3RXBA

Crystal structure of trypsin complexed with 4-guanidinobutanoic acid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxbA02
2V3HH 3S7HB 1GG6B 1V2WT 4NWKA 4X6OA 1ABJH 3ZZ6A 2G51A 1P9UA 2BTCE 3T28A 1HV7A 1YCPM 2ZF0H 4DOQA 5C1XA 4B2BA 1A5IA 1O3CA 1VITG 2D8WA 1O35A 1O38A 4O97A 3M5OA 3MU4A 1C2FA 1O2ZA 1O3OA 3GDUA 1HAYB 3HATH 3TJUA 1LPKB 1D3PB 3BEFB 1W12U 5EODA 1XUHA 2XNIA 2AYWA 1FY8E 2FI3E 1GHAG 1O5CB 3SU1A 1TBZH 5GCHG 3W94A 1EATA 2JETC 1SVPA 1LVBA 4H4FA 1C2LA 1KDQA 2BVSH 1IHSH 1T8MA 2C3SA 2G4UA 1HUTH 1JWTA 4I8HA 1GJ5H 1QRXA 2C90B 4NZLA 2FOMB 1YPHC 2GMTC 3QTVH 4X2WA 4BXSA 3RLWH 1O2KA 5DP6A 4THNH 1GBHA 4K60A 2Z94A 2FOCA 1VR1H 1L1JA 5EOKA 2STBE 1SGNE 5GJ4B 3LC5A 2ALVA 2TGDA 2BM2A 1A5GH 1C2KA 1GMCF 3VB5A 1JOUB 4O3TA 2G00A 2BQWB 1TGTA 1HJ9A 2CF8H 1O2SA 4BAMB 1ELDE 3DA9B 4ZH8A 5EXNA 1H9LB 4UFGH 1O3MA 5T6GA 1ZHRA 4SGBE 4Y10E 1HRTH 1TPSA 4MNXA 1GDQA 1AFQC 5F6MA 1QTFA 3KF2A 5A8ZA 2ZGJA 3S7KB 5I46H 1ETSH 2R3YA 4D9RA 2W3IA 1CGIE 1FN6A 1K22H 3Q3KA 1S83A 3GCNA 1GVKB 1HB0B 2FOAA 4IMQA 1YCPK 5FX5A 1BQYA 3AW0A 1NPMA 3LJJA 1WU1A 3MH5A 1DSUA 1NU7B 2VJ1A 3U1IB 2THFB 2PSYA 4CREA 5C5NA 3V7TA 1NO9H 2WINI 2PKAB 3RXCA 3TK5A 1QJ7B 2EC9H 2ZU5A 8LPRA 1FY3A 1K21H 3V0XA 2Z7FE 3URDA 1HAVA 3UUZA 3PWCA 1LVMA 3C27B 2AGIX 3LGTA 5IDKA 1YYY1 3GISB 3RXUA 2ZGCA 1C1UH 1WCZA 2O8MA 1ELAA 3EA7A 4IN2A 5GXPA 1V2MT 1BTXA 2PUQH 2P94A 2W7UA 1XM1A 2XTTB 3LGVA 1RXPA 3OSYA 2WUBA 4FUJA 5F8TA 1OP8A 2RG3A 2FZZA 1A4WH 1T8OA 3MO3A 2ANKH 1W13U 3A81A 1MTUA 1PPHE 1V2NT 1MKWH 3A80A 3P95A 1QR3E 3SNBA 1TLDA 1N6YA 1HFDA 2ANMH 2ILNA 5LPRA 1N8OB 1E37B 1UTMA 4NWLA 5HXFA 1GJ7B 3P8OA 2F9PA 1HJAC 2BD7A 1MUEB 4NG9H 1QRZA 5EPNA 4GLYA 2GZ7A 4HFPB 5GCHF 1HYLA 2G81E 3VGCB 2ODPA 4NA7A 3JZ1B 3RM2H 1YM0A 4I8KA 1C1NA 1GBEA 2Y5FA 1W8BH 2O8UA 4NZQA 3F1SB 2ZDVH 4OGYA 3UOPA 3TK9A 1XUGA 1IQIA 4FUFA 2VH6A 2CHAC 4OS6A 4ISIH 3AAVA 1VITF 4DGJA 4D76A 1NFWA 5DJ7A 7GCHG 2HNTE 5FBIA 1SQAA 3OY5U 1BBRH 1XMNB 2WPLS 1C5MD 3PMBB 2ZFQH 1DUAA 3QK1A 1GHBF 3CS0A 3RLYH 1HXEH 1W7XH 1NRPH 4O03A 1BOQA 3SUGA 2EI7A 8ESTE 1EB1H 1GI8B 1BITA 4GAWA 1BMAA 2P8OB 1QL8A 5C1YA 1GI4A 1D6RA 5EQRA 3A7XA 1AQ7A 3E1XB 2C8YB 1Z8RA 1FXYA 1AIXH 3Q3YA 1NRRH 4ZXXH 2ZFRH 2P95A 3UIRA 5GDSH 2G55A 4A1TA 2F83A 4K1SA 3LC3A 3LGYA 2A4GA 3SW2B 4CBOA 3MMGA 2GDDA 4JYTA 4IGDA 1XUJA 2TBSA 3E90B 4CH2B 2GKVE 3C1KA 3MH4A 1EAUA 1PJPA 4B71A 3QTOH 1DVAH 4ABGA 1WQSA 2BOKA 1BB0B 1BRAA 1LHFH 6GCHG 3ESTA 3T26A 1KLTA 4F49A 2ZPSA 1C9TA 3RC5A 1CBWC 1O2TA 1GHZA 4IC5A 1HJ8A 2BX3A 1DFPA 3QWCH 3ZV9A 1AN1E 2Y5HA 2OC8A 1O2NA 2H5CA 2A31A 1Z1JA 4WXIA 2ZTXA 2WV4A 3QUMP 1ORFA 4ZHLU 2TPIZ 4SGAE 4D7GA 3B8JA 3TH3H 4X8VH 1QB6A 4Y7AA 3V12A 2ZU4A 4WMEA 1C2GA 5A8YA 9LPRA 1E34B 1SR5C 1BMLA 1HIAB 3A8DA 3PMHB 3PB1E 1P9SA 3P6ZB 1Y3XA 2EEKA 2Z3DA 2LNCA 2UUKB 3BG8A 2Y82A 4ABEA 2WPHS 4OS7A 1QL9A 4Y8XA 5JBCS 5GPIB 3UTUH 2QY0B 2OXSA 1GCTB 5A0BA 2Q6DA 4ISLA 3SHCH 3ZVEA 1GCTC 4YLUA 1FN8A 3ODFA 3PLKA 1ZRBA 1OWKA 2F91A 1EAXA 2F9NA 3E8LA 3STJA 2HALA 3ZZ5A 3GY5A 4ZHAA 1QNJA 1SLXB 4FUGA 4X1NU 2XCFA 1C2EA 1GMDG 3GICB 3LH1A 5SGAE 1GBJA 4XBBA 2BD4A 3KCGH 1EAIA 2BDYA 4I32A 1BT7A 3AASA 3EQ0H 3EA8A 1A1RA 1YPMH 1O3AA 3A7YA 1C2IA 1K1JA 2VH0A 1UTLM 1BRUP 4YZUA 4JZIA 2A7HA 2VIVA 4Y8ZA 1C1QA 1LQEA 4BTTB 2VIPA 3KHVA 1AVXA 1D3TB 2Z9GA 3RU4T 1J14A 3F6UH 1VCPA 4Z6AH 2HRVA 3A85A 3ZZ7A 3SV9A 2HWLB 1OP0A 3TLOA 1A3BH 4DY7B 1CT2E 2KAIA 1P3CA 2GCTB 1HJAB 1Z7KA 1C2DA 2GTBA 2UUFB 1GJAB 2GCTC 4OGXA 2STAE 1DITH 2BQ7B 1NFXA 2GCHF 2D26C 1GJ6A 3K65B 1WBGB 3VGCC 3RMLH 1O2JA 2QXJA 5B6OA 1J15A 1DANH 1VZQH 3SU3A 4ZXYH 1C1SA 1J17T 1DWDH 2ZECA 1LCYA 3ELAH 2WYJA 1HAIH 1O5AB 1S6HA 4AGKA 1O3HA 3GY3A 3PMJA 2ZCHP 4MLFB 3LONA 2FI5E 2LPRA 2ZZUH 2XBXA 2XRCA 1ZTKA 3PYHA 3RXVA 3U69H 2PHBA 4X1SU 1LVYA 2BZ6H 2OP9A 1TOCB 3UPEA 2J94A 5T6FA 1O5GH 1PPBH 1ZMJA 1GDNA 3T5FH 1SGRE 5A8XA 1GMHF 1NS3A 1TOMH 2TGAA 4Q7XA 1AFQB 2A45B 3E0NB 5C67A 2XXLA 1GHYH 2AGGX 2J2UA 1P09A 4JCNA 2BY7X 3VXEH 2J38A 4E06H 4D9QA 3BTME 4MPVA 4AB8A 1GI9B 1TPPA 1JRTA 1V2VT 2BDAA 3LJOA 2BDGA 1K2I1 2BDCA 4CRDA 3ATMA 1ZTJA 3M35A 2XC5A 1SGPE 2ZKSA 5C5OA 3OTJE 4D7FA 1O3EA 4UFDH 3RXPA 2RA3A 1PQ7A 3D49H 3SJ9A 1GJ9B 4NSYA 1UTOA 1BA8B 4ABBA 4KP0A 1HAHH 1FIZA 4Y6DA 3MHWU 3GY4A 3K6YA 1ACBE 5DPAA 3RXEA 4X8TH 4CRAA 1IQMA 2ZGBH 4X8SH 2FEQH 3QGJA 4CR9A 1Y5UT 5LPEA 3KN2A 5C1UA 1F2SE 1SSXA 4NIVA 2ZHFH 2CN0H 2VIQA 1ESBA 1O36A 1Q31A 4I8LA 1TABE 1KYNA 1O5EH 4FUBA 1BTZA 7GCHF 1YPEH 2UWLA 1TNIA 2FLBH 3B23B 1IQLA 2H9TH 3S9AA 4ABFA 1SPJA 5TJXA 3UR6A 3BIUH 1C5RA 4LXBH 4Y11E 4Z0KA 2R3UA 5BRRE 1O32A 1N8OC 4AYVB 4DG4A 2B5TB 1HAPH 2GT7A 3NPSA 3SU5A 2OUAA 2B0FA 3SZNA 1FUJA 1ZJKA 3SV2H 1C1RA 1C1OA 1GBBA 1GHXH 1O2YA 3SBKA 5ABWA 4NCYA 3GCTF 4FUCA 4HTCH 1SFQB 1TALA 1BTHH 1QHRB 5E2PA 2ZWLH 1WV7H 4B75A 1EPTA 4K8YA 4Q7ZA 1B0FA 2BY6X 3UQOA 1HCGA 1K1OA 1AO5A 3UNSA 5E0JA 1AWHB 1GI2A 1O2GH 3ZVGA 4VGCC 1G9IE 4TWYA 4I33A 1E38B 1C5UA 2RCEA 3BSQA 3T25A 1O3IA 1AMHA 1ELEE 3RXOA 4CRGA 4FUIA 3ZZ8A 2Z6BD 3TH2H 2H5DA 1UTNA 1EJNA 3ZVCA 1QBVH 3H7OA 3QN7A 4Q80A 1INCA 4B73A 2ZCLP 3GY8A 4WWYA 2ULLA 4AG2A 4FVBA 1F92A 1SGFG 1TNKA 2GMTB 1UVOA 1EPTC 2Y7XA 2QN5T 4XSKU 1AGJA 3SJKA 2A32A 3PLPA 4X6NA 1C4Y2 2OQUA 2XBWA 1PQ5A 2SGQE 4CR5A 2BDHA 3ZZAA 2DUCA 3P8GA 2QV1A 3SI3H 5F8XA 3M5NA 1AVWA 2IJOB 2H2ZA 3RXAA 2NU1E 5E8EH 5C2ZA 2ZFSA 1VCWA 4X2VA 3RMMH 1K9OE 1V2KT 4IC6A 4Y8YA 5J4SA 2BD8A 2KAIB 1XUKA 1V2PT 4UFEH 1YF4A 1RS0A 3BTHE 1D4PB 1C2HA 1SOZA 1WTGH 3M36A 4ABIA 3I77A 2QYIA 1GBIA 3F68H 1H1BA 2WPIS 1EP5A 1F5RA 5J4QA 1ZRKA 1O2HA 1XVOA 3SU6A 3UR9A 1UMAH 2GD4B 2HNTF 4UD9H 3BTQE 4DW2U 1A0LA 1A0HB 1P2KA 1T32A 1LDTT 3BN9A 2F3CE 2FWWA 2P3UB 3VXFH 2CGAA 1JIRA 4IMZA 1SGDE 2Q6GA 4AX9H 4MDSA 1GPZA 4KGAA 1W0YH 4X6MA 2H1UA 1HAZB 1PPEE 3QLPH 1UHBB 2BXTH 3A8CA 4GHQA 4MPUA 1S0QA 2H9EH 1FJSA 2A2QH 3ZVBA 6CHAC 4ISHH 4VGCB 3K2UA 1O0DH 1MTSA 1S0RA 1ZPZA 1P03A 1QBNA 1DT2A 3R3GB 1GMCG 1CGJE 2ZGXH 2OC0A 2IN2A 2V6NA 4X6PA 1MZDA 1QA0A 4YO9A 2GV7A 1SFIA 3KEEA 3MNBA 1IHTH 1GGDC 3MU5A 1TX8A 2GCHG 4M7GA 4ZKOU 1K1MA 2W26A 2OQ5A 1OYQA 1ELBA 1XUFA 1OP2A 3RDZA 1Z71A 4KTCA 1NFUA 1L4DA 1NRSH 3FP6E 1TB6H 2HLCA 2BLOA 4RKOB 1GI7B 3FAOA 1BBRK 3E6PH 2FO9A 2UUJB 1Z6EA 5CHAC 1AZZA 1BTWA 2GX4A 1HAGE 1ZSLA 1SGIB 3E16B 1DICA 1TPOA 4TWWA 1T7CA 1KXAA 1VGCC 1T4VH 2G8TA 2BDBA 2SFAA 1ELTA 4J2YB 4H6TA 3HK6B 1P04A 2ZQ2A 1Q2WA 2PLXA 1Y3VA 1DLEA 3PROA 1SGTA 2R2WU 2ZEBA 4MG3A 4B2CA 4AOQA 1V6DA 5I25A 1ELGA 4BAKB 4GHTA 1F5LA 2QC2A 3E3TA 1BRBE 2P59A 1ESAA 3MTYA 2FLRH 1ETTH 2AGEX 2GZ9A 3GYMA 5DP5A 2ODYB 2J92A 1F0UA 5EW1H 1D9IA 1A7SA 1O5BB 1GBAA 1O3PB 2RA0A 4IBLH 4FU9A 1MH0A 2FOFA 1PYTD 1DUEA 1DSTA 5TCAA 1LKAA 2VGCC 2GDEH 1HLTH 3NWUA 1GJDB 1UVSH 1GBDA 1PQ8A 1Y5BT 4AGJA 1OPHB 1YP9A 1MTWA 4E7NA 1LPZB 2ZU3A 1C5XB 4NA8A 5EQQA 4AORA 4OS2A 1PFXC 1OXGA 1NRQH 2AIPA 1UK3A 5A2MH 1MZAA 1CA0B 1QL7A 1SHHB 3ZZ9A 2PW8H 5JB8S 2DE9A 1DXWA 3E0PB 1OWIA 3UY9A 4MVNA 1O33A 2Y7ZA 3A86A 2Y80A 1MQ6A 5DO4H 1JXPA 2BOHB 2ESTE 4RN6A 2WPMS 4A6LA 5AFYH 1FAXA 1SGYE 4ABDA 1O5DH 4DT7B 2JH5D 1ZPBA 1QQ4A 1GHWH 1TNHA 3TH4H 1AUJA 2PGBB 3F9EA 3ZZ4A 2TGTA 1D6WA 2XWBI 3E91A 4YTAA 1UTPA 3UOUA 3VB4A 2BVXH 1K1LA 1J9CH 1QFKH 3KQBA 4BNRA 1V2ST 2FM2A 4HZHA 4YOJA 1YKTA 1ZTLA 2XBYA 6GCHF 4KTUA 3RXKA 2V0BA 3T27A 3TJNA 1C4U2 1MKXK 1UTKA 5L6NH 1BTUA 1A5HA 2ANYA 1C5LH 2PUXB 1CSOE 2D2DA 3EAJA 4U30A 1AKSA 5PTPA 3RXMA 4LZ4B 3LH3A 1CGHA 3UWIA 1V2OT 4DIHH 1O3NA 1DWCH 2ZDKA 3RXIA 2M5TA 1GI1A 1DPOA 1O3FA 1G2MA 3ATKA 3ZYDA 4OS4A 2QF0A 2OBOA 5EW2H 1JIMA 1EZQA 2CMYA 2YNBA 3FZDA 3UNRA 1T8LA 2C8XB 2BD3A 3HPTB 3SQHE 3SGQE 1P06A 2ZI2H 1F5KU 1QBOA 2JH0D 4WJG2 2GVFA 3BTDE 4ZROA 1MCVA 1UVUH 3TNTA 2FOGA 3OU0A 5JPMH 3P70B 2A5IA 2C4FH 2ZPQA 2AMQA 8GCHF 3U8TH 1QY6A 2QIQA 1EASA 1AU8A 2PFEA 3FFGA 3TK6A 5HM2A 2R0LA 1MKXH 1G3BA 1O34A 1G3CA 4MPWA 1CT0E 3PV4A 4ABAA 4UEHH 5DK1A 1Z1IA 3SGBE 3O8BA 3LDXH 3TNSA 1GG6C 3DUXH 3PTNA 2JETB 1EOJA 3EYDA 1P05A 1UHBA 2QAAA 4Y0YE 1DWBH 3LKWA 5AVDA 3NZIA 2TIOA 1XUIA 3ZZDA 1L0ZA 2QF3A 1QURH 1YLDA 1P2NA 1EB2A 2A7JA 1F0RA 1SQOA 3FVFB 3TIUA 1IQKA 4XFQA 1FY5A 4YOGA 1Y8TA 2VIDA 2ZHQH 1Y3UA 1DS2E 1BIOA 3RM0H 1BDAA 1LHCH 3RXQA 4UE7H 2OTVA 2FMJA 1Z8IB 4WY3A 1UTJA 3A8BA 3G01A 4OS1A 2CF9H 2RDLA 1N6XA 3VB7A 3FP8E 2IPHA 2ZG0H 1J16A 2FX4A 3EA9A 1QB9A 4UONA 2ODQA 5E0GA 1MBMA 2J9NA 1FONA 1K28D 5ESBA 1BMMH 1BTPA 1DLKB 3PTBA 4Q2KA 5HGGA 2VWNA 4GVUA 1LTOA 1V2QT 2ZDMA 4TPYA 1V2LT 4YT6H 2SGEE 1EZXC 1CHOG 2C8ZB 1KDQB 1YCPH 3M5MA 1NFYA 3TVJB 1AE5A 2QXIA 2QXHA 1GBTA 2NU2E 1A46H 3UWJH 3ZVFA 1O2XA 2TRMA 1AUTC 3MFJA 4I8GA 1MAYA 1GCDA 2VIOA 1O3DA 5E0HA 1V2RT 4ZUHA 1RTLA 3I78A 3F9HA 2P3FH 3HKIB 4B2AA 1QRWA 2FTMA 4ISNA 2AH4X 1KXEA 3TU7H 3BV9B 4AG1A 1S6FA 1ANCA 1C5WB 1OKXA 3AW1A 1HAOH 1H9IE 1HGTH 1IQEA 1H8IH 1NRNH 1O2OA 2BZAA 3KIDU 4LK4A 3TJOA 4WH6A 1T31A 1WAYB 1P2JA 3NCLA 3BTWE 4ASHA 4BOHA 1DM4B 3AAUA 1MTVA 3RXDA 3TGIE 1GDUA 5L2ZH 1C1VH 2PV9B 1SQTA 4E7RG 2FS9A 1C5ZB 1ETRH 2G5NA 4K8BA 1UTQA 3S9BA 3GY6A 5G4BA 1D3QB 1Z8JB 3IG6B 1YGCH 3D65E 3RC4A 3SU0A 2OC7A 3BIVH 3ITIA 5JBTA 5AHGH 1MTNB 3KQDA 2ZFTA 3TJVA 1AY6H 1GL0E 1IQGA 1TYNA 2PKAA 1B0EA 2G5VA 2A5AA 1FV9A 3O8RA 3F9GA 3BTFE 1XKBC 4AN7A 3OX7U 1WUNH 1E0FD 1ID5H 2CHAB 1S5SA 4RKJB 4YESB 1Q3XA 2AERH 3F9FA 3GCTG 1MU6B 3QGNB 3BTGE 2ZIQH 1TNLA 3STIA 1IQNA 3RUOA 1P2MA 2BXUH 2VVUA 1HXFH 2AIQA 3M3TA 2J34A 4XOJA 1ZLRA 2BD9A 3V13A 3UREA 3URCA 2P8OC 2WPKS 1TIOA 1EPTB 1UK2A 1KXFA 2BD2A 2ANWA 1ZJDA 2PGQB 1H4WA 1KXDA 2ZHEH 3IITA 2V3OH 1CT4E 4INHA 3OY6U 1C5YB 1L2EA 1C1WH 3P17H 3PMAB 1CO7E 3HK3B 4I31A 3SUDA 1LVOA 3RXHA 3HGNA 4AFQA 1TNGA 1W11U 1FY4A 1WSSH 2BY5X 3A82A 1VITH 3BTEE 2A4OA 1FPCH 1ZZZA 1BHXF 3RXTA 2Y6TA 4Y71A 1CA8B 3ATIA 3NK8A 3QO6A 2SGAA 2PR3A 4Y76A 2A2XH 2SGPE 3S9CA 1RIWB 4QT8C 3PM3A 4DIIH 1XKAC 1XX9A 1TBRH 4HI3A 1ARCA 1CQQA 2ZQ1A 4R0IA 5FX6A 2BQ6B 1OSSA 1TGSZ 1LHEH 2VVVA 6CHAB 5F03A 3ZVDA 2VGCB 3SUFA 3ZZ3A 1ZOMA 3A8AA 2OLGA 3S0NA 3LU9B 1P57B 5JYIA 1GBLA 2ALPA 4FU8A 3UFAA 1MKWK 1EOLA 1NESE 2BMGB 2VIWA 2ZNKH 3SNAA 3CENA 3ODDA 1SLUB 1GI0A 4R8TB 1P2OA 2FIRH 4PROA 1CBWB 3MI4A 2FS8A 3N7OA 3BF6H 1MTNC 3QX5H 1WTHD 3LGWA 2XCNA 3SUEA 2VWMA 1MU8B 3MU8A 2W7SA 3RXRA 2OC1A 5CMXH 2D1JA 4K5ZA 4BTIB 4MNWA 1QJ1B 2AMDA 3LGUA 1HNEE 1P11E 3ZYEA 2ASUB 1O2LA 3PWBA 1QJ6B 4DVAU 3Q3XA 5ETXA 5A0CA 4JYUH 1EXFA 2F9UA 4X1RU 1HDTH 1MD8A 1NT1A 2R9PA 2O8LA 1ELFA 4WF8A 4ZMAH 3GDVA 2SNVA 4INKA 4GCHF 3RU4D 1B7XB 3MH6A 4ESTE 1GHVH 2FYRA 3Q77A 1AB9B 1CHOF 1BRCE 3A7VA 3EDXB 3ZZBA 1Y59T 5E2OA 1DY9A 1P2IA 1AFEH 2VINA 1P01A 1EUFA 3VB3A 3SV7A 2FXRA 4NGAH 1KLIH 2F9OA 2FOHA 4X8UH 2VVCA 1DWEH 4A92A 5LPFA 1PPFE 1C9PA 1G3EA 1OX1A 4O3UA 3RC6A 2HVXA 1K1IA 2P16A 1GI5A 1GVLA 3NXPA 2HPQH 5HM9A 2VWLA 1O39A 3HGPA 4U32A 2GZ8A 3D23A 2ZU1A 4X2XA 1SBWA 4GPGA 1EJMA 1O3JA 1SG8B 1SOTA 4E05H 2WPJS 2FPZA 1EP6A 5K7RA 1A61H 4B1TA 1ZHMA 2BB4A 1HIAA 5A09A 2AEIH 2FESH 1ELCA 2ZFPH 1EJAA 2BLWA 2J4IA 5IYTA 1EAWA 2BY9X 2SNWA 1A0JA 3IWMA 4TY7A 1TMTH 1SLWB 1TRNA 3MH7A 1P0SH 4ZKRU 2NU0E 4I7YH 1O2VA 5DP8A 1AE8H 1JMOH 2OCVB 1TBQH 2K1QA 3H5CB 1Y5AT 4F4OC 4GSOA 4X2YA 5DP7A 1TAWA 3P92A 2OINA 5EGMA 1AWFH 2H6MA 2A4RA 2YOLA 3GCHC 1ZMLA 5GIBA 4K1EA 1LHDH 3GOVB 5AFZH 3MO9A 1BTYA 1GI6A 1LO6A 1ZSKA 1NY22 3TPIZ 2QGRA 3ZV8A 1FLEE 3KGPA 1BBRE 3TGKE 1RFNA 1SGFA 2DE8A 1Z8GA 3SI4H 1OS8A 1F7ZA 2ZDLA 2GV6A 7ESTE 1AB9C 2F9BH 4FUHA 2Q1JA 3VFEA 1VJAU 4O9VA 2Z9LA 2VB0A 4RSPA 3SV6A 1WYKA 1YC0A 3ATLA 3U98H 4BAHB 3O8CA 3U9AH 3Q76A 5JBBS 1NROH 3SV8A 1CA0C 1RD3B 3KL6A 1E35B 1C5VA 2FX6A 1IQFA 1GMDF 3QZQA 1TPAE 4XBDA 1RRKA 5FHTA 4OS5A 5TCCA 4X1QU 1NU9A 1B5GH 3KNXA 1VCQA 2HPPH 1O2WA 2I6QA 1GI3A 1ABIH 4GCHG 1O2MA 4WMFA 6LPRA 1PPZA 3LGIA 2ZU2A 1NTPA 1ZYOA 2A7CA 1C5PA 1TNJA 4Q7YA 1SMFE 4A5TS 4HGCA 3LT3A 3SORA 1MBQA 4CBNA 2QXGA 1IQHA 3H7TA 2ZDNA 5GWZA 3SJIA 3GCOA 3M3VA 3U8OH 3SQEE 5FCKA 5LH8A 1S84A 1YPGH 1EZSC 5K0HA 2OD3B 5A0AE 4BXWA 1DY8A 1BJVA 2VWOA 4BTUB 1SI5H 2I6SA 1MCTA 4INLA 4DURA 3GYLB 3SJ8A 1EZUC 1ZSJA 1T4UH 4YM9A 4Y0ZE 1RJXB 2FI4E 5FPSA 1CVWH 1JBUH 4YOIA 3PLBA 3GY7A 3NKKA 4K69A 3TITA 1DX5M 1WQVH 2ZA5A 5EG4A 5HMAA 1C5OH 2VU8E 1FIWA 1AI8H 4I8JA 1O2UA 1LKBA 2BLVA 1O5FH 3GCHB 5FCRA 3SN8A 2Z3CA 3M7UA 4K2YA 3GDSA 2ZPRA 2ZP0H 3A7ZA 3MOCA 1XXDA 2PKSC 7KMEH 1LHGH 3BTTE 3FP7E 1G36A 1G30B 1HAVB 1O37A 3LOXA 1IAUA 4JZEH 3RP2A 5EPYA 4U01A 2BX4A 2BY8X 2IOTA 3MNXA 4TYDA 4JYVH 1TWXB 2ZDAH 5EXLA 1GHBG 1P2QA 1TE0A 3A83A 3ZZCA 7LPRA 3QDZB 3HKJB 3P8FA 1AD8H 3DT0H 1ANEA 4AFSA 1O2PA 1TA6A 2BVRH 3L6PA 3M7QA 1A2CH 4FVDA 3MU1A 1W2KH 3A88A 2C93B 3A7TA 3Q00A 4A7IB 2PSXA 1GBFA 4K1TA 1P10A 3NUMA 2B9LA 1UO6A 3B9FH 1YLCA 2UUYA 3D62A 3K9XB 1G2LA 4CH8B 2PKSB 1AKSB 1UVTH 1G37A 1FQ3A 1K1PA 6ESTA 1SB1H 2R0KA 1UVPA 3T2NA 1MD7A 1TMUH 1ZR0A 1THSH 1S82A 3AVZA 1UJ1A 2BHGA 1O2RA 1ZHPA 3KQCA 1WOFA 3RXBA 5ESTE 1FDPA 1UCYE 4IW4E 4ZAEA 2A5KA 1BHXB 2FODA 3KQEA 1GJ8B 1O3LA 1C2JA 2Y5GA 1S85A 1FY1A 2O8WA 1ANDA 5EXMA 2PTCE 1O3GA 1GJ4H 5F8ZA 2Q6FA 3RXLA 1O3KA 4UFFH 5BPEA 1SLVB 4B74A 3UQVA 4NIWA 1BZXE 4AZ2B 1T8NA 4BAQB 9ESTA 4IN1A 3UNQA 1U6QA 2BYAX 3RXFA 1FZZA 4FXGH 4LOYH 3O8DA 1S81A 2Z3EA 1ARBA 1SGCA 2FDAA 5DP9A 2GT8A 2NU3E 1P02A 1GJBB 3CS7A 5EQSA 1C1PA 3MNCA 3A84A 3RXSA 1NZQH 2B7DH 2VNTA 2CXVA 2NWNA 1G32B 2Z9IA 1RGQA 2Y81A 2XWAA 4FUDA 1O3BA 3U1JB 4Y79A 2ZHWH 2ZC9H 1V2JT 3BG4B 4X1PU 4TY6A 3K6ZA 1ELVA 2A0QB 4KTSA 1SC8U 4BANB 1C5SA 5JBAS 2WV5A 1LPGB 3M5LA 1F0TA 1KLJH 1TMBH 1ESTA 3M3SA 2SGDE 1L4ZA 3A87A 4ZHMU 1G3DA 3MU0A 1Y3YA 1GBKA 1GVZA 4TPIZ 1OWJA 5FPTA 1H9HE 1W7GH 1P3EA 3LPRA 4XBCA 3MWIU 1C5NH 2HOBA 1LQDB 2UWPA 5FXLA 2XC0A 1GGDB 1ZPCA 1QCPA 1O2IA 2BD5A 4YLQH 1GBMA 2O8TA 1AZ8A 1EKBB 2HNTC 2FYQA 3T62A 2CV3A 1GBCA 3L33A 1C1MA 2R2MB 3M37A 1RTKA 4XE4A 2Z9KA 5H4IB 2V35A 3VEQB 1THPB 1C4V2 4JK6A 2QCYA 1GMHG 5HYOA 4CHAB 1IOEA 1OYTH 1UK4A 1YPJH 1MMJN 1PPCE 2QA9E 1VGCB 1CHGA 3SNEA 1TGBA 2O9QA 1TRMA 1ZGVA 1DE7H 1E36B 1X7AC 4NIYA 2PTNA 5DP3A 1NM6A 4CRBA 2FP7B 3I29A 1OWDA 2A1DB 5C20A 1NC6A 1QGFA 1ZGIA 1OWHA 2SGFE 4B76A 1BUIA 2BDIA 2ZTZA 1KTSB 2G52A 2YNAA 3SJOA 3FANA 2NU4E 1FNIA 4BAOB 3SOSA 5T6DA 1SHYA 3DFLA 1YPKH 1MQ5A 5CHAB 3VB6A 2P93A 1YPHE 4GUXA 4IS5A 3RU4E 3BEIB 4ZKNU 4KELA 3SNCA 2HGTH 1Y3WA 1XVMA 5JB9S 2W3KA 3BTKE 1D3DB 5FBEA 2F9VA 1CE5A 1KSNA 1P8VC 2FOBA 4WXVA 1HPGA 4ZKSU 1DXPA 1SGEE 3EGKH 1BCUH 4A1XA 5LGOA 2EA3A 3PO1B 1A3EH 1HBTH 5T3HA 1LMWB 1PPGE 1Z6JH 8GCHG 3BG4C 1TFXA 1W3CA 3SHAH 3U8RH 1XXFA 1QA7A 5L30H 1YPLH 1W10U 1CU1A 3ENSB 1GHAF 2P3TB 1KXCA 4MPXA 3TGJE 1ANBA 1V2TT 4JZFH 5C3NA 5DP4A 2ZFFH 4NFEA 1TX7A 3DFJA 1FPHH 2A4QA 3OYPA 4MNYA 4NIXA 3RXGA 2FTLE 4A1VA 4ABJA 3A7WA 2B8OH 3RMNH 1L1GA 1NN6A 1FMGA 3DD2H 1N1LA 1VJ9U 5DGJA 4D8NA 1C2MA 4AFUA 2AFQB 5EU8A 2XW9A 4H42U 1THRH 1AVGH 1AHTH 1V2UT 1EX3A 1C5QA 1TA2A 1TGNA 3DHKH 4YT7H 1GJCB 1SGQE 2H9HA 2WUCA 1M9UA 4WMDA 1O2QA 1J8AA 3W95A 4XDEA 5FPYA 1RTFB 3LIWA 3P8NA 2W5EA 2ZO3H 3FZZA 3QZRA 5L2YH 5FAHA 1TRYA 1BMNH 3SNDA 1FAKH 3ZVAA 1TONA 1W14U 1KIGH 1O31A 4UDWH 2EI8A 1UCYK 4MNVA 4ABHA 1W0ZU 1UCYH 3PO1C 4X0WU 3VPKA 3S69A 3GY2A 3CP7A 1ZMNA 1L1NA 1H8DH 2AMPA 2EI6A 4H6SB 2XBVA 2PWXA 4K3JA 3EE0B 3SU2A 2Z9JA 5DKMA 3M61U 4MQAA 5JDUB 2JKHA 4U2WA 1IQJA 1TX6A 4CHAC 8KME2 2ZCKP 1SL3A 1DDJA 2J95A 3SU4A 2G4TA 1DOJA 1KY9A 1PQAA 3RMOH 1OWEA 4Y7BA 2UWOA 4DJZB 1KTTB 1V3XA 1KXBA 2CJIA 2FOEA 1HAXB 2GGVB 1P12E 1EQ9A 2JH6D 1QQUA 4NFFA 4NA9H 1QB1A 2ZGHA 4MTBA 1C5TA 4AB9A 4AFZA 3RXJA 3MO6A 1O30A 4JZ1A 1MAXA 5AF9H 2TGPZ 4WVPE 4FUEA 4CRFA 4JMYA 1C1TA 3JZ2B 3BEUA 1GL1A 3M7TA 4JZDH 3SO3A 4CRCA 1RIWC 2BLQA 2XC4A 1F0SA 1TGCA 5CE1A 4DCDA 3ATWA 1TQ7B 3L3TA 2OBQA 4AYYB 1TQ0B 2C8WB 4NSVA 1QIXB 4WH8A 3SGAE 3R0FA 1FI8A 1K1NA 4ISOA 1BJUA 2GP9B 2XYAA 4J1YA 3T29A 1GWAA 1JRSA 3WY8A 1OOKB 3MYWA 5DG6A 2WYGA 3V3MA 3A89A 2ZHDA 3MNSA 4JK5A 1PYTC 4FU7A 2ZTYA 4KKDA 2AS9A 4LZ1H 1YBWA
chains in the Genus database with same CATH superfamily
2V3HH 3S7HB 1GG6B 1V2WT 4NWKA 4X6OA 1ABJH 3ZZ6A 2G51A 3N7EA 1P9UA 2BTCE 3T28A 1HV7A 1YCPM 2ZF0H 4DOQA 3DSPA 4B2BA 1A5IA 1O3CA 1VITG 5C1XA 2XNDD 2D8WA 1O35A 1O38A 4O97A 3M5OA 3MU4A 1C2FA 1O2ZA 1O3OA 3GDUA 1HAYB 3HATH 3TJUA 1LPKB 1D3PB 3BEFB 1W12U 5EODA 1XUHA 2XNIA 2AYWA 1FY8E 2FI3E 1GHAG 1O5CB 3SU1A 2EQNA 2JDID 1TBZH 5GCHG 3W94A 1EATA 2JETC 1SVPA 5B6LA 1LVBA 4H4FA 1C2LA 1KDQA 2BVSH 1IHSH 1T8MA 2C3SA 2G4UA 1HUTH 1JWTA 4I8HA 1GJ5H 1QRXA 2C90B 4NZLA 2FOMB 1YPHC 2GMTC 3QTVH 4X2WA 4BXSA 3RLWH 1O2KA 5DP6A 2WV9A 4THNH 1GBHA 4K60A 2Z94A 2FOCA 1VR1H 1L1JA 5EOKA 2STBE 1SGNE 5GJ4B 4TT3D 3LC5A 2ALVA 2TGDA 2V7QD 2BM2A 1A5GH 1C2KA 1GMCF 3VB5A 1JOUB 4O3TA 2G00A 2BQWB 1TGTA 1HJ9A 2CF8H 1O2SA 4BAMB 1ELDE 3DA9B 4ZH8A 5EXNA 2LELA 1H9LB 4UFGH 1O3MA 5T6GA 1ZHRA 4SGBE 4Y10E 1HRTH 1TPSA 4MNXA 1GDQA 1AFQC 5F6MA 1QTFA 3KF2A 5A8ZA 2ZGJA 3S7KB 5I46H 2KCYA 1ETSH 2R3YA 4D9RA 2W3IA 1CGIE 1FN6A 1K22H 3Q3KA 1S83A 3GCNA 1GVKB 1HB0B 2FOAA 5CHBA 4IMQA 1YCPK 5FX5A 1BQYA 3AW0A 1NPMA 3LJJA 1WU1A 3MH5A 1DSUA 1NU7B 2VJ1A 3U1IB 3F0OA 2RDEA 2THFB 2PSYA 4CREA 5C5NA 3V7TA 1NO9H 2WINI 2PKAB 3RXCA 3TK5A 1QJ7B 2EC9H 2ZU5A 8LPRA 1FY3A 1K21H 3V0XA 2Z7FE 3URDA 1HAVA 3UUZA 3PWCA 1COWD 1LVMA 3C27B 2AGIX 3LGTA 5IDKA 1YYY1 3GISB 3RXUA 2ZGCA 1C1UH 1WCZA 2O8MA 1ELAA 3EA7A 4IN2A 5GXPA 1V2MT 1BTXA 2PUQH 2P94A 2W7UA 4ACAA 1XM1A 2XTTB 3LGVA 1RXPA 3OSYA 2WUBA 4FUJA 5F8TA 1OP8A 2RG3A 2FZZA 1A4WH 1T8OA 3MO3A 2ANKH 1W13U 3A81A 1MTUA 1PPHE 1V2NT 1MKWH 3A80A 3P95A 1QR3E 2KR7A 3SNBA 1TLDA 1N6YA 1HFDA 2ANMH 2ILNA 5LPRA 1N8OB 1E37B 1UTMA 4NWLA 5HXFA 1GJ7B 3P8OA 2F9PA 1HJAC 2BD7A 1MUEB 4NG9H 1QRZA 5EPNA 4GLYA 2GZ7A 4HFPB 5GCHF 1HYLA 2G81E 3VGCB 2ODPA 3PV2A 4NA7A 3JZ1B 3RM2H 1YM0A 4I8KA 1C1NA 3KQ5A 1GBEA 1W8BH 2KCOA 2O8UA 2Y5FA 4NZQA 3F1SB 2ZDVH 4OGYA 3UOPA 3TK9A 1XUGA 1IQIA 4FUFA 2VH6A 2CHAC 4OS6A 4ISIH 3AAVA 1VITF 5EIYA 4DGJA 4D76A 1NFWA 2M2AA 5DJ7A 7GCHG 2HNTE 5FBIA 1SQAA 3OY5U 1BBRH 1XMNB 2WPLS 1C5MD 3PMBB 2ZFQH 1DUAA 3QK1A 1GHBF 3CS0A 3RLYH 2GJGA 1HXEH 1W7XH 1NRPH 4O03A 1BOQA 3SUGA 2EI7A 8ESTE 1EB1H 1GI8B 1BITA 4GAWA 1BMAA 2P8OB 1QL8A 2L6OA 5C1YA 1GI4A 1D6RA 5EQRA 3A7XA 1AQ7A 3E1XB 2C8YB 1Z8RA 1FXYA 1AIXH 3Q3YA 1NRRH 4ZXXH 2ZFRH 2QE7D 2P95A 3UIRA 2W6ID 5GDSH 2G55A 4A1TA 2IPQX 2F83A 4K1SA 3LC3A 5C17A 3LGYA 2A4GA 3SW2B 4CBOA 3OEHD 3MMGA 2GDDA 4JYTA 4IGDA 1XUJA 2TBSA 3E90B 4CH2B 2GKVE 3C1KA 3MH4A 1EAUA 1PJPA 4B71A 3QTOH 1DVAH 4ABGA 2BOKA 1WQSA 1BB0B 1BRAA 1LHFH 6GCHG 3ESTA 3T26A 1KLTA 4F49A 2ZPSA 1C9TA 3RC5A 1CBWC 1O2TA 1GHZA 4IC5A 1HJ8A 2BX3A 1DFPA 3QWCH 3ZV9A 1AN1E 2A31A 2OC8A 1O2NA 2H5CA 2Y5HA 1Z1JA 4WXIA 4Q4LA 2ZTXA 2WV4A 3QUMP 1ORFA 4ZHLU 2TPIZ 4SGAE 4D7GA 3B8JA 3TH3H 4X8VH 1QB6A 4Y7AA 3V12A 2ZU4A 4WMEA 1C2GA 5A8YA 9LPRA 1E34B 1SR5C 1BMLA 1HIAB 3A8DA 3PMHB 3PB1E 1P9SA 3P6ZB 1Y3XA 2EEKA 2Z3DA 2LNCA 2UUKB 3BG8A 2Y82A 4ABEA 2WPHS 4OS7A 1QL9A 4Y8XA 5JBCS 5GPIB 3UTUH 2QY0B 2OXSA 1GCTB 5A0BA 2Q6DA 4ISLA 3SHCH 3ZVEA 1GCTC 4YLUA 1FN8A 3ODFA 3PLKA 1ZRBA 1OWKA 2F91A 1EAXA 2F9NA 3E8LA 3UAIC 2CK3D 3STJA 2HALA 3ZZ5A 3GY5A 4ZHAA 1QNJA 1SLXB 4FUGA 4X1NU 2XCFA 1C2EA 1GMDG 3GICB 3LH1A 5SGAE 1EFRD 1GBJA 4XBBA 2BD4A 3KCGH 1EAIA 2BDYA 4I32A 1BT7A 3AASA 3EQ0H 3EA8A 1A1RA 1YPMH 1O3AA 3A7YA 1C2IA 1K1JA 2VH0A 1UTLM 2OK5A 1BRUP 4YZUA 4JZIA 2A7HA 2VIVA 4Y8ZA 1C1QA 1LQEA 4BTTB 2VIPA 3KHVA 2IJD1 1AVXA 1D3TB 2Z9GA 3RU4T 1J14A 2WPDD 1VCPA 3F6UH 4Z6AH 2HRVA 3A85A 3ZZ7A 3SV9A 2HWLB 1OP0A 5CDFE 3TLOA 1A3BH 4DY7B 1CT2E 2KAIA 1P3CA 2GCTB 1HJAB 1Z7KA 1C2DA 2GTBA 2UUFB 1GJAB 2GCTC 4OGXA 2STAE 1DITH 2BQ7B 1NFXA 2GCHF 2D26C 1GJ6A 1W0KD 3K65B 1WBGB 3VGCC 2K8IA 3RMLH 1O2JA 2QXJA 5B6OA 1J15A 1DANH 1VZQH 3SU3A 4ZXYH 1C1SA 1J17T 1DWDH 2ZECA 1LCYA 3ELAH 2WYJA 1HAIH 1O5AB 1E1QD 1S6HA 4AGKA 1O3HA 2JJ2D 3GY3A 3PMJA 2ZCHP 4MLFB 3LONA 2FI5E 2LPRA 2ZZUH 2XBXA 2XRCA 1ZTKA 3PYHA 3RXVA 3U69H 2PHBA 4X1SU 1LVYA 2BZ6H 2OP9A 1TOCB 3UPEA 2J94A 5T6FA 1O5GH 1PPBH 1ZMJA 1GDNA 3T5FH 1SGRE 5A8XA 1GMHF 1NS3A 1TOMH 2TGAA 4Q7XA 1AFQB 2A45B 3E0NB 5C67A 2XXLA 1GHYH 2AGGX 2J2UA 1P09A 4JCNA 2BY7X 3VXEH 2J38A 4E06H 4D9QA 3BTME 4MPVA 4AB8A 1GI9B 1TPPA 1JRTA 1V2VT 2BDAA 3LJOA 2BDGA 1K2I1 2BDCA 4CRDA 3ATMA 1ZTJA 3M35A 2XC5A 1SGPE 2ZKSA 5C5OA 3OTJE 4D7FA 1O3EA 4UFDH 3RXPA 2RA3A 1PQ7A 3D49H 3SJ9A 1GJ9B 4NSYA 1UTOA 1BA8B 4ABBA 4KP0A 1HAHH 1FIZA 4Y6DA 3MHWU 3GY4A 3K6YA 1ACBE 4ASUD 5DPAA 3RXEA 4X8TH 4CRAA 1IQMA 2ZGBH 4X8SH 2FEQH 3QGJA 4CR9A 1Y5UT 5LPEA 3KN2A 5C1UA 1F2SE 1SSXA 4NIVA 2ZHFH 2CN0H 3SZEA 3WW7A 2VIQA 1ESBA 1O36A 1Q31A 2KX4A 4I8LA 2VBCA 1TABE 1KYNA 1O5EH 3AK5A 4FUBA 1BTZA 3OAAD 7GCHF 1YPEH 2UWLA 1TNIA 2FLBH 3B23B 1IQLA 2H9TH 3S9AA 4ABFA 1SPJA 5TJXA 3UR6A 3PRDA 4Q63A 3BIUH 1C5RA 4LXBH 4Y11E 4Z0KA 2R3UA 5BRRE 1O32A 1N8OC 4AYVB 4DG4A 2B5TB 3F0PA 1HAPH 2GT7A 3PV5A 3NPSA 3SU5A 2OUAA 2B0FA 3SZNA 1FUJA 1ZJKA 1YWUA 3SV2H 2AHME 1C1RA 1C1OA 1GBBA 1GHXH 1O2YA 3SBKA 3F3BA 5ABWA 4NCYA 3GCTF 4FUCA 4HTCH 1SFQB 1TALA 1BTHH 1QHRB 3EE7A 2ZWLH 5E2PA 1WV7H 4B75A 1EPTA 4K8YA 4Q7ZA 1B0FA 2BY6X 3UQOA 1HCGA 1K1OA 1AO5A 3UNSA 5E0JA 1AWHB 1GI2A 1O2GH 3ZVGA 4VGCC 1G9IE 4TWYA 4I33A 1E38B 1C5UA 2RCEA 3BSQA 3T25A 1O3IA 1AMHA 1ELEE 3RXOA 4CRGA 4FUIA 3ZZ8A 2Z6BD 3TH2H 2H5DA 1UTNA 1EJNA 3ZVCA 1QBVH 3H7OA 3QN7A 4Q80A 1INCA 4B73A 2ZCLP 3GY8A 4WWYA 2ULLA 4AG2A 4FVBA 1F92A 1SGFG 1TNKA 2GMTB 1UVOA 1EPTC 2Y7XA 2YMSB 2QN5T 4XSKU 1AGJA 3SJKA 2A32A 3PLPA 4X6NA 1C4Y2 2OQUA 2XBWA 1PQ5A 2SGQE 4CR5A 2BDHA 3ZZAA 2DUCA 3P8GA 2QV1A 3SI3H 5F8XA 3M5NA 1AVWA 2IJOB 4RT1A 2H2ZA 3RXAA 4I86A 2NU1E 5E8EH 5C2ZA 2ZFSA 1VCWA 4X2VA 3RMMH 1K9OE 1V2KT 4IC6A 4Y8YA 5J4SA 2BD8A 2KAIB 1XUKA 1V2PT 4UFEH 1YF4A 1RS0A 3BTHE 1D4PB 1C2HA 1SOZA 1WTGH 3M36A 4ABIA 2JIZD 3I77A 2QYIA 1GBIA 3F68H 1H1BA 5EJLA 2WPIS 1EP5A 1F5RA 5J4QA 1ZRKA 1O2HA 1XVOA 3U28C 3SU6A 3UR9A 1UMAH 2GD4B 2HNTF 3N7DA 4UD9H 3BTQE 4DW2U 1A0LA 1A0HB 1P2KA 1T32A 1LDTT 4FETA 3BN9A 2F3CE 2FWWA 2JJ1D 2P3UB 3VXFH 2YMSD 2CGAA 1JIRA 4IMZA 1SGDE 2Q6GA 4AX9H 4MDSA 1GPZA 4KGAA 1W0YH 5HIYA 4X6MA 2H1UA 1HAZB 1PPEE 3QLPH 1UHBB 2BXTH 3A8CA 4GHQA 4MPUA 1S0QA 2H9EH 1FJSA 2A2QH 2KCPA 3ZVBA 6CHAC 4ISHH 4VGCB 3K2UA 1O0DH 1MTSA 1S0RA 1ZPZA 5EJZA 1P03A 1QBNA 1DT2A 3R3GB 1GMCG 1CGJE 2ZGXH 2OC0A 2IN2A 2V6NA 1H8ED 4X6PA 1MZDA 1QA0A 4YO9A 2GV7A 1SFIA 3KEEA 3MNBA 1IHTH 1GGDC 3MU5A 1TX8A 2GCHG 4M7GA 4ZKOU 1K1MA 2W26A 2OQ5A 1OYQA 1ELBA 1XUFA 1OP2A 5KEDA 3RDZA 1Z71A 4KTCA 1NFUA 1L4DA 1NRSH 3FP6E 1TB6H 2HLCA 2BLOA 4RKOB 1GI7B 3FAOA 1QZ8A 1BBRK 3E6PH 2FO9A 2UUJB 1Z6EA 5IK2D 5CHAC 1AZZA 1BTWA 2GX4A 1HAGE 1ZSLA 1SGIB 3E16B 2RFKC 1DICA 1TPOA 4TWWA 1T7CA 1KXAA 1VGCC 1T4VH 2G8TA 2BDBA 2SFAA 1ELTA 4J2YB 4H6TA 3HK6B 1P04A 2ZQ2A 1Q2WA 2PLXA 1Y3VA 1DLEA 3PROA 1SGTA 2R2WU 2ZEBA 4MG3A 4B2CA 4AOQA 1V6DA 5I25A 1ELGA 4BAKB 4GHTA 1F5LA 2QC2A 3E3TA 1BRBE 2P59A 1ESAA 3MTYA 2FLRH 1ETTH 2AGEX 2GZ9A 3GYMA 5DP5A 2ODYB 2J92A 1F0UA 5EW1H 1D9IA 1A7SA 1O5BB 1GBAA 1O3PB 2RA0A 4IBLH 4FU9A 1MH0A 2FOFA 1PYTD 1DUEA 1DSTA 5TCAA 1LKAA 2VGCC 2GDEH 1HLTH 5GNDA 3NWUA 1GJDB 4HG6A 1UVSH 1GBDA 1PQ8A 1Y5BT 4AGJA 1OPHB 1YP9A 1MTWA 4E7NA 1LPZB 2ZU3A 1C5XB 4NA8A 5EQQA 4AORA 4OS2A 1PFXC 1OXGA 1NRQH 2AIPA 1UK3A 5A2MH 1MZAA 1CA0B 1QL7A 1SHHB 3ZZ9A 2PW8H 5JB8S 2DE9A 1DXWA 3E0PB 1OWIA 3UY9A 4MVNA 1O33A 2Y7ZA 3A86A 2Y80A 1MQ6A 5DO4H 1JXPA 2BOHB 2ESTE 4RN6A 2WPMS 4A6LA 5AFYH 1FAXA 1SGYE 4ABDA 1O5DH 4DT7B 4ZCNA 2JH5D 1ZPBA 1QQ4A 1GHWH 1TNHA 3TH4H 1AUJA 2PGBB 3F9EA 3ZZ4A 2TGTA 1D6WA 2XWBI 3E91A 4YTAA 1UTPA 2LP6A 3UB0A 3UOUA 3VB4A 2BVXH 1K1LA 1J9CH 1QFKH 3KQBA 4BNRA 1V2ST 2FM2A 4HZHA 4YOJA 1YKTA 1ZTLA 2XBYA 6GCHF 4KTUA 3RXKA 2V0BA 4TSFD 3T27A 3TJNA 1C4U2 1MKXK 4P00A 1UTKA 5L6NH 1BTUA 1A5HA 2ANYA 1C5LH 2PUXB 1CSOE 2D2DA 3EAJA 4U30A 1AKSA 5PTPA 3RXMA 2XOKD 4LZ4B 3LH3A 1CGHA 3UWIA 1V2OT 4DIHH 1O3NA 1DWCH 2ZDKA 3RXIA 2M5TA 1GI1A 1DPOA 1O3FA 1G2MA 3ATKA 3ZYDA 4OS4A 2J5UA 2QF0A 2OBOA 5EW2H 1JIMA 3KYGA 1EZQA 2CMYA 2YNBA 3FZDA 5HKKD 3UNRA 1T8LA 2C8XB 2BD3A 3HPTB 3SQHE 3SGQE 1P06A 2ZI2H 1F5KU 1QBOA 2JH0D 4WJG2 2GVFA 3BTDE 4ZROA 1MCVA 1UVUH 3TNTA 2FOGA 3OU0A 5JPMH 3P70B 2A5IA 2C4FH 2ZPQA 2AMQA 8GCHF 3U8TH 1QY6A 2QIQA 1EASA 1AU8A 2PFEA 3FFGA 3TK6A 5HM2A 2R0LA 1MKXH 1G3BA 1O34A 1G3CA 4MPWA 1CT0E 3PV4A 4ABAA 4UEHH 1NBMD 5DK1A 1Z1IA 3SGBE 3O8BA 3LDXH 3TNSA 1GG6C 3DUXH 3PTNA 2JETB 1EOJA 3EYDA 1P05A 1UHBA 2QAAA 4Y0YE 1DWBH 3LKWA 5AVDA 3NZIA 2TIOA 1XUIA 3ZZDA 1L0ZA 2QF3A 1QURH 1YLDA 1P2NA 1EB2A 2A7JA 1F0RA 1SQOA 3FVFB 3TIUA 1IQKA 2V3MA 4XFQA 1FY5A 4YOGA 1Y8TA 2VIDA 2ZHQH 1Y3UA 1DS2E 1BIOA 3RM0H 1BDAA 1LHCH 5KGOA 3RXQA 4UE7H 3MQKC 2OTVA 2FMJA 1Z8IB 4WY3A 2KM0A 1UTJA 3A8BA 3G01A 4OS1A 2CF9H 2RDLA 1N6XA 3VB7A 3FP8E 2IPHA 2ZG0H 1J16A 2FX4A 3EA9A 1W0JD 1QB9A 4UONA 3KYFA 2ODQA 5E0GA 1MBMA 2J9NA 1FONA 1K28D 5ESBA 1BMMH 1BTPA 1DLKB 3PTBA 4Q2KA 5HGGA 2VWNA 4GVUA 1LTOA 1V2QT 2ZDMA 4TPYA 1V2LT 4YT6H 2SGEE 1EZXC 1CHOG 2C8ZB 1KDQB 1YCPH 3M5MA 1NFYA 3TVJB 1AE5A 2QXIA 3NRLA 2QXHA 1GBTA 2NU2E 1A46H 3UWJH 3ZVFA 1O2XA 2TRMA 3W1EA 1AUTC 3MFJA 4I8GA 4AC9A 1MAYA 1GCDA 2VIOA 1O3DA 5E0HA 1V2RT 4ZUHA 1RTLA 3I78A 3F9HA 2P3FH 3HKIB 4B2AA 1QRWA 2FTMA 4ISNA 2AH4X 1KXEA 3TU7H 3BV9B 4AG1A 1S6FA 1ANCA 1C5WB 1OKXA 3AW1A 1HAOH 1H9IE 1HGTH 1IQEA 1H8IH 1NRNH 1O2OA 2BZAA 3KIDU 4LK4A 3TJOA 4WH6A 1T31A 1WAYB 1P2JA 3NCLA 3BTWE 4ASHA 4BOHA 1DM4B 3AAUA 1MTVA 3RXDA 3TGIE 1GDUA 5L2ZH 1C1VH 2PV9B 1SQTA 4E7RG 2FS9A 1C5ZB 1ETRH 3WWBA 2G5NA 4K8BA 1UTQA 3S9BA 3GY6A 5G4BA 1D3QB 1Z8JB 3IG6B 1YGCH 3D65E 3RC4A 2YMSC 3SU0A 4Z1MD 5C0TA 2OC7A 3BIVH 3ITIA 5T1VA 5AHGH 5JBTA 1MTNB 3KQDA 2ZFTA 3DCLA 3TJVA 1AY6H 3OEED 1GL0E 1IQGA 1TYNA 2PKAA 1B0EA 2G5VA 2A5AA 1FV9A 3O8RA 3F9GA 3BTFE 1XKBC 4AN7A 3OX7U 1WUNH 1E0FD 1ID5H 2CHAB 1S5SA 4RKJB 4YESB 1Q3XA 2AERH 3F9FA 3GCTG 1MU6B 3OE7D 3QGNB 3BTGE 2ZIQH 1TNLA 3STIA 1IQNA 3RUOA 1P2MA 2BXUH 2VVUA 1HXFH 1SQRA 2AIQA 3M3TA 2WPKS 2J34A 3FKSD 4XOJA 1ZLRA 2BD9A 3V13A 3UREA 3URCA 2P8OC 1WDIA 1TIOA 1EPTB 1UK2A 1KXFA 2BD2A 2ANWA 1ZJDA 2PGQB 1H4WA 1KXDA 2ZHEH 3IITA 2V3OH 1CT4E 4INHA 3OY6U 1C5YB 1L2EA 1C1WH 3P17H 3PMAB 1CO7E 3HK3B 4I31A 3SUDA 1LVOA 3RXHA 3HGNA 4AFQA 1TNGA 1W11U 1FY4A 1WSSH 2QF5A 2BY5X 3A82A 1VITH 3BTEE 2A4OA 1FPCH 5FL7D 1ZZZA 1BHXF 3RXTA 2Y6TA 4Y71A 1CA8B 3ATIA 3NK8A 3QO6A 2SGAA 2PR3A 3DSOA 4Y76A 2A2XH 5KECA 3F2FA 2SGPE 3S9CA 1RIWB 4QT8C 3PM3A 4DIIH 2EY4C 1XKAC 1XX9A 2W6JD 1TBRH 4HI3A 1ARCA 1CQQA 2ZQ1A 4R0IA 5FX6A 2BQ6B 2HLDD 1OSSA 1TGSZ 1LHEH 2VVVA 6CHAB 5F03A 2HVYB 3ZVDA 2VGCB 3SUFA 3ZZ3A 1ZOMA 3A8AA 1VKYA 2OLGA 3S0NA 3LU9B 1P57B 5JYIA 1GBLA 2ALPA 4FU8A 3UFAA 1MKWK 1EOLA 1NESE 2BMGB 2VIWA 2ZNKH 3SNAA 3CENA 3ODDA 1SLUB 1GI0A 4R8TB 1P2OA 2FIRH 5DSFA 4PROA 1CBWB 3MI4A 2FS8A 1K0HA 3N7OA 3BF6H 1MTNC 3DSGA 3QX5H 1WTHD 3LGWA 2XCNA 3SUEA 2VWMA 1MU8B 3MU8A 2W7SA 3RXRA 1YLNA 2OC1A 5CMXH 2D1JA 4K5ZA 4BTIB 4MNWA 1QJ1B 2AMDA 3LGUA 1HNEE 1P11E 3ZYEA 2ASUB 4B6EA 1O2LA 3PWBA 1QJ6B 4DVAU 3Q3XA 5ETXA 5A0CA 4JYUH 1EXFA 2F9UA 4X1RU 1HDTH 3OTPA 1MD8A 1NT1A 2R9PA 2O8LA 1ELFA 4WF8A 4ZMAH 3GDVA 2SNVA 4INKA 4GCHF 3RU4D 1B7XB 3MH6A 4ESTE 1GHVH 2FYRA 3Q77A 1AB9B 1NBME 4F55A 4P02A 1CHOF 1BRCE 3A7VA 3EDXB 3ZZBA 1Y59T 5E2OA 1DY9A 1P2IA 1AFEH 2J98A 2VINA 1P01A 1EUFA 3VB3A 3SV7A 2FXRA 4NGAH 1KLIH 2F9OA 2FOHA 4YXWD 4X8UH 2VVCA 1DWEH 4A92A 5LPFA 1PPFE 1C9PA 1G3EA 1OX1A 4O3UA 3RC6A 2HVXA 1K1IA 2P16A 3OFND 1GI5A 1GVLA 3NXPA 2HPQH 5HM9A 2VWLA 1O39A 3HGPA 4U32A 2GZ8A 3D23A 3H09A 4OM9A 2ZU1A 4X2XA 1SBWA 4GPGA 1EJMA 1O3JA 1SG8B 1SOTA 4E05H 2WPJS 2FPZA 1EP6A 5K7RA 1A61H 4B1TA 1ZHMA 2BB4A 1HIAA 5A09A 2AEIH 2FESH 1ELCA 2ZFPH 1EJAA 2BLWA 2J4IA 5IYTA 1EAWA 2BY9X 2SNWA 1A0JA 3IWMA 4TY7A 1TMTH 1SLWB 1TRNA 3MH7A 1P0SH 4ZKRU 2NU0E 4I7YH 1O2VA 5DP8A 1AE8H 1JMOH 2OCVB 1S6LA 1TBQH 2K1QA 3H5CB 1Y5AT 4F4OC 4GSOA 4X2YA 5DP7A 1TAWA 3P92A 2OINA 5EGMA 1AWFH 2H6MA 2A4RA 2YOLA 3N99A 3GCHC 1ZMLA 5GIBA 4K1EA 1LHDH 3GOVB 5AFZH 3MO9A 4XD7D 1BTYA 1GI6A 1LO6A 1ZSKA 1NY22 3TPIZ 2QGRA 3ZV8A 1FLEE 3KGPA 1BBRE 3TGKE 1RFNA 1SGFA 2DE8A 1Z8GA 3SI4H 1OS8A 1F7ZA 2ZDLA 2GV6A 7ESTE 1AB9C 2F9BH 4FUHA 2Q1JA 3VFEA 1VJAU 4O9VA 2Z9LA 2VB0A 4RSPA 3SV6A 1WYKA 1YC0A 3ATLA 3U98H 4BAHB 3O8CA 3U9AH 3Q76A 5JBBS 1NROH 4RI0A 1CA0C 3SV8A 1RD3B 3KL6A 1E35B 1C5VA 2FX6A 1IQFA 1GMDF 3QZQA 1TPAE 4XBDA 1RRKA 5FHTA 4OS5A 5TCCA 4X1QU 1NU9A 1B5GH 3KNXA 1VCQA 2HPPH 1O2WA 2I6QA 2F4LA 1GI3A 1ABIH 4GCHG 1O2MA 4WMFA 6LPRA 1PPZA 3LGIA 2J97A 1NTPA 1ZYOA 2ZU2A 2A7CA 1C5PA 1TNJA 4Q7YA 1SMFE 4A5TS 4HGCA 3LT3A 3SORA 1MBQA 4CBNA 5C0UA 2QXGA 1IQHA 3H7TA 2ZDNA 5GWZA 3SJIA 3GCOA 3M3VA 3U8OH 3SQEE 5FCKA 5LH8A 1S84A 1YPGH 1EZSC 5K0HA 2OD3B 2PP6A 5A0AE 4BXWA 1OHHD 1DY8A 1BJVA 2VWOA 4BTUB 1SI5H 2I6SA 1MCTA 4DT4A 4INLA 4ACBA 4DURA 3GYLB 3SJ8A 2L74A 1EZUC 1ZSJA 1T4UH 4YM9A 4Y0ZE 1RJXB 2FI4E 2KFWA 5FPSA 1CVWH 1JBUH 4YOIA 4B6FA 3PLBA 3GY7A 3NKKA 4K69A 3TITA 1DX5M 1WQVH 2ZA5A 1H8HD 5EG4A 5HMAA 1C5OH 2VU8E 1FIWA 1AI8H 4I8JA 1O2UA 1LKBA 2BLVA 1O5FH 3GCHB 5FCRA 3SN8A 2Z3CA 3M7UA 4K2YA 3GDSA 2ZPRA 2ZP0H 3A7ZA 3MOCA 3VG8A 1XXDA 2PKSC 7KMEH 1LHGH 2KCAA 3BTTE 3FP7E 1G36A 1G30B 1HAVB 1O37A 3LOXA 1IAUA 4JZEH 3RP2A 5EPYA 4U01A 2BX4A 2BY8X 2IOTA 3MNXA 4TYDA 4JYVH 1TWXB 2ZDAH 5EXLA 4RT0A 1GHBG 1P2QA 1TE0A 3A83A 3ZZCA 7LPRA 3QDZB 3HKJB 3P8FA 1AD8H 3DT0H 2QF4A 1ANEA 4AFSA 1O2PA 1TA6A 2BVRH 3L6PA 3M7QA 1A2CH 4FVDA 3MU1A 1W2KH 3A88A 2C93B 3A7TA 3Q00A 4A7IB 2PSXA 1GBFA 4K1TA 1P10A 3NUMA 2B9LA 1UO6A 3B9FH 1YLCA 2UUYA 3D62A 3K9XB 1G2LA 4CH8B 2PKSB 1AKSB 3PRBA 1UVTH 1G37A 1FQ3A 1K1PA 2F43B 1WXRA 6ESTA 1SB1H 2R0KA 1UVPA 3T2NA 1MD7A 2K0QA 1TMUH 1ZR0A 1THSH 1S82A 3AVZA 1UJ1A 2BHGA 1O2RA 1ZHPA 3KQCA 1WOFA 3RXBA 5ESTE 1FDPA 1UCYE 4IW4E 4ZAEA 2A5KA 1BHXB 2FODA 3KQEA 1GJ8B 1O3LA 1C2JA 2Y5GA 1S85A 1FY1A 2O8WA 1ANDA 5EXMA 2PTCE 1O3GA 1GJ4H 5F8ZA 2Q6FA 3RXLA 1O3KA 4UFFH 5BPEA 1SLVB 4B74A 3UQVA 4NIWA 1BZXE 4AZ2B 1T8NA 4BAQB 9ESTA 4IN1A 3UNQA 5HIZA 1U6QA 2BYAX 3CNRA 3RXFA 1FZZA 4FXGH 4LOYH 3O8DA 1S81A 2Z3EA 5EJ1A 1ARBA 1SGCA 2FDAA 5DP9A 2GT8A 2NU3E 1E1RD 1P02A 1GJBB 3CS7A 5EQSA 1C1PA 3MNCA 3A84A 3RXSA 1NZQH 2B7DH 2VNTA 2CXVA 2NWNA 1G32B 2Z9IA 1RGQA 2WSSD 2Y81A 2XWAA 4FUDA 1O3BA 3U1JB 4Y79A 4FOUC 2ZHWH 2ZC9H 1V2JT 3BG4B 4X1PU 4TY6A 3K6ZA 1ELVA 2A0QB 4KTSA 1SC8U 4BANB 1C5SA 5JBAS 1LPGB 2WV5A 3M5LA 1F0TA 1KLJH 1TMBH 1ESTA 3M3SA 2SGDE 1L4ZA 3A87A 4ZHMU 1G3DA 3MU0A 1Y3YA 1GBKA 1GVZA 4TPIZ 1OWJA 5FPTA 1H9HE 1W7GH 1P3EA 3LPRA 4XBCA 3MWIU 1C5NH 2HOBA 1LQDB 2UWPA 5FXLA 2XC0A 1GGDB 1ZPCA 1QCPA 1O2IA 2BD5A 4YLQH 1GBMA 2O8TA 1AZ8A 1EKBB 2HNTC 2FYQA 3T62A 2CV3A 1GBCA 3L33A 1C1MA 2R2MB 3M37A 1RTKA 4XE4A 2Z9KA 5H4IB 2V35A 3VEQB 1THPB 1C4V2 4JK6A 2QCYA 5C94A 2WZQA 3GS9A 1GMHG 5HYOA 4CHAB 1IOEA 1OYTH 1UK4A 1YPJH 1MMJN 1PPCE 2QA9E 1VGCB 1CHGA 3SNEA 1TGBA 2O9QA 1TRMA 2KZ4A 1ZGVA 1DE7H 1E36B 1X7AC 4NIYA 2PTNA 5DP3A 1NM6A 4CRBA 2FP7B 3I29A 1OWDA 2A1DB 5C20A 1NC6A 1QGFA 1ZGIA 1OWHA 2SGFE 4B76A 1BUIA 2BDIA 2ZTZA 1KTSB 2G52A 2YNAA 3SJOA 3FANA 2NU4E 2WHXA 1FNIA 4BAOB 3SOSA 5T6DA 1SHYA 3DFLA 1YPKH 3WWFA 1MQ5A 5CHAB 3F2GA 3VB6A 2P93A 1YPHE 4GUXA 4IS5A 1E79D 3RU4E 3BEIB 4ZKNU 4KELA 3SNCA 2HGTH 1Y3WA 1XVMA 1KMHB 5JB9S 2W3KA 3BTKE 1D3DB 5FBEA 2F9VA 1CE5A 1KSNA 1P8VC 2FOBA 4WXVA 1HPGA 4ZKSU 4F48B 1DXPA 1SGEE 3SYJA 3EGKH 1BCUH 4A1XA 5LGOA 2EA3A 3PO1B 1YY3A 1A3EH 1HBTH 5T3HA 1LMWB 1PPGE 1Z6JH 8GCHG 3BG4C 1TFXA 1W3CA 3SHAH 3U8RH 1XXFA 1QA7A 1FX0B 5L30H 1YPLH 1W10U 1CU1A 3ENSB 1GHAF 2P3TB 1KXCA 4MPXA 3TGJE 1MABB 1ANBA 1V2TT 4JZFH 5C3NA 5DP4A 2ZFFH 1SKYE 4NFEA 1TX7A 3DFJA 1FPHH 2A4QA 3OYPA 4MNYA 4NIXA 3RXGA 2FTLE 4A1VA 4ABJA 3A7WA 2B8OH 3ZIAD 3RMNH 1L1GA 1NN6A 1FMGA 3DD2H 1N1LA 1VJ9U 5DGJA 4D8NA 1C2MA 4AFUA 2AFQB 5EU8A 2XW9A 3F2HA 4H42U 1THRH 4XRNA 1AVGH 1AHTH 1V2UT 1EX3A 1C5QA 1TA2A 1TGNA 3DHKH 4YT7H 1GJCB 1SGQE 2H9HA 2WUCA 1M9UA 4WMDA 1O2QA 1J8AA 3W95A 4XDEA 4M9FA 5FPYA 3FO8D 1RTFB 3LIWA 3P8NA 2W5EA 2ZO3H 3FZZA 3QZRA 5L2YH 5FAHA 1TRYA 1BMNH 3SNDA 1FAKH 3ZVAA 1TONA 1W14U 1KIGH 1O31A 4UDWH 2EI8A 1UCYK 4MNVA 4ABHA 1W0ZU 1UCYH 3PO1C 4X0WU 3VPKA 3S69A 3GY2A 3CP7A 1ZMNA 1L1NA 1H8DH 2AMPA 2EI6A 4H6SB 2XBVA 2PWXA 4K3JA 3EE0B 3SU2A 2Z9JA 5DKMA 3M61U 3FN8A 4MQAA 5JDUB 2JKHA 4U2WA 1IQJA 1TX6A 4CHAC 8KME2 2ZCKP 1SL3A 1DDJA 2J95A 3SU4A 2G4TA 1DOJA 1KY9A 1PQAA 3RMOH 1OWEA 4Y7BA 5DN6D 2UWOA 4DJZB 1KTTB 1V3XA 5F53A 1KXBA 2CJIA 2FOEA 1HAXB 2GGVB 1P12E 1EQ9A 2JH6D 1QQUA 4NFFA 4NA9H 1QB1A 2ZGHA 4MTBA 1C5TA 4AB9A 1UW7A 4AFZA 3RXJA 3MO6A 1O30A 4JZ1A 1MAXA 5AF9H 2TGPZ 4WVPE 4FUEA 4CRFA 4JMYA 1C1TA 3JZ2B 3BEUA 1BMFD 1GL1A 3M7TA 4JZDH 3SO3A 4CRCA 1RIWC 2BLQA 2XC4A 1F0SA 3FOAA 1TGCA 5CE1A 4DCDA 3ATWA 1TQ7B 3L3TA 2OBQA 4AYYB 1TQ0B 2C8WB 4NSVA 1QIXB 4WH8A 3SGAE 3R0FA 1FI8A 1K1NA 4ISOA 1BJUA 2GP9B 2XYAA 4J1YA 3T29A 1GWAA 1JRSA 3WY8A 1OOKB 3MYWA 5DG6A 2WYGA 3V3MA 3A89A 2ZHDA 3MNSA 4JK5A 1PYTC 4FU7A 2ZTYA 4KKDA 2J98B 2AS9A 4LZ1H 1YBWA
chains in the Genus database with same CATH topology
2V3HH 3S7HB 1GG6B 1V2WT 4NWKA 4X6OA 1ABJH 3ZZ6A 2G51A 1P9UA 2BTCE 3T28A 1HV7A 1YCPM 2ZF0H 4DOQA 5C1XA 4B2BA 1A5IA 1O3CA 1VITG 2D8WA 1O35A 1O38A 4O97A 3M5OA 3MU4A 1C2FA 1O2ZA 1O3OA 3GDUA 1HAYB 3HATH 3TJUA 1LPKB 1D3PB 3BEFB 1W12U 5EODA 1XUHA 2XNIA 2AYWA 1FY8E 2FI3E 1GHAG 1O5CB 3SU1A 1TBZH 5GCHG 3W94A 1EATA 2JETC 1SVPA 1LVBA 4H4FA 1C2LA 1KDQA 2BVSH 1IHSH 1T8MA 2C3SA 2G4UA 1HUTH 1JWTA 4I8HA 1GJ5H 1QRXA 2C90B 4NZLA 2FOMB 1YPHC 2GMTC 3QTVH 4X2WA 4BXSA 3RLWH 1O2KA 5DP6A 4THNH 1GBHA 4K60A 2Z94A 2FOCA 1VR1H 1L1JA 5EOKA 2STBE 1SGNE 5GJ4B 3LC5A 2ALVA 2TGDA 2BM2A 1A5GH 1C2KA 1GMCF 3VB5A 1JOUB 4O3TA 2G00A 2BQWB 1TGTA 1HJ9A 2CF8H 1O2SA 4BAMB 1ELDE 3DA9B 4ZH8A 5EXNA 1H9LB 4UFGH 1O3MA 5T6GA 1ZHRA 4SGBE 4Y10E 1HRTH 1TPSA 4MNXA 1GDQA 1AFQC 5F6MA 1QTFA 3KF2A 5A8ZA 2ZGJA 3S7KB 5I46H 1ETSH 2R3YA 4D9RA 2W3IA 1CGIE 1FN6A 1K22H 3Q3KA 1S83A 3GCNA 1GVKB 1HB0B 2FOAA 4IMQA 1YCPK 5FX5A 1BQYA 3AW0A 1NPMA 3LJJA 1WU1A 3MH5A 1DSUA 1NU7B 2VJ1A 3U1IB 2THFB 2PSYA 4CREA 5C5NA 3V7TA 1NO9H 2WINI 2PKAB 3RXCA 3TK5A 1QJ7B 2EC9H 2ZU5A 8LPRA 1FY3A 1K21H 3V0XA 2Z7FE 3URDA 1HAVA 3UUZA 3PWCA 1LVMA 3C27B 2AGIX 3LGTA 5IDKA 1YYY1 3GISB 3RXUA 2ZGCA 1C1UH 1WCZA 2O8MA 1ELAA 3EA7A 4IN2A 5GXPA 1V2MT 1BTXA 2PUQH 2P94A 2W7UA 1XM1A 2XTTB 3LGVA 1RXPA 3OSYA 2WUBA 4FUJA 5F8TA 1OP8A 2RG3A 2FZZA 1A4WH 1T8OA 3MO3A 2ANKH 1W13U 3A81A 1MTUA 1PPHE 1V2NT 1MKWH 3A80A 3P95A 1QR3E 3SNBA 1TLDA 1N6YA 1HFDA 2ANMH 2ILNA 5LPRA 1N8OB 1E37B 1UTMA 4NWLA 5HXFA 1GJ7B 3P8OA 2F9PA 1HJAC 2BD7A 1MUEB 4NG9H 1QRZA 5EPNA 4GLYA 2GZ7A 4HFPB 5GCHF 1HYLA 2G81E 3VGCB 2ODPA 4NA7A 3JZ1B 3RM2H 1YM0A 4I8KA 1C1NA 1GBEA 2Y5FA 1W8BH 2O8UA 4NZQA 3F1SB 2ZDVH 4OGYA 3UOPA 3TK9A 1XUGA 1IQIA 4FUFA 2VH6A 2CHAC 4OS6A 4ISIH 3AAVA 1VITF 4DGJA 4D76A 1NFWA 5DJ7A 7GCHG 2HNTE 5FBIA 1SQAA 3OY5U 1BBRH 1XMNB 2WPLS 1C5MD 3PMBB 2ZFQH 1DUAA 3QK1A 1GHBF 3CS0A 3RLYH 1HXEH 1W7XH 1NRPH 4O03A 1BOQA 3SUGA 2EI7A 8ESTE 1EB1H 1GI8B 1BITA 4GAWA 1BMAA 2P8OB 1QL8A 5C1YA 1GI4A 1D6RA 5EQRA 3A7XA 1AQ7A 3E1XB 2C8YB 1Z8RA 1FXYA 1AIXH 3Q3YA 1NRRH 4ZXXH 2ZFRH 2P95A 3UIRA 5GDSH 2G55A 4A1TA 2F83A 4K1SA 3LC3A 3LGYA 2A4GA 3SW2B 4CBOA 3MMGA 2GDDA 4JYTA 4IGDA 1XUJA 2TBSA 3E90B 4CH2B 2GKVE 3C1KA 3MH4A 1EAUA 1PJPA 4B71A 3QTOH 1DVAH 4ABGA 1WQSA 2BOKA 1BB0B 1BRAA 1LHFH 6GCHG 3ESTA 3T26A 1KLTA 4F49A 2ZPSA 1C9TA 3RC5A 1CBWC 1O2TA 1GHZA 4IC5A 1HJ8A 2BX3A 1DFPA 3QWCH 3ZV9A 1AN1E 2Y5HA 2OC8A 1O2NA 2H5CA 2A31A 1Z1JA 4WXIA 2ZTXA 2WV4A 3QUMP 1ORFA 4ZHLU 2TPIZ 4SGAE 4D7GA 3B8JA 3TH3H 4X8VH 1QB6A 4Y7AA 3V12A 2ZU4A 4WMEA 1C2GA 5A8YA 9LPRA 1E34B 1SR5C 1BMLA 1HIAB 3A8DA 3PMHB 3PB1E 1P9SA 3P6ZB 1Y3XA 2EEKA 2Z3DA 2LNCA 2UUKB 3BG8A 2Y82A 4ABEA 2WPHS 4OS7A 1QL9A 4Y8XA 5JBCS 5GPIB 3UTUH 2QY0B 2OXSA 1GCTB 5A0BA 2Q6DA 4ISLA 3SHCH 3ZVEA 1GCTC 4YLUA 1FN8A 3ODFA 3PLKA 1ZRBA 1OWKA 2F91A 1EAXA 2F9NA 3E8LA 3STJA 2HALA 3ZZ5A 3GY5A 4ZHAA 1QNJA 1SLXB 4FUGA 4X1NU 2XCFA 1C2EA 1GMDG 3GICB 3LH1A 5SGAE 1GBJA 4XBBA 2BD4A 3KCGH 1EAIA 2BDYA 4I32A 1BT7A 3AASA 3EQ0H 3EA8A 1A1RA 1YPMH 1O3AA 3A7YA 1C2IA 1K1JA 2VH0A 1UTLM 1BRUP 4YZUA 4JZIA 2A7HA 2VIVA 4Y8ZA 1C1QA 1LQEA 4BTTB 2VIPA 3KHVA 1AVXA 1D3TB 2Z9GA 3RU4T 1J14A 3F6UH 1VCPA 4Z6AH 2HRVA 3A85A 3ZZ7A 3SV9A 2HWLB 1OP0A 3TLOA 1A3BH 4DY7B 1CT2E 2KAIA 1P3CA 2GCTB 1HJAB 1Z7KA 1C2DA 2GTBA 2UUFB 1GJAB 2GCTC 4OGXA 2STAE 1DITH 2BQ7B 1NFXA 2GCHF 2D26C 1GJ6A 3K65B 1WBGB 3VGCC 3RMLH 1O2JA 2QXJA 5B6OA 1J15A 1DANH 1VZQH 3SU3A 4ZXYH 1C1SA 1J17T 1DWDH 2ZECA 1LCYA 3ELAH 2WYJA 1HAIH 1O5AB 1S6HA 4AGKA 1O3HA 3GY3A 3PMJA 2ZCHP 4MLFB 3LONA 2FI5E 2LPRA 2ZZUH 2XBXA 2XRCA 1ZTKA 3PYHA 3RXVA 3U69H 2PHBA 4X1SU 1LVYA 2BZ6H 2OP9A 1TOCB 3UPEA 2J94A 5T6FA 1O5GH 1PPBH 1ZMJA 1GDNA 3T5FH 1SGRE 5A8XA 1GMHF 1NS3A 1TOMH 2TGAA 4Q7XA 1AFQB 2A45B 3E0NB 5C67A 2XXLA 1GHYH 2AGGX 2J2UA 1P09A 4JCNA 2BY7X 3VXEH 2J38A 4E06H 4D9QA 3BTME 4MPVA 4AB8A 1GI9B 1TPPA 1JRTA 1V2VT 2BDAA 3LJOA 2BDGA 1K2I1 2BDCA 4CRDA 3ATMA 1ZTJA 3M35A 2XC5A 1SGPE 2ZKSA 5C5OA 3OTJE 4D7FA 1O3EA 4UFDH 3RXPA 2RA3A 1PQ7A 3D49H 3SJ9A 1GJ9B 4NSYA 1UTOA 1BA8B 4ABBA 4KP0A 1HAHH 1FIZA 4Y6DA 3MHWU 3GY4A 3K6YA 1ACBE 5DPAA 3RXEA 4X8TH 4CRAA 1IQMA 2ZGBH 4X8SH 2FEQH 3QGJA 4CR9A 1Y5UT 5LPEA 3KN2A 5C1UA 1F2SE 1SSXA 4NIVA 2ZHFH 2CN0H 2VIQA 1ESBA 1O36A 1Q31A 4I8LA 1TABE 1KYNA 1O5EH 4FUBA 1BTZA 7GCHF 1YPEH 2UWLA 1TNIA 2FLBH 3B23B 1IQLA 2H9TH 3S9AA 4ABFA 1SPJA 5TJXA 3UR6A 3BIUH 1C5RA 4LXBH 4Y11E 4Z0KA 2R3UA 5BRRE 1O32A 1N8OC 4AYVB 4DG4A 2B5TB 1HAPH 2GT7A 3NPSA 3SU5A 2OUAA 2B0FA 3SZNA 1FUJA 1ZJKA 3SV2H 1C1RA 1C1OA 1GBBA 1GHXH 1O2YA 3SBKA 5ABWA 4NCYA 3GCTF 4FUCA 4HTCH 1SFQB 1TALA 1BTHH 1QHRB 5E2PA 2ZWLH 1WV7H 4B75A 1EPTA 4K8YA 4Q7ZA 1B0FA 2BY6X 3UQOA 1HCGA 1K1OA 1AO5A 3UNSA 5E0JA 1AWHB 1GI2A 1O2GH 3ZVGA 4VGCC 1G9IE 4TWYA 4I33A 1E38B 1C5UA 2RCEA 3BSQA 3T25A 1O3IA 1AMHA 1ELEE 3RXOA 4CRGA 4FUIA 3ZZ8A 2Z6BD 3TH2H 2H5DA 1UTNA 1EJNA 3ZVCA 1QBVH 3H7OA 3QN7A 4Q80A 1INCA 4B73A 2ZCLP 3GY8A 4WWYA 2ULLA 4AG2A 4FVBA 1F92A 1SGFG 1TNKA 2GMTB 1UVOA 1EPTC 2Y7XA 2QN5T 4XSKU 1AGJA 3SJKA 2A32A 3PLPA 4X6NA 1C4Y2 2OQUA 2XBWA 1PQ5A 2SGQE 4CR5A 2BDHA 3ZZAA 2DUCA 3P8GA 2QV1A 3SI3H 5F8XA 3M5NA 1AVWA 2IJOB 2H2ZA 3RXAA 2NU1E 5E8EH 5C2ZA 2ZFSA 1VCWA 4X2VA 3RMMH 1K9OE 1V2KT 4IC6A 4Y8YA 5J4SA 2BD8A 2KAIB 1XUKA 1V2PT 4UFEH 1YF4A 1RS0A 3BTHE 1D4PB 1C2HA 1SOZA 1WTGH 3M36A 4ABIA 3I77A 2QYIA 1GBIA 3F68H 1H1BA 2WPIS 1EP5A 1F5RA 5J4QA 1ZRKA 1O2HA 1XVOA 3SU6A 3UR9A 1UMAH 2GD4B 2HNTF 4UD9H 3BTQE 4DW2U 1A0LA 1A0HB 1P2KA 1T32A 1LDTT 3BN9A 2F3CE 2FWWA 2P3UB 3VXFH 2CGAA 1JIRA 4IMZA 1SGDE 2Q6GA 4AX9H 4MDSA 1GPZA 4KGAA 1W0YH 4X6MA 2H1UA 1HAZB 1PPEE 3QLPH 1UHBB 2BXTH 3A8CA 4GHQA 4MPUA 1S0QA 2H9EH 1FJSA 2A2QH 3ZVBA 6CHAC 4ISHH 4VGCB 3K2UA 1O0DH 1MTSA 1S0RA 1ZPZA 1P03A 1QBNA 1DT2A 3R3GB 1GMCG 1CGJE 2ZGXH 2OC0A 2IN2A 2V6NA 4X6PA 1MZDA 1QA0A 4YO9A 2GV7A 1SFIA 3KEEA 3MNBA 1IHTH 1GGDC 3MU5A 1TX8A 2GCHG 4M7GA 4ZKOU 1K1MA 2W26A 2OQ5A 1OYQA 1ELBA 1XUFA 1OP2A 3RDZA 1Z71A 4KTCA 1NFUA 1L4DA 1NRSH 3FP6E 1TB6H 2HLCA 2BLOA 4RKOB 1GI7B 3FAOA 1BBRK 3E6PH 2FO9A 2UUJB 1Z6EA 5CHAC 1AZZA 1BTWA 2GX4A 1HAGE 1ZSLA 1SGIB 3E16B 1DICA 1TPOA 4TWWA 1T7CA 1KXAA 1VGCC 1T4VH 2G8TA 2BDBA 2SFAA 1ELTA 4J2YB 4H6TA 3HK6B 1P04A 2ZQ2A 1Q2WA 2PLXA 1Y3VA 1DLEA 3PROA 1SGTA 2R2WU 2ZEBA 4MG3A 4B2CA 4AOQA 1V6DA 5I25A 1ELGA 4BAKB 4GHTA 1F5LA 2QC2A 3E3TA 1BRBE 2P59A 1ESAA 3MTYA 2FLRH 1ETTH 2AGEX 2GZ9A 3GYMA 5DP5A 2ODYB 2J92A 1F0UA 5EW1H 1D9IA 1A7SA 1O5BB 1GBAA 1O3PB 2RA0A 4IBLH 4FU9A 1MH0A 2FOFA 1PYTD 1DUEA 1DSTA 5TCAA 1LKAA 2VGCC 2GDEH 1HLTH 3NWUA 1GJDB 1UVSH 1GBDA 1PQ8A 1Y5BT 4AGJA 1OPHB 1YP9A 1MTWA 4E7NA 1LPZB 2ZU3A 1C5XB 4NA8A 5EQQA 4AORA 4OS2A 1PFXC 1OXGA 1NRQH 2AIPA 1UK3A 5A2MH 1MZAA 1CA0B 1QL7A 1SHHB 3ZZ9A 2PW8H 5JB8S 2DE9A 1DXWA 3E0PB 1OWIA 3UY9A 4MVNA 1O33A 2Y7ZA 3A86A 2Y80A 1MQ6A 5DO4H 1JXPA 2BOHB 2ESTE 4RN6A 2WPMS 4A6LA 5AFYH 1FAXA 1SGYE 4ABDA 1O5DH 4DT7B 2JH5D 1ZPBA 1QQ4A 1GHWH 1TNHA 3TH4H 1AUJA 2PGBB 3F9EA 3ZZ4A 2TGTA 1D6WA 2XWBI 3E91A 4YTAA 1UTPA 3UOUA 3VB4A 2BVXH 1K1LA 1J9CH 1QFKH 3KQBA 4BNRA 1V2ST 2FM2A 4HZHA 4YOJA 1YKTA 1ZTLA 2XBYA 6GCHF 4KTUA 3RXKA 2V0BA 3T27A 3TJNA 1C4U2 1MKXK 1UTKA 5L6NH 1BTUA 1A5HA 2ANYA 1C5LH 2PUXB 1CSOE 2D2DA 3EAJA 4U30A 1AKSA 5PTPA 3RXMA 4LZ4B 3LH3A 1CGHA 3UWIA 1V2OT 4DIHH 1O3NA 1DWCH 2ZDKA 3RXIA 2M5TA 1GI1A 1DPOA 1O3FA 1G2MA 3ATKA 3ZYDA 4OS4A 2QF0A 2OBOA 5EW2H 1JIMA 1EZQA 2CMYA 2YNBA 3FZDA 3UNRA 1T8LA 2C8XB 2BD3A 3HPTB 3SQHE 3SGQE 1P06A 2ZI2H 1F5KU 1QBOA 2JH0D 4WJG2 2GVFA 3BTDE 4ZROA 1MCVA 1UVUH 3TNTA 2FOGA 3OU0A 5JPMH 3P70B 2A5IA 2C4FH 2ZPQA 2AMQA 8GCHF 3U8TH 1QY6A 2QIQA 1EASA 1AU8A 2PFEA 3FFGA 3TK6A 5HM2A 2R0LA 1MKXH 1G3BA 1O34A 1G3CA 4MPWA 1CT0E 3PV4A 4ABAA 4UEHH 5DK1A 1Z1IA 3SGBE 3O8BA 3LDXH 3TNSA 1GG6C 3DUXH 3PTNA 2JETB 1EOJA 3EYDA 1P05A 1UHBA 2QAAA 4Y0YE 1DWBH 3LKWA 5AVDA 3NZIA 2TIOA 1XUIA 3ZZDA 1L0ZA 2QF3A 1QURH 1YLDA 1P2NA 1EB2A 2A7JA 1F0RA 1SQOA 3FVFB 3TIUA 1IQKA 4XFQA 1FY5A 4YOGA 1Y8TA 2VIDA 2ZHQH 1Y3UA 1DS2E 1BIOA 3RM0H 1BDAA 1LHCH 3RXQA 4UE7H