 1MOUA 3DPWA 2G2SB 3EK4A 3PIBA 3H1OA 4JRBA 4OJ0A 3SG5A 1W7UA 2DDCA 2HFCA 1F0BA 3DQCA 3GL4A 1F09A 4AR7A 3ZULA 5HGEA 5HBDA 3ST4A 1Q4DA 2DD9A 1XMZA 4L12A 5BQLA 2G6YA 4H47A 3U0LA 4W6DA 1JC0A 1UISA 4W74A 4LW5A 3DQKA 4XGYA 1RMPA 4W7DA 1W7TA 2AWKA 5H87A 1JBYA 3OSQA 5T3IA 2DUEA 4DXMA 4W6TA 4W6MA 1XQMA 4LJCA 1W7SA 5EHUA 4IK5A 2WHUA 5LTRA 4W76A 4W6LA 4ZBLA 2DUIA 4I2YA 3NEZA 3PJBA 4BDUA 5HW9A 4RYWA 2Z6YA 3W1DA 3U0MA 4ZF4A 2ZMWA 5EXUA 2GX2A 4KF5C 2A48A 4LJDC 3SSVA 3NEDA 1Z1PA 2EMDA 4W6IA 4EDSA 2Q6PA 4W6KA 2ICRA 1HCJA 3BX9A 4J88A 2DD7A 4W7EA 4HVFA 3CB9A 4B30A 3BXCA 2YE0A 1YJ2A 4LQTA 4JFGA 2A52B 3CFFA 2Z6XA 5DPHA 5HZTA 1CV7A 1QYFA 3LF3A 5H88A 4Z4KA 3O77A 3OSRA 3DQ2A 3KCSA 2YFPA 3LA1A 1B9CA 2A53B 1EMGA 1C4FA 3ZUFA 1XA9A 2H5PA 4EULA 1GFLA 5EB6A 2WISA 1Q4AA 1KYSA 3GJ2A 3KCTA 2Q57A 4KGEA 3EK7A 4R6DA 4KPIA 3SSTA 4N3DA 2QZ0A 3CD1A 4Q7UA 2QLGA 4W6CA 2VAEA 3MGFA 3SVBA 3DQ3A 2G3DB 3EVRA 4W6RA 1Q4CA 1KP5A 3DQFA 1Z1QA 4B30B 2VVIA 4XVPA 5DQBA 4W7AA 5DTZA 2H5QA 3LVCA 2AWJA 1KYPA 2HPWA 3DQIA 2O2BA 4DXNA 4LJBA 2IB5A 3EKJA 3U8CA 3M24A 5EXCI 1OXFA 2G16B 3W1CA 1EMCA 1MYWA 2AHAA 1GL4A 3DQ5A 1QYQA 4UTSA 4IZNA 4R6BA 2V4EB 4KA9A 4W6HA 2DUGA 3RWAA 1ZGQA 4PPJA 4W6JA 3ED8A 3SRYA 3IR8A 4OHSA 3EKHA 4GF6B 3SSPA 4J89A 2HRSA 4Q9XA 2AWLA 3CFAA 4ZF3A 3DPXA 2ZMUA 3PJ5A 2HGDA 2QRFA 3DQ7A 3SSLA 2FZUA 3LVDA 4HQCA 4IK8A 2ZO7A 1H4UA 3AKOA 3GB3A 4W6GA 1ZGPA 3OGOA 5FVGA 3SG3A 3SSYA 4JGEA 3M22A 2HCGA 2DUFA 4EMQA 2POXA 4DKMA 3AI5A 5DPGA 1BFPA 3E5WA 4U2VA 2G3OA 4RYSA 5DTYA 4JF9A 3U0KA 5HZOA 4J8AA 3VHTA 2DUHA 4ZINA 4W75A 2VADA 4W6OA 1H6RA 4H3MA 2HQZA 3WLCA 3DQEA 1RMOA 2A47A 2H8QA 3VK1A 3RWTA 4GESB 3I19A 5BT0A 3NT9A 4Q7RA 4W6BA 3SVNA 3K1KA 3LSAA 3IP2A 3UG0A 2OGRA 2C9IA 2QLEA 2AWMA 3U8PA 1QY3A 3SSKA 3P28A 2DDDA 2OTBA 2QLIA 4OQWA 3DQDA 3TMRA 1QYOA 2H6VA 1YHIA 4ZB1A 5EXBA 2OKYA 3NT3A 2Z6ZA 3EK8A 3EVPA 5BTTA 2FWQA 3DQLA 2OKWA 3ZUJA 4W6NA 5LK4A 5EBJA 2OJKA 4IK4A 3SSHA 2H5OA 4W7FA 2B3PA 1GGXA 2A56B 4B5YA 4Q9WA 4JC2A 3E5TA 1YHHA 2JADA 2PXWA 5DPJA 2B3QA 1ZGOA 3DQNA 2P4MA 1OXEA 4ANJA 2G6XA 4W6PA 1Q4BA 4W73A 4KW9A 5AQBB 5DRGA 4L1IA 5DU0A 3V3DA 3DQHA 2QU1A 2H9WA 4Z4MA 5HZSA 4PPKA 2WHTA 3SVRA 4IK1A 4H3LA 3SV5A 4HE4A 4KF5A 4LJDA 2O29A 3BXBA 5DRFA 3DQMA 3ZTFA 1YZWA 2IE2A 2HGYA 2WURA 1RM9A 1XAEA 5H89A 2QLHA 3SG4A 2Z1OA 3SVDA 2V4EC 3SVOA 2H5RA 3DQ4A 3DQAA 4ZFSA 3ST2A 2AH8A 3U8AA 3U0NA 2QLGB 3SVEA 4KF4A 2QT2A 3EVVA 4IK9A 1RRXA 3G9AA 4W6FA 4W7CA 4KAGA 3DQ6A 1EMBA 2WSNA 5LTPA 3SVCA 3ST0A 3DQ9A 1QXTA 1EMEA 3SS0A 3SVSA 3DPZA 1EMFA 4TZAA 4OY4A 5EB7A 5DTXA 5FHVA 5KTGA 1YFPA 2WHSA 5HZUA 3ST3A 2HJOA 1OXDA 3H1RA 3LVAA 4ZIOA 2IOVA 4RTCA 3CGLA 2A46A 3TMTA 1YJFA 2VVJA 4DXQA 5FVFA 4W77A
chains in the Genus database with same CATH superfamily
2EMNA 4EDOA 3DQ1A 4P76A 4L13A 3SG7A 3LF4B 3GJ1A 2A54B 5J2OA 3DQUA 2IB6A 2YE1A 4LQUA 2VVHA 4W72A 1YHGA 4JEOA 1JBZA 4TZGA 4EN1A 2GW4B 3VICA 4OGSA 1EMKA 1ZUXA 3A8SA 5EJUA 4KW4A 4HQ8A 4DKNA 2C9JA 3SVUA 3WCKA 3CD9A 1Q4EA 4NWSA 2G6EA 4XOWA 2V4EA 3AI4A 4W69A 4W7XA 1HUYA 4W6UA 1MOVA 3DQJA 4XL5A 2BTJA 3VHTB 2FL1A 4W6AA 2EMOA 2RH7A 3P8UA 4P1QA 2G5ZB 5LTQA 1S6ZA 4DXOA 4H48A 2O24A 4W7RA 1JC1A 3E5VA 5FVIA 4ZF5A 4W6SA 3CFHA 5DY6A 4KGFA 2YDZA 1RMMA 4PPLA 2WSOA 5DPIA 4ORNA 3SG6A 4AS8A 3GEXA 1EMLA 2VZXA 4HQ9A 1KYRA 4H3NA 5DTLA 3EVUA 4DXPA 3WLDA 5DQMA 2Y0GA 3LS3A 2A50B 4IK3A 3S05A 5F9GA 1EMAA 3CBEA 4KW8A 4XOVA 2GW3A 2GX0A 2HQKA 4PFEA 2PXSA 3PJ7A 4GOBA 2OTEA 3BXAA 3UFZA 5BTTB 2ARLA 3NF0A 4KEXA 1EMMA 3DQOA 1Q73A 3DQ8A 3O78A 4Q7TA 1XSSA 1G7KA 3ADFA 2ZO6A 3SG2A 4DXIA 2WIQA 1MOUA 3DPWA 2G2SB 3EK4A 3PIBA 3H1OA 4JRBA 4OJ0A 3SG5A 1W7UA 2DDCA 2HFCA 1F0BA 3DQCA 3GL4A 1F09A 4AR7A 3ZULA 5HGEA 5HBDA 3ST4A 1Q4DA 2DD9A 1XMZA 4L12A 5BQLA 2G6YA 4H47A 3U0LA 4W6DA 1JC0A 1UISA 4W74A 4LW5A 3DQKA 4XGYA 1RMPA 4W7DA 1W7TA 2AWKA 5H87A 1JBYA 3OSQA 5T3IA 2DUEA 4DXMA 4W6TA 4W6MA 1XQMA 4LJCA 1W7SA 5EHUA 4IK5A 2WHUA 5LTRA 4W76A 4W6LA 4ZBLA 2DUIA 4I2YA 3NEZA 3PJBA 4BDUA 5HW9A 4RYWA 2Z6YA 3W1DA 3U0MA 4ZF4A 2ZMWA 5EXUA 2GX2A 4KF5C 2A48A 4LJDC 3SSVA 3NEDA 1Z1PA 2EMDA 4W6IA 4EDSA 2Q6PA 4W6KA 2ICRA 1HCJA 3BX9A 4J88A 2DD7A 4W7EA 4HVFA 3CB9A 4B30A 3BXCA 2YE0A 1YJ2A 4LQTA 4JFGA 2A52B 3CFFA 2Z6XA 5DPHA 5HZTA 1CV7A 1QYFA 3LF3A 5H88A 4Z4KA 3O77A 3OSRA 3DQ2A 3KCSA 2YFPA 3LA1A 1B9CA 2A53B 1EMGA 1C4FA 3ZUFA 1XA9A 2H5PA 4EULA 1GFLA 5EB6A 2WISA 1Q4AA 1KYSA 3GJ2A 3KCTA 2Q57A 4KGEA 3EK7A 4R6DA 4KPIA 3SSTA 4N3DA 2QZ0A 3CD1A 4Q7UA 2QLGA 4W6CA 2VAEA 3MGFA 3SVBA 3DQ3A 2G3DB 3EVRA 4W6RA 1Q4CA 1KP5A 3DQFA 1Z1QA 4B30B 2VVIA 4XVPA 5DQBA 4W7AA 5DTZA 2H5QA 3LVCA 2AWJA 1KYPA 2HPWA 3DQIA 2O2BA 4DXNA 4LJBA 2IB5A 3EKJA 3U8CA 3M24A 5EXCI 1OXFA 2G16B 3W1CA 1EMCA 1MYWA 2AHAA 1GL4A 3DQ5A 1QYQA 4UTSA 4IZNA 4R6BA 2V4EB 4KA9A 4W6HA 2DUGA 3RWAA 1ZGQA 4PPJA 4W6JA 3ED8A 3SRYA 3IR8A 4OHSA 3EKHA 4GF6B 3SSPA 4J89A 2HRSA 4Q9XA 2AWLA 3CFAA 4ZF3A 3DPXA 2ZMUA 3PJ5A 2HGDA 2QRFA 3DQ7A 3SSLA 2FZUA 3LVDA 4HQCA 4IK8A 2ZO7A 1H4UA 3AKOA 3GB3A 4W6GA 1ZGPA 3OGOA 5FVGA 3SG3A 3SSYA 4JGEA 3M22A 2HCGA 2DUFA 4EMQA 2POXA 4DKMA 3AI5A 5DPGA 1BFPA 3E5WA 4U2VA 2G3OA 4RYSA 5DTYA 4JF9A 3U0KA 5HZOA 4J8AA 3VHTA 2DUHA 4ZINA 4W75A 2VADA 4W6OA 1H6RA 4H3MA 2HQZA 3WLCA 3DQEA 1RMOA 2A47A 2H8QA 3VK1A 3RWTA 4GESB 3I19A 5BT0A 3NT9A 4Q7RA 4W6BA 3SVNA 3K1KA 3LSAA 3IP2A 3UG0A 2OGRA 2C9IA 2QLEA 2AWMA 3U8PA 1QY3A 3SSKA 3P28A 2DDDA 2OTBA 2QLIA 4OQWA 3DQDA 3TMRA 1QYOA 2H6VA 1YHIA 4ZB1A 5EXBA 2OKYA 3NT3A 2Z6ZA 3EK8A 3EVPA 5BTTA 2FWQA 3DQLA 2OKWA 3ZUJA 4W6NA 5LK4A 5EBJA 2OJKA 4IK4A 3SSHA 2H5OA 4W7FA 2B3PA 1GGXA 2A56B 4B5YA 4Q9WA 4JC2A 3E5TA 1YHHA 2JADA 2PXWA 5DPJA 2B3QA 1ZGOA 3DQNA 2P4MA 1OXEA 4ANJA 2G6XA 4W6PA 1Q4BA 4W73A 4KW9A 5AQBB 5DRGA 4L1IA 5DU0A 3V3DA 3DQHA 2QU1A 2H9WA 4Z4MA 5HZSA 4PPKA 2WHTA 3SVRA 4IK1A 4H3LA 3SV5A 4HE4A 4KF5A 4LJDA 2O29A 3BXBA 5DRFA 3DQMA 3ZTFA 1YZWA 2IE2A 2HGYA 2WURA 1RM9A 1XAEA 5H89A 2QLHA 3SG4A 2Z1OA 3SVDA 2V4EC 3SVOA 2H5RA 3DQ4A 3DQAA 4ZFSA 3ST2A 2AH8A 3U8AA 3U0NA 2QLGB 3SVEA 4KF4A 2QT2A 3EVVA 4IK9A 1RRXA 3G9AA 4W6FA 4W7CA 4KAGA 3DQ6A 1EMBA 2WSNA 5LTPA 3SVCA 3ST0A 3DQ9A 1QXTA 1EMEA 3SS0A 3SVSA 3DPZA 1EMFA 4TZAA 4OY4A 5EB7A 5DTXA 5FHVA 5KTGA 1YFPA 2WHSA 5HZUA 3ST3A 2HJOA 1OXDA 3H1RA 3LVAA 4ZIOA 2IOVA 4RTCA 3CGLA 2A46A 3TMTA 1YJFA 2VVJA 4DXQA 5FVFA 4W77A
chains in the Genus database with same CATH topology
2EMNA 4EDOA 3DQ1A 4P76A 4L13A 3SG7A 3LF4B 3GJ1A 2A54B 5J2OA 3DQUA 2IB6A 2YE1A 4LQUA 2VVHA 4W72A 1YHGA 4JEOA 1JBZA 4TZGA 4EN1A 2GW4B 3VICA 4OGSA 1EMKA 1ZUXA 3A8SA 5EJUA 4KW4A 4HQ8A 4DKNA 2C9JA 3SVUA 3WCKA 3CD9A 1Q4EA 4NWSA 2G6EA 4XOWA 2V4EA 3AI4A 4W69A 4W7XA 1HUYA 4W6UA 1MOVA 3DQJA 4XL5A 2BTJA 3VHTB 2FL1A 4W6AA 2EMOA 2RH7A 3P8UA 4P1QA 2G5ZB 5LTQA 1S6ZA 4DXOA 4H48A 2O24A 4W7RA 1JC1A 3E5VA 5FVIA 4ZF5A 4W6SA 3CFHA 5DY6A 4KGFA 2YDZA 1RMMA 4PPLA 2WSOA 5DPIA 4ORNA 3SG6A 4AS8A 3GEXA 1EMLA 2VZXA 4HQ9A 1KYRA 4H3NA 5DTLA 3EVUA 4DXPA 3WLDA 5DQMA 2Y0GA 3LS3A 2A50B 4IK3A 3S05A 5F9GA 1EMAA 3CBEA 4KW8A 4XOVA 2GW3A 2GX0A 2HQKA 4PFEA 2PXSA 3PJ7A 4GOBA 2OTEA 3BXAA 3UFZA 5BTTB 2ARLA 3NF0A 4KEXA 1EMMA 3DQOA 1Q73A 3DQ8A 3O78A 4Q7TA 1XSSA 1G7KA 3ADFA 2ZO6A 3SG2A 4DXIA 2WIQA 1MOUA 3DPWA 2G2SB 3EK4A 3PIBA 3H1OA 4JRBA 4OJ0A 3SG5A 1W7UA 2DDCA 2HFCA 1F0BA 3DQCA 3GL4A 1F09A 4AR7A 3ZULA 5HGEA 5HBDA 3ST4A 1Q4DA 2DD9A 1XMZA 4L12A 5BQLA 2G6YA 4H47A 3U0LA 4W6DA 1JC0A 1UISA 4W74A 4LW5A 3DQKA 4XGYA 1RMPA 4W7DA 1W7TA 2AWKA 5H87A 1JBYA 3OSQA 5T3IA 2DUEA 4DXMA 4W6TA 4W6MA 1XQMA 4LJCA 1W7SA 5EHUA 4IK5A 2WHUA 5LTRA 4W76A 4W6LA 4ZBLA 2DUIA 4I2YA 3NEZA 3PJBA 4BDUA 5HW9A 4RYWA 2Z6YA 3W1DA 3U0MA 4ZF4A 2ZMWA 5EXUA 2GX2A 4KF5C 2A48A 4LJDC 3SSVA 3NEDA 1Z1PA 2EMDA 4W6IA 4EDSA 2Q6PA 4W6KA 2ICRA 1HCJA 3BX9A 4J88A 2DD7A 4W7EA 4HVFA 3CB9A 4B30A 3BXCA 2YE0A 1YJ2A 4LQTA 4JFGA 2A52B 3CFFA 2Z6XA 5DPHA 5HZTA 1CV7A 1QYFA 3LF3A 5H88A 4Z4KA 3O77A 3OSRA 3DQ2A 3KCSA 2YFPA 3LA1A 1B9CA 2A53B 1EMGA 1C4FA 3ZUFA 1XA9A 2H5PA 4EULA 1GFLA 5EB6A 2WISA 1Q4AA 1KYSA 3GJ2A 3KCTA 2Q57A 4KGEA 3EK7A 4R6DA 4KPIA 3SSTA 4N3DA 2QZ0A 3CD1A 4Q7UA 2QLGA 4W6CA 2VAEA 3MGFA 3SVBA 3DQ3A 2G3DB 3EVRA 4W6RA 1Q4CA 1KP5A 3DQFA 1Z1QA 4B30B 2VVIA 4XVPA 5DQBA 4W7AA 5DTZA 2H5QA 3LVCA 2AWJA 1KYPA 2HPWA 3DQIA 2O2BA 4DXNA 4LJBA 2IB5A 3EKJA 3U8CA 3M24A 5EXCI 1OXFA 2G16B 3W1CA 1EMCA 1MYWA 2AHAA 1GL4A 3DQ5A 1QYQA 4UTSA 4IZNA 4R6BA 2V4EB 4KA9A 4W6HA 2DUGA 3RWAA 1ZGQA 4PPJA 4W6JA 3ED8A 3SRYA 3IR8A 4OHSA 3EKHA 4GF6B 3SSPA 4J89A 2HRSA 4Q9XA 2AWLA 3CFAA 4ZF3A 3DPXA 2ZMUA 3PJ5A 2HGDA 2QRFA 3DQ7A 3SSLA 2FZUA 3LVDA 4HQCA 4IK8A 2ZO7A 1H4UA 3AKOA 3GB3A 4W6GA 1ZGPA 3OGOA 5FVGA 3SG3A 3SSYA 4JGEA 3M22A 2HCGA 2DUFA 4EMQA 2POXA 4DKMA 3AI5A 5DPGA 1BFPA 3E5WA 4U2VA 2G3OA 4RYSA 5DTYA 4JF9A 3U0KA 5HZOA 4J8AA 3VHTA 2DUHA 4ZINA 4W75A 2VADA 4W6OA 1H6RA 4H3MA 2HQZA 3WLCA 3DQEA 1RMOA 2A47A 2H8QA 3VK1A 3RWTA 4GESB 3I19A 5BT0A 3NT9A 4Q7RA 4W6BA 3SVNA 3K1KA 3LSAA 3IP2A 3UG0A 2OGRA 2C9IA 2QLEA 2AWMA 3U8PA 1QY3A 3SSKA 3P28A 2DDDA 2OTBA 2QLIA 4OQWA 3DQDA 3TMRA 1QYOA 2H6VA 1YHIA 4ZB1A 5EXBA 2OKYA 3NT3A 2Z6ZA 3EK8A 3EVPA 5BTTA 2FWQA 3DQLA 2OKWA 3ZUJA 4W6NA 5LK4A 5EBJA 2OJKA 4IK4A 3SSHA 2H5OA 4W7FA 2B3PA 1GGXA 2A56B 4B5YA 4Q9WA 4JC2A 3E5TA 1YHHA 2JADA 2PXWA 5DPJA 2B3QA 1ZGOA 3DQNA 2P4MA 1OXEA 4ANJA 2G6XA 4W6PA 1Q4BA 4W73A 4KW9A 5AQBB 5DRGA 4L1IA 5DU0A 3V3DA 3DQHA 2QU1A 2H9WA 4Z4MA 5HZSA 4PPKA 2WHTA 3SVRA 4IK1A 4H3LA 3SV5A 4HE4A 4KF5A 4LJDA 2O29A 3BXBA 5DRFA 3DQMA 3ZTFA 1YZWA 2IE2A 2HGYA 2WURA 1RM9A 1XAEA 5H89A 2QLHA 3SG4A 2Z1OA 3SVDA 2V4EC 3SVOA 2H5RA 3DQ4A 3DQAA 4ZFSA 3ST2A 2AH8A 3U8AA 3U0NA 2QLGB 3SVEA 4KF4A 2QT2A 3EVVA 4IK9A 1RRXA 3G9AA 4W6FA 4W7CA 4KAGA 3DQ6A 1EMBA 2WSNA 5LTPA 3SVCA 3ST0A 3DQ9A 1QXTA 1EMEA 3SS0A 3SVSA 3DPZA 1EMFA 4TZAA 4OY4A 5EB7A 5DTXA 5FHVA 5KTGA 1YFPA 2WHSA 5HZUA 3ST3A 2HJOA 1OXDA 3H1RA 3LVAA 4ZIOA 2IOVA 4RTCA 3CGLA 2A46A 3TMTA 1YJFA 2VVJA 4DXQA 5FVFA 4W77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMN A;  4EDO A;  3DQ1 A;  4P76 A;  4L13 A;  3SG7 A;  3LF4 B;  3GJ1 A;  2A54 B;  5J2O A;  3DQU A;  2IB6 A;  2YE1 A;  4LQU A;  2VVH A;  4W72 A;  1YHG A;  4JEO A;  1JBZ A;  4TZG A;  4EN1 A;  2GW4 B;  3VIC A;  4OGS A;  1EMK A;  1ZUX A;  3A8S A;  5EJU A;  4KW4 A;  4HQ8 A;  4DKN A;  2C9J A;  3SVU A;  3WCK A;  3CD9 A;  1Q4E A;  4NWS A;  2G6E A;  4XOW A;  2V4E A;  3AI4 A;  4W69 A;  4W7X A;  1HUY A;  4W6U A;  1MOV A;  3DQJ A;  4XL5 A;  2BTJ A;  3VHT B;  2FL1 A;  4W6A A;  2EMO A;  2RH7 A;  3P8U A;  4P1Q A;  2G5Z B;  5LTQ A;  1S6Z A;  4DXO A;  4H48 A;  2O24 A;  4W7R A;  1JC1 A;  3E5V A;  5FVI A;  4ZF5 A;  4W6S A;  3CFH A;  5DY6 A;  4KGF A;  2YDZ A;  1RMM A;  4PPL A;  2WSO A;  5DPI A;  4ORN A;  3SG6 A;  4AS8 A;  3GEX A;  1EML A;  2VZX A;  4HQ9 A;  1KYR A;  4H3N A;  5DTL A;  3EVU A;  4DXP A;  3WLD A;  5DQM A;  2Y0G A;  3LS3 A;  2A50 B;  4IK3 A;  3S05 A;  5F9G A;  1EMA A;  3CBE A;  4KW8 A;  4XOV A;  2GW3 A;  2GX0 A;  2HQK A;  4PFE A;  2PXS A;  3PJ7 A;  4GOB A;  2OTE A;  3BXA A;  3UFZ A;  5BTT B;  2ARL A;  3NF0 A;  4KEX A;  1EMM A;  3DQO A;  1Q73 A;  3DQ8 A;  3O78 A;  4Q7T A;  1XSS A;  1G7K A;  3ADF A;  2ZO6 A;  3SG2 A;  4DXI A;  2WIQ A;  1MOU A;  3DPW A;  2G2S B;  3EK4 A;  3PIB A;  3H1O A;  4JRB A;  4OJ0 A;  3SG5 A;  1W7U A;  2DDC A;  2HFC A;  1F0B A;  3DQC A;  3GL4 A;  1F09 A;  4AR7 A;  3ZUL A;  5HGE A;  5HBD A;  3ST4 A;  1Q4D A;  2DD9 A;  1XMZ A;  4L12 A;  5BQL A;  2G6Y A;  4H47 A;  3U0L A;  4W6D A;  1JC0 A;  1UIS A;  4W74 A;  4LW5 A;  3DQK A;  4XGY A;  1RMP A;  4W7D A;  1W7T A;  2AWK A;  5H87 A;  1JBY A;  3OSQ A;  5T3I A;  2DUE A;  4DXM A;  4W6T A;  4W6M A;  1XQM A;  4LJC A;  1W7S A;  5EHU A;  4IK5 A;  2WHU A;  5LTR A;  4W76 A;  4W6L A;  4ZBL A;  2DUI A;  4I2Y A;  3NEZ A;  3PJB A;  4BDU A;  5HW9 A;  4RYW A;  2Z6Y A;  3W1D A;  3U0M A;  4ZF4 A;  2ZMW A;  5EXU A;  2GX2 A;  4KF5 C;  2A48 A;  4LJD C;  3SSV A;  3NED A;  1Z1P A;  2EMD A;  4W6I A;  4EDS A;  2Q6P A;  4W6K A;  2ICR A;  1HCJ A;  3BX9 A;  4J88 A;  2DD7 A;  4W7E A;  4HVF A;  3CB9 A;  4B30 A;  3BXC A;  2YE0 A;  1YJ2 A;  4LQT A;  4JFG A;  2A52 B;  3CFF A;  2Z6X A;  5DPH A;  5HZT A;  1CV7 A;  1QYF A;  3LF3 A;  5H88 A;  4Z4K A;  3O77 A;  3OSR A;  3DQ2 A;  3KCS A;  2YFP A;  3LA1 A;  1B9C A;  2A53 B;  1EMG A;  1C4F A;  3ZUF A;  1XA9 A;  2H5P A;  4EUL A;  1GFL A;  5EB6 A;  2WIS A;  1Q4A A;  1KYS A;  3GJ2 A;  3KCT A;  2Q57 A;  4KGE A;  3EK7 A;  4R6D A;  4KPI A;  3SST A;  4N3D A;  2QZ0 A;  3CD1 A;  4Q7U A;  2QLG A;  4W6C A;  2VAE A;  3MGF A;  3SVB A;  3DQ3 A;  2G3D B;  3EVR A;  4W6R A;  1Q4C A;  1KP5 A;  3DQF A;  1Z1Q A;  4B30 B;  2VVI A;  4XVP A;  5DQB A;  4W7A A;  5DTZ A;  2H5Q A;  3LVC A;  2AWJ A;  1KYP A;  2HPW A;  3DQI A;  2O2B A;  4DXN A;  4LJB A;  2IB5 A;  3EKJ A;  3U8C A;  3M24 A;  5EXC I;  1OXF A;  2G16 B;  3W1C A;  1EMC A;  1MYW A;  2AHA A;  1GL4 A;  3DQ5 A;  1QYQ A;  4UTS A;  4IZN A;  4R6B A;  2V4E B;  4KA9 A;  4W6H A;  2DUG A;  3RWA A;  1ZGQ A;  4PPJ A;  4W6J A;  3ED8 A;  3SRY A;  3IR8 A;  4OHS A;  3EKH A;  4GF6 B;  3SSP A;  4J89 A;  2HRS A;  4Q9X A;  2AWL A;  3CFA A;  4ZF3 A;  3DPX A;  2ZMU A;  3PJ5 A;  2HGD A;  2QRF A;  3DQ7 A;  3SSL A;  2FZU A;  3LVD A;  4HQC A;  4IK8 A;  2ZO7 A;  1H4U A;  3AKO A;  3GB3 A;  4W6G A;  1ZGP A;  3OGO A;  5FVG A;  3SG3 A;  3SSY A;  4JGE A;  3M22 A;  2HCG A;  2DUF A;  4EMQ A;  2POX A;  4DKM A;  3AI5 A;  5DPG A;  1BFP A;  3E5W A;  4U2V A;  2G3O A;  4RYS A;  5DTY A;  4JF9 A;  3U0K A;  5HZO A;  4J8A A;  3VHT A;  2DUH A;  4ZIN A;  4W75 A;  2VAD A;  4W6O A;  1H6R A;  4H3M A;  2HQZ A;  3WLC A;  3DQE A;  1RMO A;  2A47 A;  2H8Q A;  3VK1 A;  3RWT A;  4GES B;  3I19 A;  5BT0 A;  3NT9 A;  4Q7R A;  4W6B A;  3SVN A;  3K1K A;  3LSA A;  3IP2 A;  3UG0 A;  2OGR A;  2C9I A;  2QLE A;  2AWM A;  3U8P A;  1QY3 A;  3SSK A;  3P28 A;  2DDD A;  2OTB A;  2QLI A;  4OQW A;  3DQD A;  3TMR A;  1QYO A;  2H6V A;  1YHI A;  4ZB1 A;  5EXB A;  2OKY A;  3NT3 A;  2Z6Z A;  3EK8 A;  3EVP A;  5BTT A;  2FWQ A;  3DQL A;  2OKW A;  3ZUJ A;  4W6N A;  5LK4 A;  5EBJ A;  2OJK A;  4IK4 A;  3SSH A;  2H5O A;  4W7F A;  2B3P A;  1GGX A;  2A56 B;  4B5Y A;  4Q9W A;  4JC2 A;  3E5T A;  1YHH A;  2JAD A;  2PXW A;  5DPJ A;  2B3Q A;  1ZGO A;  3DQN A;  2P4M A;  1OXE A;  4ANJ A;  2G6X A;  4W6P A;  1Q4B A;  4W73 A;  4KW9 A;  5AQB B;  5DRG A;  4L1I A;  5DU0 A;  3V3D A;  3DQH A;  2QU1 A;  2H9W A;  4Z4M A;  5HZS A;  4PPK A;  2WHT A;  3SVR A;  4IK1 A;  4H3L A;  3SV5 A;  4HE4 A;  4KF5 A;  4LJD A;  2O29 A;  3BXB A;  5DRF A;  3DQM A;  3ZTF A;  1YZW A;  2IE2 A;  2HGY A;  2WUR A;  1RM9 A;  1XAE A;  5H89 A;  2QLH A;  3SG4 A;  2Z1O A;  3SVD A;  2V4E C;  3SVO A;  2H5R A;  3DQ4 A;  3DQA A;  4ZFS A;  3ST2 A;  2AH8 A;  3U8A A;  3U0N A;  2QLG B;  3SVE A;  4KF4 A;  2QT2 A;  3EVV A;  4IK9 A;  1RRX A;  3G9A A;  4W6F A;  4W7C A;  4KAG A;  3DQ6 A;  1EMB A;  2WSN A;  5LTP A;  3SVC A;  3ST0 A;  3DQ9 A;  1QXT A;  1EME A;  3SS0 A;  3SVS A;  3DPZ A;  1EMF A;  4TZA A;  4OY4 A;  5EB7 A;  5DTX A;  5FHV A;  5KTG A;  1YFP A;  2WHS A;  5HZU A;  3ST3 A;  2HJO A;  1OXD A;  3H1R A;  3LVA A;  4ZIO A;  2IOV A;  4RTC A;  3CGL A;  2A46 A;  3TMT A;  1YJF A;  2VVJ A;  4DXQ A;  5FVF A;  4W77 A; 
#chains in the Genus database with same CATH topology
 2EMN A;  4EDO A;  3DQ1 A;  4P76 A;  4L13 A;  3SG7 A;  3LF4 B;  3GJ1 A;  2A54 B;  5J2O A;  3DQU A;  2IB6 A;  2YE1 A;  4LQU A;  2VVH A;  4W72 A;  1YHG A;  4JEO A;  1JBZ A;  4TZG A;  4EN1 A;  2GW4 B;  3VIC A;  4OGS A;  1EMK A;  1ZUX A;  3A8S A;  5EJU A;  4KW4 A;  4HQ8 A;  4DKN A;  2C9J A;  3SVU A;  3WCK A;  3CD9 A;  1Q4E A;  4NWS A;  2G6E A;  4XOW A;  2V4E A;  3AI4 A;  4W69 A;  4W7X A;  1HUY A;  4W6U A;  1MOV A;  3DQJ A;  4XL5 A;  2BTJ A;  3VHT B;  2FL1 A;  4W6A A;  2EMO A;  2RH7 A;  3P8U A;  4P1Q A;  2G5Z B;  5LTQ A;  1S6Z A;  4DXO A;  4H48 A;  2O24 A;  4W7R A;  1JC1 A;  3E5V A;  5FVI A;  4ZF5 A;  4W6S A;  3CFH A;  5DY6 A;  4KGF A;  2YDZ A;  1RMM A;  4PPL A;  2WSO A;  5DPI A;  4ORN A;  3SG6 A;  4AS8 A;  3GEX A;  1EML A;  2VZX A;  4HQ9 A;  1KYR A;  4H3N A;  5DTL A;  3EVU A;  4DXP A;  3WLD A;  5DQM A;  2Y0G A;  3LS3 A;  2A50 B;  4IK3 A;  3S05 A;  5F9G A;  1EMA A;  3CBE A;  4KW8 A;  4XOV A;  2GW3 A;  2GX0 A;  2HQK A;  4PFE A;  2PXS A;  3PJ7 A;  4GOB A;  2OTE A;  3BXA A;  3UFZ A;  5BTT B;  2ARL A;  3NF0 A;  4KEX A;  1EMM A;  3DQO A;  1Q73 A;  3DQ8 A;  3O78 A;  4Q7T A;  1XSS A;  1G7K A;  3ADF A;  2ZO6 A;  3SG2 A;  4DXI A;  2WIQ A;  1MOU A;  3DPW A;  2G2S B;  3EK4 A;  3PIB A;  3H1O A;  4JRB A;  4OJ0 A;  3SG5 A;  1W7U A;  2DDC A;  2HFC A;  1F0B A;  3DQC A;  3GL4 A;  1F09 A;  4AR7 A;  3ZUL A;  5HGE A;  5HBD A;  3ST4 A;  1Q4D A;  2DD9 A;  1XMZ A;  4L12 A;  5BQL A;  2G6Y A;  4H47 A;  3U0L A;  4W6D A;  1JC0 A;  1UIS A;  4W74 A;  4LW5 A;  3DQK A;  4XGY A;  1RMP A;  4W7D A;  1W7T A;  2AWK A;  5H87 A;  1JBY A;  3OSQ A;  5T3I A;  2DUE A;  4DXM A;  4W6T A;  4W6M A;  1XQM A;  4LJC A;  1W7S A;  5EHU A;  4IK5 A;  2WHU A;  5LTR A;  4W76 A;  4W6L A;  4ZBL A;  2DUI A;  4I2Y A;  3NEZ A;  3PJB A;  4BDU A;  5HW9 A;  4RYW A;  2Z6Y A;  3W1D A;  3U0M A;  4ZF4 A;  2ZMW A;  5EXU A;  2GX2 A;  4KF5 C;  2A48 A;  4LJD C;  3SSV A;  3NED A;  1Z1P A;  2EMD A;  4W6I A;  4EDS A;  2Q6P A;  4W6K A;  2ICR A;  1HCJ A;  3BX9 A;  4J88 A;  2DD7 A;  4W7E A;  4HVF A;  3CB9 A;  4B30 A;  3BXC A;  2YE0 A;  1YJ2 A;  4LQT A;  4JFG A;  2A52 B;  3CFF A;  2Z6X A;  5DPH A;  5HZT A;  1CV7 A;  1QYF A;  3LF3 A;  5H88 A;  4Z4K A;  3O77 A;  3OSR A;  3DQ2 A;  3KCS A;  2YFP A;  3LA1 A;  1B9C A;  2A53 B;  1EMG A;  1C4F A;  3ZUF A;  1XA9 A;  2H5P A;  4EUL A;  1GFL A;  5EB6 A;  2WIS A;  1Q4A A;  1KYS A;  3GJ2 A;  3KCT A;  2Q57 A;  4KGE A;  3EK7 A;  4R6D A;  4KPI A;  3SST A;  4N3D A;  2QZ0 A;  3CD1 A;  4Q7U A;  2QLG A;  4W6C A;  2VAE A;  3MGF A;  3SVB A;  3DQ3 A;  2G3D B;  3EVR A;  4W6R A;  1Q4C A;  1KP5 A;  3DQF A;  1Z1Q A;  4B30 B;  2VVI A;  4XVP A;  5DQB A;  4W7A A;  5DTZ A;  2H5Q A;  3LVC A;  2AWJ A;  1KYP A;  2HPW A;  3DQI A;  2O2B A;  4DXN A;  4LJB A;  2IB5 A;  3EKJ A;  3U8C A;  3M24 A;  5EXC I;  1OXF A;  2G16 B;  3W1C A;  1EMC A;  1MYW A;  2AHA A;  1GL4 A;  3DQ5 A;  1QYQ A;  4UTS A;  4IZN A;  4R6B A;  2V4E B;  4KA9 A;  4W6H A;  2DUG A;  3RWA A;  1ZGQ A;  4PPJ A;  4W6J A;  3ED8 A;  3SRY A;  3IR8 A;  4OHS A;  3EKH A;  4GF6 B;  3SSP A;  4J89 A;  2HRS A;  4Q9X A;  2AWL A;  3CFA A;  4ZF3 A;  3DPX A;  2ZMU A;  3PJ5 A;  2HGD A;  2QRF A;  3DQ7 A;  3SSL A;  2FZU A;  3LVD A;  4HQC A;  4IK8 A;  2ZO7 A;  1H4U A;  3AKO A;  3GB3 A;  4W6G A;  1ZGP A;  3OGO A;  5FVG A;  3SG3 A;  3SSY A;  4JGE A;  3M22 A;  2HCG A;  2DUF A;  4EMQ A;  2POX A;  4DKM A;  3AI5 A;  5DPG A;  1BFP A;  3E5W A;  4U2V A;  2G3O A;  4RYS A;  5DTY A;  4JF9 A;  3U0K A;  5HZO A;  4J8A A;  3VHT A;  2DUH A;  4ZIN A;  4W75 A;  2VAD A;  4W6O A;  1H6R A;  4H3M A;  2HQZ A;  3WLC A;  3DQE A;  1RMO A;  2A47 A;  2H8Q A;  3VK1 A;  3RWT A;  4GES B;  3I19 A;  5BT0 A;  3NT9 A;  4Q7R A;  4W6B A;  3SVN A;  3K1K A;  3LSA A;  3IP2 A;  3UG0 A;  2OGR A;  2C9I A;  2QLE A;  2AWM A;  3U8P A;  1QY3 A;  3SSK A;  3P28 A;  2DDD A;  2OTB A;  2QLI A;  4OQW A;  3DQD A;  3TMR A;  1QYO A;  2H6V A;  1YHI A;  4ZB1 A;  5EXB A;  2OKY A;  3NT3 A;  2Z6Z A;  3EK8 A;  3EVP A;  5BTT A;  2FWQ A;  3DQL A;  2OKW A;  3ZUJ A;  4W6N A;  5LK4 A;  5EBJ A;  2OJK A;  4IK4 A;  3SSH A;  2H5O A;  4W7F A;  2B3P A;  1GGX A;  2A56 B;  4B5Y A;  4Q9W A;  4JC2 A;  3E5T A;  1YHH A;  2JAD A;  2PXW A;  5DPJ A;  2B3Q A;  1ZGO A;  3DQN A;  2P4M A;  1OXE A;  4ANJ A;  2G6X A;  4W6P A;  1Q4B A;  4W73 A;  4KW9 A;  5AQB B;  5DRG A;  4L1I A;  5DU0 A;  3V3D A;  3DQH A;  2QU1 A;  2H9W A;  4Z4M A;  5HZS A;  4PPK A;  2WHT A;  3SVR A;  4IK1 A;  4H3L A;  3SV5 A;  4HE4 A;  4KF5 A;  4LJD A;  2O29 A;  3BXB A;  5DRF A;  3DQM A;  3ZTF A;  1YZW A;  2IE2 A;  2HGY A;  2WUR A;  1RM9 A;  1XAE A;  5H89 A;  2QLH A;  3SG4 A;  2Z1O A;  3SVD A;  2V4E C;  3SVO A;  2H5R A;  3DQ4 A;  3DQA A;  4ZFS A;  3ST2 A;  2AH8 A;  3U8A A;  3U0N A;  2QLG B;  3SVE A;  4KF4 A;  2QT2 A;  3EVV A;  4IK9 A;  1RRX A;  3G9A A;  4W6F A;  4W7C A;  4KAG A;  3DQ6 A;  1EMB A;  2WSN A;  5LTP A;  3SVC A;  3ST0 A;  3DQ9 A;  1QXT A;  1EME A;  3SS0 A;  3SVS A;  3DPZ A;  1EMF A;  4TZA A;  4OY4 A;  5EB7 A;  5DTX A;  5FHV A;  5KTG A;  1YFP A;  2WHS A;  5HZU A;  3ST3 A;  2HJO A;  1OXD A;  3H1R A;  3LVA A;  4ZIO A;  2IOV A;  4RTC A;  3CGL A;  2A46 A;  3TMT A;  1YJF A;  2VVJ A;  4DXQ A;  5FVF A;  4W77 A; 
#chains in the Genus database with same CATH homology
 2EMN A;  4EDO A;  3DQ1 A;  4P76 A;  4L13 A;  3SG7 A;  3LF4 B;  3GJ1 A;  2A54 B;  5J2O A;  3DQU A;  2IB6 A;  2YE1 A;  4LQU A;  2VVH A;  4W72 A;  1YHG A;  4JEO A;  1JBZ A;  4TZG A;  4EN1 A;  2GW4 B;  3VIC A;  4OGS A;  1EMK A;  1ZUX A;  3A8S A;  5EJU A;  4KW4 A;  4HQ8 A;  4DKN A;  2C9J A;  3SVU A;  3WCK A;  3CD9 A;  1Q4E A;  4NWS A;  2G6E A;  4XOW A;  2V4E A;  3AI4 A;  4W69 A;  4W7X A;  1HUY A;  4W6U A;  1MOV A;  3DQJ A;  4XL5 A;  2BTJ A;  3VHT B;  2FL1 A;  4W6A A;  2EMO A;  2RH7 A;  3P8U A;  4P1Q A;  2G5Z B;  5LTQ A;  1S6Z A;  4DXO A;  4H48 A;  2O24 A;  4W7R A;  1JC1 A;  3E5V A;  5FVI A;  4ZF5 A;  4W6S A;  3CFH A;  5DY6 A;  4KGF A;  2YDZ A;  1RMM A;  4PPL A;  2WSO A;  5DPI A;  4ORN A;  3SG6 A;  4AS8 A;  3GEX A;  1EML A;  2VZX A;  4HQ9 A;  1KYR A;  4H3N A;  5DTL A;  3EVU A;  4DXP A;  3WLD A;  5DQM A;  2Y0G A;  3LS3 A;  2A50 B;  4IK3 A;  3S05 A;  5F9G A;  1EMA A;  3CBE A;  4KW8 A;  4XOV A;  2GW3 A;  2GX0 A;  2HQK A;  4PFE A;  2PXS A;  3PJ7 A;  4GOB A;  2OTE A;  3BXA A;  3UFZ A;  5BTT B;  2ARL A;  3NF0 A;  4KEX A;  1EMM A;  3DQO A;  1Q73 A;  3DQ8 A;  3O78 A;  4Q7T A;  1XSS A;  1G7K A;  3ADF A;  2ZO6 A;  3SG2 A;  4DXI A;  2WIQ A;  1MOU A;  3DPW A;  2G2S B;  3EK4 A;  3PIB A;  3H1O A;  4JRB A;  4OJ0 A;  3SG5 A;  1W7U A;  2DDC A;  2HFC A;  1F0B A;  3DQC A;  3GL4 A;  1F09 A;  4AR7 A;  3ZUL A;  5HGE A;  5HBD A;  3ST4 A;  1Q4D A;  2DD9 A;  1XMZ A;  4L12 A;  5BQL A;  2G6Y A;  4H47 A;  3U0L A;  4W6D A;  1JC0 A;  1UIS A;  4W74 A;  4LW5 A;  3DQK A;  4XGY A;  1RMP A;  4W7D A;  1W7T A;  2AWK A;  5H87 A;  1JBY A;  3OSQ A;  5T3I A;  2DUE A;  4DXM A;  4W6T A;  4W6M A;  1XQM A;  4LJC A;  1W7S A;  5EHU A;  4IK5 A;  2WHU A;  5LTR A;  4W76 A;  4W6L A;  4ZBL A;  2DUI A;  4I2Y A;  3NEZ A;  3PJB A;  4BDU A;  5HW9 A;  4RYW A;  2Z6Y A;  3W1D A;  3U0M A;  4ZF4 A;  2ZMW A;  5EXU A;  2GX2 A;  4KF5 C;  2A48 A;  4LJD C;  3SSV A;  3NED A;  1Z1P A;  2EMD A;  4W6I A;  4EDS A;  2Q6P A;  4W6K A;  2ICR A;  1HCJ A;  3BX9 A;  4J88 A;  2DD7 A;  4W7E A;  4HVF A;  3CB9 A;  4B30 A;  3BXC A;  2YE0 A;  1YJ2 A;  4LQT A;  4JFG A;  2A52 B;  3CFF A;  2Z6X A;  5DPH A;  5HZT A;  1CV7 A;  1QYF A;  3LF3 A;  5H88 A;  4Z4K A;  3O77 A;  3OSR A;  3DQ2 A;  3KCS A;  2YFP A;  3LA1 A;  1B9C A;  2A53 B;  1EMG A;  1C4F A;  3ZUF A;  1XA9 A;  2H5P A;  4EUL A;  1GFL A;  5EB6 A;  2WIS A;  1Q4A A;  1KYS A;  3GJ2 A;  3KCT A;  2Q57 A;  4KGE A;  3EK7 A;  4R6D A;  4KPI A;  3SST A;  4N3D A;  2QZ0 A;  3CD1 A;  4Q7U A;  2QLG A;  4W6C A;  2VAE A;  3MGF A;  3SVB A;  3DQ3 A;  2G3D B;  3EVR A;  4W6R A;  1Q4C A;  1KP5 A;  3DQF A;  1Z1Q A;  4B30 B;  2VVI A;  4XVP A;  5DQB A;  4W7A A;  5DTZ A;  2H5Q A;  3LVC A;  2AWJ A;  1KYP A;  2HPW A;  3DQI A;  2O2B A;  4DXN A;  4LJB A;  2IB5 A;  3EKJ A;  3U8C A;  3M24 A;  5EXC I;  1OXF A;  2G16 B;  3W1C A;  1EMC A;  1MYW A;  2AHA A;  1GL4 A;  3DQ5 A;  1QYQ A;  4UTS A;  4IZN A;  4R6B A;  2V4E B;  4KA9 A;  4W6H A;  2DUG A;  3RWA A;  1ZGQ A;  4PPJ A;  4W6J A;  3ED8 A;  3SRY A;  3IR8 A;  4OHS A;  3EKH A;  4GF6 B;  3SSP A;  4J89 A;  2HRS A;  4Q9X A;  2AWL A;  3CFA A;  4ZF3 A;  3DPX A;  2ZMU A;  3PJ5 A;  2HGD A;  2QRF A;  3DQ7 A;  3SSL A;  2FZU A;  3LVD A;  4HQC A;  4IK8 A;  2ZO7 A;  1H4U A;  3AKO A;  3GB3 A;  4W6G A;  1ZGP A;  3OGO A;  5FVG A;  3SG3 A;  3SSY A;  4JGE A;  3M22 A;  2HCG A;  2DUF A;  4EMQ A;  2POX A;  4DKM A;  3AI5 A;  5DPG A;  1BFP A;  3E5W A;  4U2V A;  2G3O A;  4RYS A;  5DTY A;  4JF9 A;  3U0K A;  5HZO A;  4J8A A;  3VHT A;  2DUH A;  4ZIN A;  4W75 A;  2VAD A;  4W6O A;  1H6R A;  4H3M A;  2HQZ A;  3WLC A;  3DQE A;  1RMO A;  2A47 A;  2H8Q A;  3VK1 A;  3RWT A;  4GES B;  3I19 A;  5BT0 A;  3NT9 A;  4Q7R A;  4W6B A;  3SVN A;  3K1K A;  3LSA A;  3IP2 A;  3UG0 A;  2OGR A;  2C9I A;  2QLE A;  2AWM A;  3U8P A;  1QY3 A;  3SSK A;  3P28 A;  2DDD A;  2OTB A;  2QLI A;  4OQW A;  3DQD A;  3TMR A;  1QYO A;  2H6V A;  1YHI A;  4ZB1 A;  5EXB A;  2OKY A;  3NT3 A;  2Z6Z A;  3EK8 A;  3EVP A;  5BTT A;  2FWQ A;  3DQL A;  2OKW A;  3ZUJ A;  4W6N A;  5LK4 A;  5EBJ A;  2OJK A;  4IK4 A;  3SSH A;  2H5O A;  4W7F A;  2B3P A;  1GGX A;  2A56 B;  4B5Y A;  4Q9W A;  4JC2 A;  3E5T A;  1YHH A;  2JAD A;  2PXW A;  5DPJ A;  2B3Q A;  1ZGO A;  3DQN A;  2P4M A;  1OXE A;  4ANJ A;  2G6X A;  4W6P A;  1Q4B A;  4W73 A;  4KW9 A;  5AQB B;  5DRG A;  4L1I A;  5DU0 A;  3V3D A;  3DQH A;  2QU1 A;  2H9W A;  4Z4M A;  5HZS A;  4PPK A;  2WHT A;  3SVR A;  4IK1 A;  4H3L A;  3SV5 A;  4HE4 A;  4KF5 A;  4LJD A;  2O29 A;  3BXB A;  5DRF A;  3DQM A;  3ZTF A;  1YZW A;  2IE2 A;  2HGY A;  2WUR A;  1RM9 A;  1XAE A;  5H89 A;  2QLH A;  3SG4 A;  2Z1O A;  3SVD A;  2V4E C;  3SVO A;  2H5R A;  3DQ4 A;  3DQA A;  4ZFS A;  3ST2 A;  2AH8 A;  3U8A A;  3U0N A;  2QLG B;  3SVE A;  4KF4 A;  2QT2 A;  3EVV A;  4IK9 A;  1RRX A;  3G9A A;  4W6F A;  4W7C A;  4KAG A;  3DQ6 A;  1EMB A;  2WSN A;  5LTP A;  3SVC A;  3ST0 A;  3DQ9 A;  1QXT A;  1EME A;  3SS0 A;  3SVS A;  3DPZ A;  1EMF A;  4TZA A;  4OY4 A;  5EB7 A;  5DTX A;  5FHV A;  5KTG A;  1YFP A;  2WHS A;  5HZU A;  3ST3 A;  2HJO A;  1OXD A;  3H1R A;  3LVA A;  4ZIO A;  2IOV A;  4RTC A;  3CGL A;  2A46 A;  3TMT A;  1YJF A;  2VVJ A;  4DXQ A;  5FVF A;  4W77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...