3RXCA

Crystal structure of trypsin complexed with 2-aminopyridine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxcA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxcA02
1E38B 3LJOA 2K1QA 5CHAC 4BAKB 1P06A 1DVAH 1GI1A 1GVLA 4DURA 1RJXB 4K60A 1EATA 2A4GA 1O3CA 1QY6A 4WXVA 3U1JB 1YPMH 5EW2H 1FY1A 3FVFB 1GBBA 2GX4A 5AFYH 4RN6A 1SSXA 1BHXB 2FLRH 2ZFRH 3KQBA 5GPIB 5DPAA 1CT4E 2FO9A 3F9GA 4IS5A 4ZMAH 1QRZA 3FAOA 1AB9C 3ELAH 1LO6A 3SI4H 2Y5GA 4NA7A 8LPRA 2ZP0H 5LGOA 3OY5U 5E0GA 1T8OA 2QXJA 1GMDF 3SI3H 3SU1A 4IC5A 2G5NA 2ZGCA 1ZPCA 3U8OH 1MKWH 3RXIA 1HYLA 1BB0B 2XCNA 2J92A 4MNWA 2BDCA 1QIXB 3RMMH 1G32B 1ZRKA 4X0WU 1KXBA 1MZDA 3TVJB 3O8CA 1UTMA 1DE7H 4U2WA 1MMJN 3K6ZA 4ZKSU 2OTVA 5JBCS 2ZWLH 1GI8B 1JRTA 2FMJA 2FOCA 1TNGA 3H7TA 1WBGB 2R3UA 3SN8A 3QUMP 1HAHH 1SGYE 4JZFH 1GHAG 5EODA 2HNTE 1YPHE 1MZAA 3U9AH 1P12E 3L33A 2QXHA 2FOEA 4A1VA 1EASA 1F5RA 1B0FA 4AGKA 1MU8B 3LONA 1EAWA 1BTUA 1FY4A 1GVZA 2R2WU 4RSPA 4MPVA 1S6FA 1B5GH 2HRVA 4ZKNU 4GHQA 1ZOMA 5E0HA 5C67A 2BTCE 2HNTC 2BYAX 3M3SA 2XBWA 4A1XA 4A5TS 3GY3A 3AW1A 4YESB 1A0HB 1ZPZA 2BXUH 3JZ1B 1C4Y2 1HNEE 4FU9A 1PYTC 1NRSH 3SU2A 4K1TA 5EU8A 3MO6A 1S85A 3UPEA 2ZO3H 1F5KU 1O2IA 1S5SA 3MI4A 4X6NA 4GCHF 7GCHG 1UHBA 4E7RG 5GIBA 1LHGH 2ZDMA 5ESBA 2ZDAH 2D8WA 3S0NA 2BD3A 1FZZA 1GJAB 2BZ6H 3RXTA 4NZQA 1F0SA 1H9IE 2A1DB 2BOKA 1GBCA 3M7UA 1DM4B 3MYWA 1FY5A 3PTNA 3VPKA 1C1VH 1GJ7B 3CS0A 4GSOA 4U32A 3GYLB 2CXVA 4CH2B 1TPOA 3BTME 4JZ1A 1HAGE 1THSH 2D1JA 1FIZA 5FCKA 3PB1E 3UNSA 2VIVA 3BSQA 1TA2A 2XWAA 3VXEH 3RXMA 7ESTE 1T8MA 2ZGJA 5EXMA 2SGEE 5L2YH 1BOQA 1SHYA 3A8DA 3E16B 4X1PU 4Y71A 3SV6A 3BEIB 3SJOA 1DICA 3MU4A 3A86A 2ODPA 1K1LA 4CH8B 1PPCE 3A83A 3RM0H 1L4DA 3ZZBA 3GDVA 4E7NA 3T28A 1YC0A 1RIWB 1RTKA 1O3FA 1IQMA 3V13A 1QB1A 3EQ0H 1GBFA 4Q80A 2AIQA 1ARCA 2CHAC 3VGCB 1EXFA 3F9FA 3Q3KA 5HM9A 2FOFA 1AUJA 2ZFPH 3TH3H 4AGJA 1OWIA 1C5YB 1O2OA 1SGDE 2VIOA 2O8LA 3V3MA 1ELGA 3RP2A 3TH4H 2UUJB 1BCUH 2FYQA 1GHAF 1QBOA 3BG4C 5JDUB 4HFPB 1QNJA 5I46H 1O33A 1O37A 4KKDA 1IQIA 2H9TH 1O2PA 1P8VC 1FONA 3QGNB 1ABIH 1UTJA 3A8BA 1BBRH 2O8WA 3RU4D 2BDGA 3BTTE 2HGTH 3UR9A 2AS9A 1GDQA 1SQOA 1MCTA 3M5NA 3PLBA 4DJZB 1EB1H 3S7KB 4AFQA 1DITH 1O32A 2AMPA 4AX9H 1L1JA 2Z3CA 3MOCA 1LVYA 3GISB 1QBNA 4D76A 1P03A 4WMEA 2AGEX 1TBZH 3H5CB 3BIUH 2ZU1A 2OC1A 2A4OA 2ZHWH 4YZUA 4VGCC 9ESTA 3VB7A 1O3MA 3P8NA 1NFXA 1CO7E 3ZVGA 1OKXA 1SG8B 1VITG 2UWOA 1MD7A 1TGNA 7KMEH 1BITA 7GCHF 2V3OH 1TMTH 1OX1A 1KXFA 1Z8IB 4LXBH 3SJIA 3F6UH 5LH8A 1GJ4H 2PLXA 1J8AA 1OS8A 3PYHA 2HVXA 4NSYA 5C1YA 1GGDB 1M9UA 3A7WA 1D9IA 3LJJA 1MTVA 2G4UA 5FXLA 3M37A 1QJ6B 1GI3A 3A85A 1GJBB 1QA0A 4MNXA 1AKSB 1FDPA 4Q7YA 4B74A 4ASHA 1F92A 1GHVH 3UREA 1BTZA 4H6TA 3SUFA 5TJXA 1AZ8A 4ZAEA 1L1GA 1SGRE 1KLIH 1O3JA 2ZFSA 2TGTA 1TGBA 1N6XA 3RXCA 3QO6A 5GXPA 1GJ8B 1RTFB 1O2RA 2C4FH 5GJ4B 3PROA 1J14A 5C20A 4K1SA 1LVOA 4OGYA 1YPKH 2AERH 1QQUA 4Q7ZA 3TK6A 3P6ZB 1GJCB 1EZSC 1O5CB 3LKWA 2HWLB 2ZPQA 2OBQA 2WPHS 1GI4A 2GTBA 1NPMA 1YPJH 4ABGA 3DUXH 1EB2A 4LZ4B 1CHOG 1ZTJA 3FZDA 4NSVA 2VWNA 2QF3A 1AMHA 1ZGIA 3Q76A 1UMAH 1P05A 4OS5A 5L30H 1TABE 3DA9B 1W13U 1GHBF 5E2OA 1DY8A 2A0QB 2C90B 3LGTA 3BIVH 1QTFA 2VJ1A 1UJ1A 1AE8H 1C5NH 4NGAH 1LKAA 4XOJA 4IN1A 4UFFH 1UK4A 3U8TH 1PPZA 4ABDA 3BTQE 2NU1E 3NPSA 1V2ST 3UNRA 2SGDE 1GJ5H 1NN6A 3ZZ5A 4F49A 1HAPH 5HGGA 4NZLA 1LHEH 1WAYB 2VIPA 1TWXB 2ZHQH 4DIHH 1ZHMA 1O39A 4BAMB 1ZJDA 1C4V2 1RS0A 2ALVA 3SNDA 1VITF 1QQ4A 5T6FA 1AWFH 1K1MA 2B7DH 1Y8TA 1LHFH 1UHBB 3MNSA 1TE0A 3ZZ4A 4X2VA 4ZH8A 5EXLA 4TY7A 3RM2H 1W7GH 3ZYDA 2GD4B 1XKBC 2A5IA 2BQ6B 1A5HA 1ID5H 2J2UA 4JK6A 4MPXA 4ESTE 4E05H 1SGQE 1O2TA 2WYGA 3MH4A 4FUCA 2P3FH 1EOLA 2W7UA 1ESAA 1PQ5A 5ETXA 2PGQB 1EAXA 1KXEA 1BHXF 3MFJA 1C2JA 2J94A 1O0DH 1TALA 5GCHG 1CVWH 2I6QA 2P94A 2ANYA 5DP7A 2Q6FA 1SI5H 3U1IB 1P10A 3PMJA 3FP6E 4K2YA 1Q31A 3SNEA 1NRPH 4XE4A 1P2OA 1PFXC 1UVSH 2P3TB 1FY3A 1TIOA 1S82A 4B76A 5HYOA 2EA3A 4WY3A 2VGCB 2FI4E 1N1LA 1H8IH 1P2NA 1XUJA 3MU5A 2ZHFH 2THFB 2LNCA 1EAUA 5E2PA 3K6YA 6LPRA 1RTLA 1CHOF 3RU4E 2P8OC 2QCYA 1O31A 1QGFA 1Z1JA 1KSNA 2PSYA 4FUDA 3RXVA 3PTBA 4YOGA 4MPWA 2XC5A 1G3BA 3OYPA 1Y5BT 1FPHH 1GCTC 5DP8A 1FIWA 3PWBA 1GBTA 3F9EA 3QZQA 1BBRE 1IHTH 1THPB 1WQVH 4FVBA 2ZNKH 4OS1A 5DO4H 1YYY1 2ILNA 1TBQH 3AASA 1GMDG 3P8FA 1BT7A 1BZXE 1P09A 4CRCA 3BEUA 3K9XB 1HIAA 2CF8H 5I25A 4AN7A 2PKSC 1MKWK 3GY6A 4IW4E 2XW9A 1AN1E 1SMFE 1BMMH 1H9LB 5T6DA 2ZCKP 5DK1A 2JKHA 1NRNH 5A09A 2AMDA 1AU8A 3RXEA 5HMAA 1ZHRA 3GCHB 1NESE 1AE5A 1P01A 4NIVA 2ZHEH 1BRBE 3GOVB 1MBMA 4IMQA 1XXFA 4AB9A 5EQSA 1GJ6A 1T8LA 3DFLA 3TH2H 2PGBB 2FEQH 2ZI2H 2ZGXH 3DT0H 2PHBA 4FUFA 1PQAA 1MTNB 1QJ1B 3E1XB 1EP5A 4AFUA 3LH1A 4SGAE 1PQ8A 1AFQB 2F9VA 3SW2B 1EP6A 3KHVA 3QK1A 8ESTE 2A7CA 1PPBH 2R0KA 3T62A 2WINI 1G3EA 4X1NU 1XVOA 1FN8A 1ZJKA 4KTUA 4R8TB 2R2MB 1SGTA 1GBMA 1TPAE 1VGCC 2FESH 5L2ZH 1C5RA 1ELDE 1MTSA 4JZDH 4Z6AH 3RMLH 2H6MA 2PKAA 1BJUA 1GI5A 1SL3A 1YCPM 4BTIB 1KYNA 1WYKA 1GCDA 1O2QA 4JZEH 1SGPE 4BXSA 1HXFH 1LPZB 2BY7X 4WJG2 1CE5A 3ZVBA 4MDSA 1IOEA 2CV3A 2F9BH 1A0LA 3VGCC 2XCFA 1IQEA 2G8TA 3GDSA 1O3IA 4ISOA 1MAYA 5CE1A 4B2CA 2FX6A 1HJAB 1V2WT 1AIXH 5B6OA 1AKSA 1N8OB 2VU8E 5EG4A 1OWDA 1JXPA 2FOGA 1BTYA 1EQ9A 4NIWA 1C1RA 3SU6A 1F0TA 1BMAA 1AZZA 1A61H 2BY6X 4KELA 1Z6EA 2Y5HA 4O97A 3A7ZA 3T2NA 4ISIH 1A5IA 2W26A 1TGSZ 2XXLA 3ITIA 3V0XA 4K3JA 1L1NA 1A3EH 1EUFA 1INCA 1O3OA 3KF2A 4X1RU 1NRRH 1ZTKA 1GHZA 3STIA 1HB0B 3T26A 2NU3E 2WPKS 2Q6DA 3M3VA 3E90B 4DY7B 2AIPA 2VVVA 1TPSA 2TGPZ 1C1SA 3RMOH 4CREA 1UCYH 2Q6GA 3NKKA 4UDWH 2Y5FA 5A8XA 1W7XH 1GG6B 1V2PT 5A0CA 1O3KA 3RXKA 3VEQB 1ETSH 4ABBA 2ZQ1A 1W10U 2C8WB 1O34A 5DGJA 1XKAC 5E0JA 1HJ8A 1FPCH 1MUEB 1SQTA 3ZVAA 2BY8X 1IHSH 1GGDC 2TGAA 4YM9A 3O8BA 2V0BA 5JYIA 1VITH 1IQGA 4DGJA 1ZRBA 3N7OA 4AFSA 1GMHF 2G51A 2VH6A 3M5MA 2ZCHP 2FS8A 3M7QA 2UWLA 2UUFB 1BJVA 1HCGA 4RKJB 1C9PA 2WPLS 3GY8A 1NFYA 1BBRK 1D4PB 4MNYA 3ZVDA 1XMNB 3JZ2B 5EQRA 2JH6D 2QV1A 3ZZ9A 3HKIB 3R3GB 1HAVB 2BM2A 5A0BA 2ESTE 2OINA 4OGXA 1QURH 1J16A 4H42U 2ZFFH 2Z6BD 3LGIA 5C2ZA 3MU1A 2G00A 1EOJA 5FPTA 2Z3EA 3HGNA 5FPSA 1S83A 2QN5T 1XUFA 2BX3A 1P3EA 4D7FA 3M5OA 4AG1A 4Z0KA 1G36A 4ABJA 4MTBA 1TMUH 2VWOA 4B73A 1Y3UA 3D62A 3GCNA 3RXBA 2BD8A 2HNTF 1S84A 4INLA 3ZZAA 1A4WH 4MQAA 2XBVA 1GHYH 2VIQA 4FXGH 3SU0A 3RXSA 7LPRA 2ZECA 1QCPA 1HAIH 1T31A 4ZHLU 1ZHPA 3M61U 2Y82A 1J17T 4UD9H 1EX3A 4OS7A 5EGMA 5G4BA 3SUGA 1DWEH 3P17H 1IQJA 3OTJE 3V12A 1H4WA 3BV9B 2OC7A 5FCRA 5F8TA 1ZTLA 2PFEA 2QY0B 1C5OH 2EEKA 2RCEA 2BD4A 2GCTC 2AGIX 1G30B 2B5TB 1HIAB 1NZQH 3C27B 3SJKA 3BTKE 4Y7BA 3RXGA 4FUEA 1Z7KA 2D26C 3RXQA 2HLCA 1BMNH 4Y0YE 4D7GA 2RA0A 4TPYA 3P8OA 4NIXA 1GBJA 2QC2A 1K21H 4J2YB 3A88A 1FLEE 2YNBA 1QBVH 4MNVA 1T32A 4D9QA 2VVUA 1W0ZU 1C1MA 2BHGA 3LT3A 4KTCA 1B0EA 4DOQA 3TJUA 3VFEA 1C9TA 2GV6A 1NC6A 4TY6A 3UIRA 1UK3A 2F9NA 2BOHB 5C3NA 2PV9B 1W2KH 1GHBG 4HGCA 5DJ7A 2R3YA 5FX5A 3AW0A 1VZQH 2ANMH 3UY9A 1O35A 3SO3A 2A31A 1TNLA 3PMHB 1FJSA 8GCHF 3FP7E 4O03A 1LPGB 1F0RA 4LK4A 4Y8XA 2C93B 4JK5A 1TYNA 3RXOA 1C1PA 1XVMA 2G52A 1IQLA 1ABJH 1ACBE 5HXFA 1FUJA 1FV9A 1QB9A 4I8JA 1Q2WA 3E3TA 3RXDA 3EA7A 4UFEH 1MKXH 4NG9H 3RXFA 2BLQA 2CJIA 2FIRH 4GHTA 4CRFA 1NU9A 4Y8ZA 5IDKA 4LZ1H 4D8NA 3P92A 4I31A 4CR5A 1DWBH 1AB9B 1YGCH 4YLQH 3TJOA 2ZU2A 3ZZ8A 1ORFA 1OXGA 1UTNA 3URCA 3A89A 3KNXA 4YOJA 2PKAB 1O2KA 2GV7A 1O3LA 5T3HA 1CA0C 1LMWB 1K22H 1SLVB 4I8GA 1EPTA 1HXEH 2WPJS 5FHTA 1CU1A 4KGAA 2STAE 4BOHA 4ZKOU 4AOQA 1GBAA 3QN7A 2HPQH 1NT1A 1NFUA 1C2DA 1TRMA 2FI3E 2PSXA 1C1TA 2I6SA 3GY2A 1EZUC 1TGTA 3BF6H 3KQEA 2P16A 2BDHA 4CHAB 4D9RA 2WUCA 2HPPH 3ODFA 2ALPA 1CBWB 1ELFA 1G2LA 4HI3A 1YKTA 4UFDH 4TPIZ 4HTCH 1V2MT 2NU0E 4BANB 3GY7A 2TPIZ 3HKJB 1SC8U 2JH0D 1UTLM 2O9QA 3E0NB 3S7HB 3ZVCA 2QA9E 1GI6A 2H5CA 2LPRA 1SVPA 2EC9H 1UO6A 2Y6TA 3TJVA 2FDAA 2TGDA 1CHGA 4ABHA 2XNIA 1GI7B 3QX5H 1RFNA 1GL0E 2W5EA 4UEHH 3QLPH 1PJPA 4NFEA 5AFZH 8KME2 3ATWA 1KXAA 4WWYA 1O2WA 2GT7A 4GVUA 1EJAA 4I8HA 2GKVE 1SLUB 1UCYE 2CF9H 1MU6B 3QGJA 2M5TA 5FX6A 1TGCA 4Y6DA 6CHAB 1J15A 1T7CA 1ELAA 2ZGBH 4MPUA 1NO9H 4ISNA 1YPEH 1ANDA 3D49H 3HK3B 4UFGH 1T4VH 5BRRE 5DKMA 1VCQA 3I78A 1ZYOA 1GMCF 2QXIA 3RLYH 3SOSA 1JRSA 1JIRA 2GGVB 1FMGA 4M7GA 5AVDA 1MTUA 4ZUHA 1QL7A 1LTOA 1CGHA 1HPGA 3SNBA 4CRDA 1L2EA 1DY9A 1Y3VA 3CENA 2H2ZA 5GWZA 2VB0A 2WV4A 4ABFA 1LDTT 1UTOA 3M36A 1WSSH 3QTVH 2C8ZB 6GCHG 1OOKB 5C5OA 4XDEA 1GDUA 1C5QA 2ZCLP 1QRWA 2O8MA 4O3TA 3G01A 1V6DA 1W11U 3ZV9A 4H6SB 3OX7U 1ZLRA 1V2VT 2Y81A 1PPFE 3GY5A 1Z1IA 3SUEA 3FP8E 3MNBA 4A92A 3UWJH 1J9CH 6ESTA 1ZSLA 2ZDKA 4E06H 2GZ8A 1YP9A 2ZF0H 1GJDB 1UK2A 1IQFA 2D2DA 2VNTA 3Q77A 1WOFA 2FOHA 1MTWA 3CP7A 3SZNA 1TRYA 4ABIA 4NFFA 1ZMLA 1DPOA 5F6MA 2BQ7B 1S81A 2FYRA 2GMTB 1N8OC 1FI8A 4HZHA 1AVWA 3U69H 1O3EA 2P59A 1BUIA 1O5BB 2FOAA 2CHAB 2PR3A 2TRMA 1QL8A 3RXJA 1GI0A 1XUHA 1FY8E 1O2NA 1DANH 1MH0A 1O5EH 4O9VA 2H1UA 1OWJA 3A84A 4CBNA 2ZTZA 1WCZA 3MU8A 1HAVA 1K1JA 1GL1A 4FUHA 1T8NA 5A8YA 1VCWA 3UWIA 2AFQB 1A0JA 2RG3A 4Y7AA 4B2AA 1O5AB 2ZU4A 1S6HA 2EI6A 2FOMB 4ISHH 3SGBE 1K1IA 1O2LA 1XUKA 2PW8H 2VVCA 1CQQA 2C8XB 1TQ7B 2ZPSA 2BD5A 3FZZA 2FTLE 4JYTA 5FPYA 3RU4T 1LQDB 1O2YA 1IAUA 1SGEE 3O8DA 3RXHA 1ZSKA 2VH0A 1TAWA 1PYTD 1L0ZA 3GDUA 1Z6JH 2ZQ2A 4ZXYH 3R0FA 4INHA 2ZA5A 5K7RA 3SHAH 1VCPA 3B23B 4VGCB 1MQ5A 4JCNA 1PQ7A 4YT7H 4CRGA 5HM2A 3A7YA 4WH8A 1SQAA 1SR5C 3ZV8A 4O3UA 2NU2E 2BB4A 1P11E 1P9SA 1D3QB 2CMYA 1PPHE 2ZHDA 3A7TA 3TLOA 2BLOA 2QGRA 1O2GH 2BXTH 2ANKH 3HK6B 1SFIA 1OWHA 1C1NA 1SGNE 3NK8A 4ZHAA 1E34B 3QWCH 3RDZA 3A7VA 1P3CA 4I8KA 3A8AA 3LGVA 2FXRA 3P95A 3AAVA 1NU7B 4FUBA 2ZC9H 1CT0E 5JBBS 2ULLA 2R0LA 2B9LA 1DXPA 1SGFG 2Q1JA 6GCHF 2OBOA 3M35A 1F0UA 2ZU3A 5J4SA 1C1UH 1MBQA 4B75A 5EPNA 1WTHD 2Y7XA 3BTGE 1RRKA 3IWMA 1O5GH 2UUKB 5GDSH 3Q00A 1WQSA 2KAIA 1FQ3A 1UCYK 3M3TA 3NZIA 1TNJA 2DUCA 1V2RT 1SHHB 1C5XB 2DE9A 1FN6A 1DLKB 1ELBA 1O3HA 2ZDLA 1EPTB 2C8YB 4K8YA 2GVFA 1DLEA 3LIWA 4MVNA 3EYDA 1GMHG 3EDXB 3ESTA 1SGFA 1SOTA 3RC6A 4AB8A 3K65B 3U8RH 1O2JA 1U6QA 5JB9S 3ZZ3A 2J38A 2AYWA 1UVTH 3EE0B 1C4U2 3GCOA 1OP8A 1CGJE 2F9OA 4KP0A 1IQHA 2EI7A 3A82A 3FANA 2VIDA 3PV4A 3I29A 1JOUB 1ZR0A 1ARBA 1YM0A 2C3SA 3LPRA 4BXWA 4X1SU 2P95A 2QAAA 3ZYEA 1O3NA 3PMBB 1RIWC 1GDNA 3MH6A 4K5ZA 3K2UA 2GDEH 3VB4A 1WV7H 2A5KA 1OSSA 1PPGE 1C1OA 3F1SB 5EOKA 2SNWA 1Z8JB 3Q3YA 3VXFH 1C1WH 1K9OE 2SNVA 2XTTB 1BTHH 4YTAA 1YCPH 2WPMS 1JIMA 1TONA 4XBCA 2ZDVH 4U01A 1EJMA 5FBEA 1NS3A 1KLJH 3ATIA 3SHCH 4FU7A 2PUQH 3RXPA 1AI8H 1H8DH 3AAUA 1VJ9U 1FAKH 2OQUA 3H7OA 2SFAA 1D3TB 1QRXA 1F2SE 2RDLA 2GZ7A 3PO1B 1O5FH 5C5NA 3RXLA 2A7JA 2ZGHA 5LPFA 2HALA 4LOYH 2V35A 1TNHA 3UTUH 1UVPA 4Q7XA 5FBIA 3S69A 4B1TA 1A7SA 1D3PB 2FX4A 4I32A 4NWLA 3EGKH 4CBOA 1V2QT 3B9FH 2BVRH 2EI8A 2OC0A 5JBTA 4ABAA 2BDBA 1SOZA 4PROA 1IQNA 1HDTH 1S0QA 1F5LA 5DP5A 2JETB 2Z94A 5A2MH 3TJNA 1BMLA 1MQ6A 2G81E 4AG2A 1HGTH 1Y5AT 1C5VA 3WY8A 3A7XA 1C2GA 1GBKA 4DVAU 5JB8S 1GVKB 1OPHB 1WUNH 1QB6A 2ZFTA 3SUDA 4KTSA 2OQ5A 3FFGA 1P9UA 2Z9JA 3S9CA 1O3DA 1TA6A 3E0PB 1KDQB 4TWWA 8GCHG 2GP9B 4CHAC 4XSKU 3S9BA 4J1YA 1V2UT 3E8LA 1CBWC 4XBDA 2FI5E 2G5VA 2W7SA 2FPZA 3TGJE 1HAYB 4JYVH 2ZEBA 2DE8A 5ABWA 3RXRA 2P8OB 4CRAA 1QL9A 2IN2A 2FWWA 3ENSB 2BVSH 2H9HA 1MKXK 1XXDA 2BD9A 2BVXH 2FODA 1LVBA 4R0IA 1MD8A 1OP2A 3DHKH 1KXDA 4FUIA 1GCTB 1XUGA 2ZKSA 2ZDNA 2BD7A 4BAHB 1C5LH 1AHTH 1Y5UT 1NM6A 2J9NA 1DWDH 1K1NA 5JBAS 4DCDA 1K1OA 1DDJA 1TX8A 1C2KA 1P04A 1QA7A 2GT8A 1K1PA 3SGAE 4IGDA 2SGAA 3M5LA 1GBEA 1P02A 1C5UA 2ZTYA 4Y8YA 3RXAA 1BDAA 2IJOB 3MMGA 2XBYA 1YPHC 3VB6A 3TNTA 5LPRA 5JPMH 2PTNA 2PKSB 1OYQA 2F83A 3KGPA 1DUEA 3SJ8A 1AFEH 6CHAC 3VB3A 3Q3XA 3TU7H 4U30A 2BY5X 3NCLA 1GI2A 3HGPA 3HPTB 1TBRH 4X2YA 1WU1A 2Z7FE 4A1TA 1TRNA 5E8EH 4BTUB 5TCAA 3KCGH 4Y76A 1HBTH 2W3KA 4OS4A 3UUZA 2PTCE 1TNIA 2AH4X 2BDYA 4IN2A 1V2LT 2HOBA 5DG6A 2UWPA 4YLUA 1K28D 1VR1H 2FP7B 2CN0H 3ATLA 3ZZ6A 1CA8B 1UVOA 1P2JA 3UOUA 3SU3A 1TQ0B 1O2HA 1TPPA 1YBWA 2BDAA 2BZAA 1LCYA 1ANCA 3KQCA 4H4FA 1DXWA 3BTEE 1TOCB 1V2NT 4JYUH 2TBSA 4DIIH 3SU5A 1HJ9A 5C1UA 2IOTA 4X8SH 2FM2A 1VGCB 4GLYA 2FTMA 3ATMA 2P93A 4QT8C 1OP0A 2ZZUH 1D6RA 1P0SH 2FS9A 4AFZA 4GAWA 1ELTA 1OYTH 2KAIB 2TIOA 1DOJA 3MU0A 1RXPA 4ZKRU 1V2KT 2XWBI 1SLXB 2NU4E 2NWNA 2R9PA 3F9HA 2W3IA 4IC6A 3SQHE 1KXCA 3URDA 4WXIA 2GMTC 4WH6A 1C5ZB 3RUOA 1AWHB 1GMCG 5CHAB 3BTFE 1LQEA 1YPLH 1TX6A 2ZFQH 3GCTG 2FOBA 2FZZA 1YF4A 1ANEA 2A45B 4Y10E 3SV9A 2P3UB 4K8BA 3LGWA 4IBLH 1KTSB 1MAXA 3DD2H 2XC4A 4CRBA 3A81A 4X1QU 2A5AA 3C1KA 1V2OT 1W8BH 4ABEA 2QYIA 3SV8A 1Y3WA 1OWKA 3E6PH 1ZGVA 3HATH 4YT6H 4ISLA 9LPRA 4IMZA 1C2HA 1TB6H 3MNCA 3ZZDA 1H9HE 1HLTH 2F9PA 4NA8A 1ELEE 3OU0A 3CS7A 1F7ZA 2OLGA 4NIYA 3PLPA 2ANWA 4AYVB 1SBWA 1GBIA 3SNAA 5EW1H 5A0AE 1FAXA 2VGCC 1EKBB 3SQEE 2BMGB 2XBXA 1A2CH 1TMBH 3T27A 2XYAA 1THRH 1C1QA 5F03A 3LH3A 3LOXA 1GHXH 1XUIA 1KIGH 3PM3A 3TK5A 1E37B 1YLCA 3M7TA 4B2BA 4MG3A 2ZG0H 3KQDA 3ODDA 2AEIH 5SGAE 1W12U 3D23A 3T29A 1P2KA 2OUAA 1ETRH 1W14U 1Z8RA 2VWMA 1Z8GA 2G55A 2ZTXA 3NUMA 5CMXH 2A2QH 3SU4A 1EZQA 3QTOH 2H5DA 2JH5D 4I33A 3MTYA 4SGBE 5AHGH 1E35B 3BTDE 2PWXA 2QF0A 3MO9A 2QXGA 2O8TA 1ZPBA 1W3CA 1C2IA 1AO5A 1AUTC 3L6PA 5TCCA 3UQVA 4Q2KA 2WUBA 1JMOH 3TIUA 2BLWA 4K69A 3ZVEA 1ELCA 1HAXB 2ZPRA 3KN2A 3PMAB 3U98H 1TFXA 3TGKE 4BAQB 3GCHC 3I77A 3ZVFA 3BTHE 1FNIA 1AVGH 1P57B 3PWCA 2F91A 2YNAA 4FUGA 4BTTB 2A4QA 1NFWA 4MLFB 1ZMJA 1HV7A 3GYMA 1QHRB 1LVMA 2WPIS 3MO3A 2UUYA 1IQKA 1EPTC 1DX5M 4NA9H 1O2ZA 1BTWA 2A2XH 2AGGX 3STJA 1MTNC 1O2SA 1C2EA 4NWKA 2F3CE 3BN9A 3KIDU 1GJ9B 3LC5A 1UTQA 1DS2E 4X8TH 4ZXXH 1AFQC 5EQQA 3GCTF 1SLWB 2OP9A 2IPHA 2Z9LA 1O3BA 1HAZB 2AMQA 2GDDA 1BIOA 1O3PB 2A4RA 2VIWA 3BEFB 1SB1H 3BG8A 1HAOH 1V3XA 1G3CA 3ATKA 4YO9A 4F4OC 1C5MD 2BDIA 1DSUA 1K2I1 1GBHA 1LHDH 1ANBA 3TNSA 1G37A 1GHWH 1D3DB 3DFJA 3LC3A 3RXUA 1V2JT 4K1EA 1MCVA 3TITA 5C1XA 1KLTA 1QFKH 5L6NH 1TX7A 3A87A 2XRCA 5K0HA 4THNH 1C5PA 2BX4A 3A80A 2RA3A 4ZROA 1BA8B 1ESTA 2GCTB 4A7IB 1HJAC 1QR3E 1KDQA 1CSOE 4X2XA 4X2WA 1EJNA 5F8ZA 4X6OA 3SJ9A 1E0FD 3LGYA 1DUAA 3T25A 1AY6H 1C5SA 3QDZB 3SV7A 1BTXA 3P8GA 3VB5A 4TWYA 3A8CA 1L4ZA 1GWAA 1WTGH 4WMDA 5AF9H 2J34A 3MHWU 5A8ZA 2VWLA 3BG4B 3IG6B 1NROH 1O36A 1C5WB 3PO1C 3KL6A 2WYJA 1CT2E 1BRUP 5BPEA 3UOPA 3GICB 5DP3A 1O2MA 1GBDA 3IITA 1YLDA 4XBBA 2ODYB 1O5DH 2OXSA 3L3TA 1OWEA 2ASUB 4Y11E 1SGCA 3MH7A 1GI9B 1JWTA 1YPGH 1Y3YA 2JETC 4AZ2B 1B7XB 2A7HA 2B8OH 1HRTH 1HUTH 1G3DA 3EA9A 1EAIA 3KEEA 3AVZA 1RGQA 1AGJA 1GBLA 4RKOB 4INKA 1GG6C 1C5TA 3PLKA 1NTPA 1O30A 1D6WA 2CGAA 4UONA 1BQYA 1YCPK 1PPEE 4WVPE 4BNRA 1A5GH 5DP6A 3UNQA 5LPEA 2ZIQH 2Z9IA 1O3AA 2GCHG 3EA8A 3LDXH 3SNCA 4A6LA 2BY9X 4UE7H 1A1RA 4TYDA 1TNKA 1A46H 1DFPA 5DP4A 4CR9A 1LKBA 1CA0B 2STBE 1CGIE 1Y3XA 4YOIA 1NRQH 5FAHA 2VINA 2BQWB 4ZHMU 2ODQA 4AYYB 1ELVA 4Y79A 4DG4A 1O2VA 1BRAA 2B0FA 3OY6U 3BTWE 4JMYA 3UR6A 2PUXB 2XC0A 1O3GA 4BAOB 4WF8A 1HFDA 3SV2H 2ZU5A 4DW2U 3MNXA 1Y59T 1UVUH 1W0YH 2OCVB 2A32A 1TLDA 1BTPA 1EZXC 2WV5A 2Z9KA 3UFAA 3EAJA 2BD2A 3TK9A 1C2MA 2OC8A 5J4QA 4XFQA 3W94A 1XM1A 4OS6A 1E36B 2J95A 4GUXA 3T5FH 3TPIZ 2J4IA 1JBUH 5IYTA 4X8VH 3TGIE 1O2XA 2FLBH 3UQOA 3SORA 1SGIB 1P2IA 3ZZCA 2H9EH 4GPGA 4OS2A 1KY9A 1ZMNA 3D65E 3MWIU 3RMNH 1V2TT 1SPJA 1LPKB 1S0RA 3RC4A 1SFQB 4WMFA 3O8RA 4JZIA 3GY4A 4X6PA 2O8UA 3QZRA 5EPYA 1DWCH 1X7AC 1KTTB 1AVXA 1LHCH 1N6YA 3NWUA 4X6MA 1AD8H 5F8XA 1G9IE 1RD3B 5PTPA 1QJ7B 4NCYA 3SBKA 2BLVA 2QIQA 1ETTH 3LGUA 2SGPE 1C2LA 3RC5A 5ESTE 4X8UH 1XX9A 2Y80A 4FUJA 3S9AA 1ZZZA 2OD3B 1O2UA 2YOLA 5EXNA 3NXPA 3P70B 4I7YH 3V7TA 2F9UA 4Y0ZE 3ZZ7A 1Z71A 4AORA 1H1BA 2Y7ZA 1BRCE 1DSTA 4I8LA 1UTKA 4FVDA 1UTPA 1A3BH 3F68H 1NY22 1T4UH 1P2MA 5DP9A 1GPZA 1P2QA 3B8JA 2GZ9A 1G2MA 2G4TA 3LU9B 1FXYA 3RLWH 4DT7B 1C2FA 1DT2A 5GCHF 2Z9GA 2V3HH 1AQ7A 1ZSJA 3W95A 5T6GA 3E91A 1ESBA 2SGFE 2V6NA 1Q3XA 5H4IB 1TOMH 4GCHG 3MH5A 2GCHF 4FU8A 2SGQE 1O38A 3SGQE 4B71A 1VJAU 2Z3DA 3OSYA
chains in the Genus database with same CATH superfamily
1E38B 3LJOA 2K1QA 5CHAC 2VBCA 4BAKB 1WDIA 1P06A 1DVAH 1GI1A 1GVLA 4DURA 1RJXB 4K60A 1EATA 2A4GA 1O3CA 1QY6A 4WXVA 3U1JB 1YPMH 5EW2H 1FY1A 3FVFB 1GBBA 2GX4A 5AFYH 4RN6A 1SSXA 1BHXB 2FLRH 2ZFRH 3KQBA 5GPIB 5DPAA 1CT4E 5HIYA 2FO9A 3F9GA 4IS5A 4ZMAH 1QRZA 3FAOA 1AB9C 3ELAH 1LO6A 3SI4H 2Y5GA 4NA7A 8LPRA 2ZP0H 5LGOA 3OFND 3OY5U 5E0GA 1T8OA 2QXJA 1GMDF 3SI3H 3SU1A 4IC5A 1W0KD 2G5NA 2ZGCA 1SKYE 1ZPCA 3U8OH 1MKWH 3RXIA 1HYLA 1BB0B 2XCNA 2J92A 4MNWA 2BDCA 4Q63A 3OEHD 1QIXB 3RMMH 1G32B 1ZRKA 4X0WU 1KXBA 1MZDA 3TVJB 3O8CA 1UTMA 1DE7H 4U2WA 1MMJN 3K6ZA 4ZKSU 2OTVA 3DSPA 5JBCS 2ZWLH 1GI8B 1JRTA 2FMJA 2FOCA 1TNGA 3H7TA 1WBGB 2W6ID 2R3UA 3SN8A 3QUMP 1HAHH 1SGYE 4JZFH 1GHAG 5EODA 2HNTE 1YPHE 1MZAA 3U9AH 2OK5A 1P12E 3L33A 2QXHA 2FOEA 4A1VA 4B6FA 1EASA 1F5RA 1B0FA 4AGKA 1MU8B 3LONA 1EAWA 1BTUA 4Z1MD 1FY4A 1GVZA 2R2WU 4RSPA 4MPVA 1S6FA 1B5GH 2HRVA 4ZKNU 4GHQA 2L6OA 1ZOMA 2KM0A 5E0HA 5C67A 2BTCE 2HNTC 2BYAX 3M3SA 2XBWA 4A1XA 4A5TS 3GY3A 3AW1A 4YESB 1A0HB 1ZPZA 2BXUH 3JZ1B 1C4Y2 3PRDA 1HNEE 4FU9A 1PYTC 1NRSH 3SU2A 4K1TA 5EU8A 3MO6A 1S85A 3FKSD 3UPEA 2QF4A 2ZO3H 1F5KU 1O2IA 1S5SA 3MI4A 4X6NA 4GCHF 7GCHG 1UHBA 4E7RG 5GIBA 1LHGH 2ZDMA 5ESBA 2ZDAH 2D8WA 3S0NA 2BD3A 2GJGA 1FZZA 1GJAB 2BZ6H 3RXTA 4NZQA 1F0SA 1H9IE 2A1DB 2BOKA 1GBCA 3M7UA 1DM4B 3MYWA 1FY5A 3PTNA 3VPKA 2J98A 1C1VH 1GJ7B 3CS0A 4GSOA 4U32A 3GYLB 1YWUA 2CXVA 4CH2B 1TPOA 2J5UA 3BTME 4JZ1A 1HAGE 2JDID 1THSH 2QE7D 2D1JA 1FIZA 5FCKA 3PB1E 3UNSA 2VIVA 3BSQA 1TA2A 2XWAA 3VXEH 3RXMA 4RI0A 7ESTE 1T8MA 2J97A 2ZGJA 5EXMA 2SGEE 5L2YH 1BOQA 1SHYA 3A8DA 3E16B 4X1PU 4Y71A 3SV6A 3BEIB 3SJOA 1DICA 3MU4A 3A86A 2ODPA 1K1LA 4CH8B 1PPCE 3A83A 3RM0H 1L4DA 3DSGA 3ZZBA 3GDVA 4E7NA 3T28A 1YC0A 1RIWB 1RTKA 1O3FA 1IQMA 3V13A 1QB1A 3EQ0H 1GBFA 4Q80A 2AIQA 5C0TA 1ARCA 2CHAC 3VGCB 1EXFA 3F9FA 3Q3KA 5HM9A 2FOFA 1AUJA 2ZFPH 3TH3H 4AGJA 1OWIA 5HKKD 1C5YB 1O2OA 1SGDE 2VIOA 2O8LA 3V3MA 1ELGA 3RP2A 3TH4H 2UUJB 1BCUH 2FYQA 1GHAF 1QBOA 3BG4C 5JDUB 4HFPB 1QNJA 3SZEA 5I46H 1O33A 1O37A 4KKDA 4FOUC 1IQIA 2H9TH 1O2PA 1P8VC 1FONA 3QGNB 1ABIH 1UTJA 3A8BA 1BBRH 2O8WA 3RU4D 2BDGA 3BTTE 2HGTH 3UR9A 2AS9A 1GDQA 1SQOA 1MCTA 3M5NA 3PLBA 4DJZB 1EB1H 1BMFD 3S7KB 4AFQA 1DITH 1O32A 2AMPA 4AX9H 1L1JA 2Z3CA 3MOCA 1LVYA 3GISB 1QBNA 4D76A 1P03A 4WMEA 2AGEX 1TBZH 3H5CB 3BIUH 2ZU1A 2OC1A 2A4OA 2ZHWH 4YZUA 4VGCC 9ESTA 3VB7A 1O3MA 3P8NA 1NFXA 3OTPA 3KQ5A 1CO7E 3ZVGA 1OKXA 1SG8B 1VITG 2UWOA 1MD7A 1TGNA 7KMEH 1BITA 7GCHF 2V3OH 1TMTH 1OX1A 1KXFA 1Z8IB 4LXBH 1H8ED 3SJIA 3F6UH 5LH8A 1GJ4H 2PLXA 1J8AA 1OS8A 3PYHA 2HVXA 4NSYA 5C1YA 1GGDB 1M9UA 3A7WA 1D9IA 1W0JD 1MTVA 3LJJA 2G4UA 5FXLA 3M37A 1QJ6B 1GI3A 3A85A 1GJBB 1QA0A 4MNXA 1AKSB 1FDPA 4Q7YA 4B74A 4ASHA 1F92A 1GHVH 3UREA 1BTZA 4H6TA 3SUFA 5TJXA 1AZ8A 3FN8A 4ZAEA 1L1GA 1SGRE 1KLIH 1O3JA 2ZFSA 2TGTA 1TGBA 1N6XA 3RXCA 3QO6A 5GXPA 1GJ8B 1RTFB 1O2RA 2C4FH 3KYGA 5GJ4B 3PROA 1J14A 5C20A 4K1SA 1LVOA 4OGYA 1YPKH 2AERH 1QQUA 4Q7ZA 3PV5A 3TK6A 3P6ZB 1GJCB 1EZSC 1O5CB 3LKWA 2HWLB 2ZPQA 2OBQA 2WPHS 1GI4A 3DSOA 2GTBA 1NPMA 1YPJH 3FOAA 4ABGA 3DUXH 1EB2A 4LZ4B 5KEDA 1CHOG 1ZTJA 3FZDA 4NSVA 2VWNA 2QF3A 4XD7D 1AMHA 1ZGIA 3Q76A 1UMAH 1P05A 4OS5A 5L30H 1TABE 3DA9B 1W13U 1GHBF 5E2OA 1DY8A 3GS9A 2A0QB 2C90B 3LGTA 3BIVH 1QTFA 2AHME 1UJ1A 2VJ1A 1AE8H 1C5NH 4NGAH 1LKAA 4XOJA 4IN1A 4UFFH 1UK4A 3U8TH 1PPZA 4ABDA 3BTQE 2NU1E 3NPSA 1V2ST 3UNRA 2SGDE 1GJ5H 5DSFA 1NN6A 3ZZ5A 4F49A 1HAPH 5HGGA 4NZLA 3F2GA 1LHEH 1WAYB 2VIPA 5C17A 1TWXB 2ZHQH 4DIHH 1ZHMA 1O39A 4BAMB 1ZJDA 1C4V2 1RS0A 2ALVA 3SNDA 1VITF 1QQ4A 5T6FA 3F2FA 1AWFH 1K1MA 2B7DH 2XNDD 1Y8TA 1LHFH 1UHBB 3MNSA 1TE0A 3ZZ4A 4X2VA 4ZH8A 5EXLA 4TY7A 1MABB 3RM2H 1W7GH 3ZYDA 2GD4B 1XKBC 2A5IA 2BQ6B 1A5HA 1ID5H 2J2UA 4JK6A 4MPXA 4ESTE 4E05H 1SGQE 3N7DA 1O2TA 2WYGA 3MH4A 4FUCA 2P3FH 1EOLA 2W7UA 1ESAA 1PQ5A 5ETXA 2PGQB 1EAXA 1KXEA 1BHXF 3MFJA 1C2JA 2J94A 1O0DH 3OAAD 3UB0A 1TALA 5GCHG 1CVWH 2I6QA 2P94A 2ANYA 2QF5A 5DP7A 2Q6FA 1SI5H 3U1IB 1P10A 3PMJA 3FP6E 4K2YA 1Q31A 3SNEA 1NRPH 4XE4A 1P2OA 1PFXC 1UVSH 2P3TB 1FY3A 1TIOA 1S82A 4B76A 5HYOA 2EA3A 4WY3A 2VGCB 2FI4E 1N1LA 1H8IH 1P2NA 1XUJA 3MU5A 2ZHFH 2THFB 2LNCA 1EAUA 5E2PA 3K6YA 6LPRA 1RTLA 1CHOF 3RU4E 2P8OC 2QCYA 1O31A 1QGFA 1Z1JA 1KSNA 2PSYA 4FUDA 3RXVA 3PTBA 4YOGA 4MPWA 2XC5A 1G3BA 3OYPA 1Y5BT 1FPHH 2RDEA 1GCTC 5DP8A 1FIWA 3PWBA 1FX0B 1GBTA 3F9EA 3QZQA 1BBRE 3N7EA 1IHTH 1THPB 1WQVH 4FVBA 2ZNKH 4OS1A 5DO4H 1YYY1 2ILNA 1TBQH 3AASA 4F55A 1GMDG 3P8FA 1BT7A 1BZXE 1P09A 4CRCA 3BEUA 3K9XB 1HIAA 2CF8H 5I25A 4AN7A 2PKSC 1MKWK 3GY6A 4IW4E 2XW9A 1AN1E 1SMFE 1BMMH 1H9LB 5T6DA 2ZCKP 5DK1A 2JKHA 2LP6A 1NRNH 5A09A 2AMDA 1AU8A 3RXEA 5HMAA 1ZHRA 3GCHB 1NESE 3FO8D 1AE5A 1P01A 4NIVA 2ZHEH 1BRBE 3GOVB 1MBMA 4IMQA 1XXFA 4AB9A 5EQSA 1GJ6A 1T8LA 3DFLA 3TH2H 2PGBB 2FEQH 2ZI2H 2ZGXH 3DT0H 2PHBA 4FUFA 1PQAA 2WZQA 1MTNB 1QJ1B 3E1XB 4P00A 1EP5A 4AFUA 3LH1A 4SGAE 1PQ8A 1AFQB 2F9VA 3SW2B 1EP6A 4DT4A 3KHVA 3QK1A 8ESTE 2A7CA 1PPBH 5C0UA 2R0KA 3T62A 2WINI 1G3EA 4X1NU 1XVOA 1FN8A 1ZJKA 4KTUA 4R8TB 2R2MB 1SGTA 4I86A 4RT1A 1GBMA 1TPAE 1VGCC 2FESH 5L2ZH 1C5RA 1ELDE 1MTSA 4JZDH 4Z6AH 3RMLH 2H6MA 2PKAA 1BJUA 1GI5A 1SL3A 1YCPM 4BTIB 1KYNA 1WYKA 1GCDA 1O2QA 4JZEH 1SGPE 4BXSA 1HXFH 1LPZB 2BY7X 4WJG2 1CE5A 3ZVBA 4MDSA 3CNRA 1IOEA 2CV3A 2F9BH 1A0LA 3VGCC 2JIZD 2XCFA 1IQEA 2G8TA 3GDSA 1O3IA 4YXWD 4ISOA 1MAYA 5CE1A 4B2CA 3EE7A 2KCOA 2FX6A 1HJAB 1V2WT 1AIXH 5B6OA 1AKSA 1N8OB 2VU8E 5EG4A 1OWDA 1JXPA 2FOGA 1BTYA 1EQ9A 4NIWA 1C1RA 3SU6A 1F0TA 1BMAA 1WXRA 1AZZA 1A61H 2BY6X 4KELA 1Z6EA 2Y5HA 4O97A 3A7ZA 3T2NA 4ISIH 1A5IA 2W26A 1TGSZ 2XXLA 3ITIA 3V0XA 4K3JA 1L1NA 1A3EH 3WWFA 1EUFA 1INCA 1O3OA 3KF2A 4X1RU 1NRRH 1ZTKA 1GHZA 3STIA 1HB0B 3T26A 2NU3E 2WPKS 2Q6DA 3M3VA 3E90B 4DY7B 2AIPA 2VVVA 1TPSA 2TGPZ 1C1SA 3RMOH 4CREA 1UCYH 2Q6GA 3NKKA 4UDWH 2Y5FA 5A8XA 1W7XH 1GG6B 1V2PT 5A0CA 1O3KA 3RXKA 3VEQB 1ETSH 4ABBA 2ZQ1A 1W10U 2C8WB 1O34A 5DGJA 1XKAC 5E0JA 1HJ8A 1FPCH 1MUEB 1SQTA 3ZVAA 2BY8X 1IHSH 1GGDC 2TGAA 4YM9A 3O8BA 2V0BA 5CDFE 5JYIA 1VITH 1IQGA 4DGJA 1ZRBA 3N7OA 4AFSA 1GMHF 2G51A 2VH6A 3M5MA 2PP6A 2ZCHP 2FS8A 3M7QA 2UWLA 2UUFB 1BJVA 1HCGA 4RKJB 1C9PA 2WPLS 3GY8A 1NFYA 1BBRK 1D4PB 4MNYA 3ZVDA 1XMNB 3JZ2B 5EQRA 2JH6D 2QV1A 3ZZ9A 3HKIB 3R3GB 1HAVB 2BM2A 5A0BA 2ESTE 2OINA 4OGXA 1QURH 1J16A 4H42U 2ZFFH 2Z6BD 3LGIA 5C2ZA 3MU1A 2G00A 2WPDD 1EOJA 2L74A 3F3BA 5FPTA 2Z3EA 3HGNA 5FPSA 1S83A 2QN5T 1XUFA 2BX3A 1P3EA 4D7FA 3M5OA 4AG1A 4Z0KA 1G36A 4ABJA 4MTBA 1TMUH 2VWOA 4B73A 1Y3UA 3D62A 3GCNA 4B6EA 3RXBA 2BD8A 2HNTF 1S84A 4INLA 3ZZAA 5C94A 1A4WH 4MQAA 2XBVA 1GHYH 2VIQA 4FXGH 3SU0A 3RXSA 7LPRA 2ZECA 1QCPA 1HAIH 1T31A 4ZHLU 1ZHPA 3M61U 2Y82A 1J17T 4UD9H 1EX3A 4OS7A 5EGMA 5G4BA 3SUGA 1DWEH 3P17H 1IQJA 3OTJE 3V12A 1H4WA 3BV9B 2OC7A 2EQNA 5FCRA 5F8TA 1SQRA 1ZTLA 2PFEA 2QY0B 1C5OH 2EEKA 2RCEA 2BD4A 2GCTC 2AGIX 1G30B 2B5TB 1HIAB 1NZQH 3C27B 3SJKA 3BTKE 4Y7BA 3RXGA 4FUEA 1Z7KA 2D26C 3RXQA 2HLCA 1BMNH 4Y0YE 4ASUD 4D7GA 1YY3A 2RA0A 4TPYA 3P8OA 4NIXA 1GBJA 2QC2A 1K21H 4J2YB 3A88A 1FLEE 2YNBA 1QBVH 4MNVA 1T32A 4D9QA 1NBME 2VVUA 1W0ZU 1C1MA 2BHGA 3LT3A 4KTCA 1B0EA 4DOQA 5KECA 3TJUA 3VFEA 1C9TA 2GV6A 1NC6A 4TY6A 3UIRA 1UK3A 2F9NA 2BOHB 5C3NA 2PV9B 1W2KH 1GHBG 4HGCA 5DJ7A 2R3YA 5FX5A 3AW0A 1VZQH 2ANMH 3UY9A 1O35A 3SO3A 2A31A 1TNLA 3PMHB 1FJSA 8GCHF 3FP7E 4O03A 1LPGB 1F0RA 4LK4A 4Y8XA 2C93B 4JK5A 1TYNA 3RXOA 1C1PA 1XVMA 2G52A 1IQLA 1ABJH 2KR7A 1ACBE 5HXFA 1FUJA 1FV9A 1QB9A 4I8JA 2WV9A 4RT0A 1Q2WA 3E3TA 3RXDA 3EA7A 4UFEH 1MKXH 4NG9H 3RXFA 2BLQA 2CJIA 2FIRH 4GHTA 4CRFA 1NU9A 2V3MA 4Y8ZA 5IDKA 4LZ1H 4D8NA 3P92A 4I31A 4CR5A 1DWBH 1AB9B 1YGCH 4YLQH 3TJOA 2ZU2A 3ZZ8A 1ORFA 1OXGA 1UTNA 3URCA 3A89A 3KNXA 4YOJA 2PKAB 1O2KA 2GV7A 1O3LA 5T3HA 1CA0C 1LMWB 1K22H 1SLVB 4I8GA 1VKYA 1EPTA 1HXEH 2WPJS 5FHTA 1CU1A 2CK3D 2STAE 4KGAA 4BOHA 4ZKOU 4AOQA 1GBAA 3QN7A 2HPQH 1NT1A 1NFUA 1C2DA 1TRMA 2FI3E 2PSXA 1C1TA 2I6SA 3GY2A 1EZUC 1TGTA 3BF6H 3KQEA 2P16A 2BDHA 4CHAB 4D9RA 2WUCA 2HPPH 3ODFA 2ALPA 4TSFD 1CBWB 1ELFA 1G2LA 4HI3A 1YKTA 4UFDH 4TPIZ 2KFWA 4HTCH 1V2MT 2NU0E 4BANB 3GY7A 1E1RD 2TPIZ 3HKJB 1SC8U 2JH0D 1UTLM 2O9QA 3E0NB 3S7HB 3ZVCA 2QA9E 1GI6A 2H5CA 2LPRA 1SVPA 2EC9H 1UO6A 2Y6TA 3TJVA 2FDAA 2TGDA 1CHGA 4ABHA 2XNIA 1GI7B 3QX5H 1RFNA 1GL0E 2W5EA 4UEHH 3QLPH 1PJPA 4NFEA 5AFZH 8KME2 3ATWA 1KXAA 4WWYA 1O2WA 2GT7A 4GVUA 1EJAA 4I8HA 2GKVE 1SLUB 2F4LA 1UCYE 2CF9H 1MU6B 3QGJA 2M5TA 5FX6A 1TGCA 4Y6DA 6CHAB 1J15A 1T7CA 1ELAA 2ZGBH 4MPUA 1NO9H 4ISNA 1YPEH 1ANDA 3D49H 3HK3B 4UFGH 1T4VH 5BRRE 5DKMA 1VCQA 3I78A 1ZYOA 1GMCF 2QXIA 3RLYH 3SOSA 1JRSA 1JIRA 2GGVB 1FMGA 4M7GA 5AVDA 3OEED 1MTUA 4ZUHA 1QL7A 1LTOA 1CGHA 1HPGA 3SNBA 4CRDA 2JJ2D 1L2EA 1DY9A 1Y3VA 3CENA 2H2ZA 5GWZA 3F0OA 2VB0A 2WV4A 4ABFA 1LDTT 1UTOA 3M36A 1WSSH 3QTVH 2C8ZB 6GCHG 1OOKB 5C5OA 4XDEA 1GDUA 1C5QA 2ZCLP 1QRWA 2O8MA 4O3TA 3G01A 1V6DA 1W11U 3ZV9A 4H6SB 3OX7U 1ZLRA 1V2VT 2Y81A 1PPFE 3GY5A 1Z1IA 3SUEA 3FP8E 3MNBA 4A92A 3UWJH 1J9CH 6ESTA 1ZSLA 2ZDKA 4E06H 1K0HA 2GZ8A 1YP9A 2ZF0H 1GJDB 1UK2A 1IQFA 2D2DA 2VNTA 3Q77A 1WOFA 2FOHA 1MTWA 3CP7A 3SZNA 1TRYA 4ABIA 4NFFA 1ZMLA 1DPOA 5F6MA 2BQ7B 1S81A 2FYRA 2GMTB 1N8OC 1FI8A 4HZHA 1AVWA 3U69H 1O3EA 2P59A 1BUIA 1O5BB 2FOAA 2CHAB 2PR3A 2TRMA 1QL8A 3RXJA 1GI0A 1XUHA 1FY8E 1O2NA 1DANH 1MH0A 1O5EH 2W6JD 2K8IA 4O9VA 1YLNA 2H1UA 1OWJA 3A84A 4CBNA 2ZTZA 1WCZA 3MU8A 1HAVA 1K1JA 1GL1A 4FUHA 1T8NA 5A8YA 1VCWA 3UWIA 2AFQB 1A0JA 2RG3A 4Y7AA 4B2AA 1O5AB 2ZU4A 1S6HA 2EI6A 2FOMB 4ISHH 3SGBE 1K1IA 1O2LA 1XUKA 2PW8H 2VVCA 1CQQA 2C8XB 1TQ7B 2ZPSA 2BD5A 3FZZA 2FTLE 4JYTA 5FPYA 3RU4T 1LQDB 1O2YA 1IAUA 1SGEE 3O8DA 3RXHA 1ZSKA 2VH0A 1TAWA 1PYTD 1L0ZA 3GDUA 1Z6JH 2ZQ2A 4ZXYH 3R0FA 4INHA 2ZA5A 5K7RA 3SHAH 1VCPA 3B23B 4VGCB 1MQ5A 4JCNA 1PQ7A 4YT7H 4CRGA 5HM2A 3A7YA 4WH8A 1SQAA 1SR5C 3ZV8A 4O3UA 2NU2E 2BB4A 1P11E 1P9SA 1D3QB 2CMYA 1PPHE 2ZHDA 3A7TA 3TLOA 2BLOA 2QGRA 1O2GH 2BXTH 2ANKH 3HK6B 1SFIA 1OWHA 1C1NA 1SGNE 3NK8A 4ZHAA 1E34B 3QWCH 3RDZA 3A7VA 1P3CA 4I8KA 3A8AA 3LGVA 2FXRA 3P95A 3AAVA 1NU7B 4FUBA 2ZC9H 1CT0E 5JBBS 2ULLA 2R0LA 2B9LA 1DXPA 1SGFG 2Q1JA 3PRBA 6GCHF 2OBOA 3M35A 1F0UA 2ZU3A 5J4SA 1C1UH 1MBQA 4B75A 5EPNA 1WTHD 2Y7XA 3BTGE 1RRKA 3IWMA 1O5GH 2UUKB 5GDSH 3Q00A 1WQSA 2KAIA 1FQ3A 3WWBA 1UCYK 3M3TA 3NZIA 5CHBA 1TNJA 2DUCA 1V2RT 1SHHB 1C5XB 2DE9A 1FN6A 1DLKB 1ELBA 1O3HA 2ZDLA 1EPTB 2C8YB 4K8YA 2GVFA 1DLEA 3LIWA 4MVNA 3EYDA 1GMHG 3EDXB 3ESTA 1SGFA 1SOTA 3RC6A 4AB8A 3K65B 5EIYA 3U8RH 4XRNA 2M2AA 1O2JA 1U6QA 5JB9S 3ZZ3A 2J38A 2YMSB 2AYWA 1UVTH 5GNDA 3EE0B 1C4U2 3GCOA 1OP8A 1CGJE 2F9OA 4KP0A 1IQHA 2EI7A 3A82A 3FANA 4OM9A 2VIDA 3PV4A 3I29A 1JOUB 1ZR0A 1ARBA 1YM0A 2HLDD 2C3SA 3LPRA 4BXWA 4X1SU 2P95A 2QAAA 3ZYEA 1O3NA 3PMBB 1RIWC 1GDNA 3MH6A 4K5ZA 3K2UA 2GDEH 3VB4A 1WV7H 2A5KA 1OSSA 3F2HA 2IPQX 1PPGE 1C1OA 2WHXA 3F1SB 5EOKA 2SNWA 1Z8JB 3Q3YA 3VXFH 1C1WH 1K9OE 2SNVA 2XTTB 1BTHH 4YTAA 1YCPH 2WPMS 1JIMA 1TONA 4XBCA 2ZDVH 4U01A 2F43B 1EJMA 5FBEA 1NS3A 1KLJH 3ATIA 3SHCH 4FU7A 2PUQH 3RXPA 1AI8H 1H8DH 3AAUA 1VJ9U 5KGOA 1FAKH 2OQUA 3H7OA 2SFAA 1D3TB 1QRXA 1F2SE 2RDLA 2GZ7A 3PO1B 1O5FH 5C5NA 3RXLA 2A7JA 2ZGHA 5LPFA 2HALA 4LOYH 3MQKC 2V35A 1TNHA 3UTUH 1UVPA 4Q7XA 5FBIA 3S69A 4B1TA 1A7SA 1D3PB 2FX4A 4I32A 4NWLA 3EGKH 4CBOA 1V2QT 3B9FH 2BVRH 2EI8A 1S6LA 2OC0A 5JBTA 4ABAA 2BDBA 1SOZA 4PROA 1IQNA 1HDTH 1S0QA 1F5LA 5DP5A 2JETB 2Z94A 5A2MH 3TJNA 1BMLA 1MQ6A 1UW7A 2G81E 4AG2A 1HGTH 1Y5AT 1C5VA 3WY8A 3A7XA 1C2GA 1GBKA 4DVAU 5JB8S 1GVKB 4M9FA 1OPHB 1WUNH 1QB6A 2ZFTA 3SUDA 4FETA 4KTSA 2OQ5A 3FFGA 1P9UA 2Z9JA 3S9CA 1O3DA 1TA6A 5B6LA 3E0PB 1KDQB 4TWWA 8GCHG 2GP9B 4CHAC 1E1QD 4XSKU 3PV2A 3S9BA 2YMSD 4J1YA 1V2UT 3E8LA 1CBWC 4XBDA 2FI5E 2G5VA 2W7SA 2FPZA 3TGJE 1HAYB 4JYVH 2ZEBA 2DE8A 5ABWA 3RXRA 2P8OB 4CRAA 1QL9A 2IN2A 1COWD 2FWWA 3ENSB 2BVSH 2H9HA 1MKXK 1XXDA 2BD9A 2BVXH 2FODA 1LVBA 4R0IA 1MD8A 1OP2A 3DHKH 3WW7A 1KXDA 4FUIA 1GCTB 1XUGA 2ZKSA 2ZDNA 2BD7A 4BAHB 1C5LH 1AHTH 1Y5UT 1NM6A 2J9NA 1DWDH 1K1NA 5JBAS 4DCDA 1K1OA 1DDJA 1TX8A 1C2KA 1P04A 1QA7A 2GT8A 1K1PA 3SGAE 4IGDA 2SGAA 3M5LA 1GBEA 1P02A 1C5UA 2ZTYA 4Y8YA 3RXAA 1BDAA 2IJOB 3MMGA 2XBYA 1YPHC 3VB6A 3TNTA 5LPRA 5JPMH 2PTNA 2PKSB 1OYQA 2F83A 3KGPA 1DUEA 3SJ8A 1AFEH 6CHAC 3VB3A 3Q3XA 3TU7H 4U30A 2BY5X 3NCLA 1GI2A 3HGPA 3HPTB 1TBRH 4X2YA 1WU1A 2Z7FE 4A1TA 1TRNA 4P02A 5E8EH 4BTUB 5TCAA 3KCGH 4Y76A 1HBTH 2W3KA 4OS4A 3UUZA 2PTCE 1TNIA 2AH4X 5EJLA 2BDYA 4IN2A 1V2LT 2HOBA 5DG6A 2UWPA 4YLUA 1K28D 1VR1H 2FP7B 2CN0H 3ATLA 3ZZ6A 1CA8B 1UVOA 1P2JA 3UOUA 3SU3A 1TQ0B 1O2HA 1TPPA 1YBWA 2BDAA 2BZAA 2V7QD 1LCYA 1ANCA 3KQCA 4AC9A 4H4FA 1DXWA 4HG6A 3BTEE 1TOCB 1V2NT 4JYUH 2TBSA 4DIIH 3SU5A 1HJ9A 5C1UA 2IOTA 4X8SH 2XOKD 2FM2A 1VGCB 4GLYA 2FTMA 3ATMA 2P93A 4QT8C 1OP0A 2ZZUH 1D6RA 1P0SH 2FS9A 4AFZA 4GAWA 1ELTA 1OYTH 2KAIB 2TIOA 1DOJA 3MU0A 1RXPA 4ZKRU 1V2KT 2XWBI 1SLXB 2NU4E 2NWNA 2R9PA 3F9HA 2W3IA 4IC6A 3SQHE 1KXCA 3URDA 4WXIA 2GMTC 4WH6A 1C5ZB 3RUOA 1OHHD 1AWHB 1GMCG 5CHAB 3BTFE 1LQEA 1YPLH 1TX6A 2ZFQH 3GCTG 2FOBA 2FZZA 1YF4A 1ANEA 2A45B 4Y10E 3SV9A 2P3UB 4K8BA 3LGWA 4IBLH 1KTSB 1MAXA 3DD2H 2XC4A 4CRBA 3A81A 4X1QU 2A5AA 3C1KA 4TT3D 1V2OT 1W8BH 4ABEA 2QYIA 3SV8A 1Y3WA 1OWKA 3E6PH 1ZGVA 3HATH 4YT6H 4ISLA 9LPRA 5IK2D 4IMZA 1C2HA 1TB6H 3MNCA 3ZZDA 1H9HE 2IJD1 1HLTH 2F9PA 4NA8A 1ELEE 3OU0A 3CS7A 1F7ZA 2OLGA 4NIYA 3PLPA 2ANWA 4AYVB 1SBWA 1GBIA 3SNAA 5EW1H 5A0AE 1FAXA 2VGCC 1EKBB 3SQEE 2BMGB 2XBXA 1A2CH 1TMBH 3T27A 2XYAA 1THRH 1C1QA 5F03A 3LH3A 3LOXA 1GHXH 2LELA 1XUIA 1KIGH 3PM3A 3TK5A 1E37B 1YLCA 3M7TA 4B2BA 4MG3A 2ZG0H 3KQDA 3ODDA 2AEIH 5SGAE 1W12U 3D23A 3T29A 1P2KA 2OUAA 1ETRH 1W14U 1Z8RA 2VWMA 1Z8GA 2G55A 2ZTXA 3NUMA 5CMXH 2A2QH 3SU4A 1EZQA 3QTOH 2H5DA 2JH5D 4I33A 3MTYA 4SGBE 5AHGH 1E35B 3BTDE 2PWXA 2QF0A 3MO9A 2QXGA 3KYFA 2O8TA 1ZPBA 1W3CA 1C2IA 1AO5A 1AUTC 3L6PA 5TCCA 3UQVA 2EY4C 4Q2KA 2WUBA 1JMOH 3TIUA 2BLWA 5FL7D 4K69A 3ZVEA 1ELCA 1HAXB 2ZPRA 3KN2A 3PMAB 3U98H 1TFXA 3H09A 3TGKE 4BAQB 3GCHC 3I77A 3ZVFA 3BTHE 2KX4A 1FNIA 1AVGH 1P57B 3PWCA 2F91A 2YNAA 4FUGA 4BTTB 3SYJA 2A4QA 1NFWA 4MLFB 1ZMJA 1HV7A 3GYMA 3U28C 4F48B 1QHRB 1LVMA 2WPIS 3MO3A 2UUYA 1IQKA 1EPTC 1DX5M 4NA9H 1O2ZA 1BTWA 2A2XH 2AGGX 3STJA 1MTNC 1O2SA 1C2EA 4NWKA 2F3CE 3BN9A 3KIDU 1GJ9B 3LC5A 1UTQA 1DS2E 4X8TH 4ZXXH 1AFQC 5EQQA 3GCTF 1SLWB 2OP9A 2IPHA 2Z9LA 1O3BA 3OE7D 1HAZB 2AMQA 2GDDA 1BIOA 2RFKC 1O3PB 2A4RA 2YMSC 2VIWA 3BEFB 1SB1H 3BG8A 1HAOH 1V3XA 1G3CA 3ATKA 3NRLA 4YO9A 4F4OC 1C5MD 2BDIA 1DSUA 1K2I1 1GBHA 1LHDH 1ANBA 3TNSA 1G37A 3AK5A 1GHWH 1D3DB 3DFJA 3LC3A 1QZ8A 3RXUA 1V2JT 4K1EA 1MCVA 3TITA 5C1XA 1KLTA 1QFKH 5L6NH 1TX7A 3A87A 2KCYA 2XRCA 5K0HA 4THNH 1C5PA 2BX4A 3A80A 2RA3A 4ZROA 1BA8B 1ESTA 2GCTB 2WSSD 4A7IB 1HJAC 1QR3E 1KDQA 1CSOE 4X2XA 4X2WA 1EJNA 5F8ZA 4X6OA 3SJ9A 1E0FD 3LGYA 1DUAA 3T25A 1AY6H 2K0QA 1C5SA 3QDZB 3SV7A 1BTXA 3P8GA 3VB5A 4TWYA 3A8CA 3N99A 1L4ZA 5EJ1A 1GWAA 1WTGH 4WMDA 5AF9H 2J34A 3MHWU 5A8ZA 2VWLA 1H8HD 3BG4B 3IG6B 1NROH 1O36A 1C5WB 3PO1C 3KL6A 2WYJA 1CT2E 1BRUP 5BPEA 3UOPA 4ACBA 3GICB 2J98B 5DP3A 1O2MA 1GBDA 3IITA 1YLDA 4XBBA 2ODYB 1O5DH 2OXSA 3L3TA 1OWEA 2ASUB 4Y11E 1SGCA 3MH7A 1GI9B 1JWTA 1YPGH 1Y3YA 2JETC 4AZ2B 1B7XB 2A7HA 2B8OH 3ZIAD 1HRTH 1HUTH 1G3DA 3EA9A 1EAIA 3KEEA 3AVZA 3DCLA 1RGQA 1AGJA 1GBLA 4RKOB 4INKA 1GG6C 1C5TA 3PLKA 1NTPA 1O30A 1D6WA 2CGAA 4UONA 1BQYA 1YCPK 1PPEE 4WVPE 4BNRA 1A5GH 5DP6A 3UNQA 5LPEA 2ZIQH 2Z9IA 1O3AA 2GCHG 3EA8A 3LDXH 3SNCA 4A6LA 2BY9X 4UE7H 1A1RA 4TYDA 4ACAA 1TNKA 1A46H 1DFPA 5DP4A 4CR9A 1LKBA 1CA0B 2STBE 1CGIE 1E79D 1Y3XA 4YOIA 1KMHB 1NRQH 1EFRD 2VINA 5FAHA 2BQWB 4ZHMU 2ODQA 4AYYB 1ELVA 4Y79A 4DG4A 1O2VA 1BRAA 2B0FA 3OY6U 3BTWE 4JMYA 3UR6A 2PUXB 2XC0A 1O3GA 4BAOB 4WF8A 1HFDA 3SV2H 2ZU5A 4DW2U 3MNXA 1Y59T 1UVUH 1W0YH 2OCVB 2A32A 5T1VA 1TLDA 1BTPA 1EZXC 2WV5A 2Z9KA 3UFAA 3EAJA 2BD2A 2KCAA 1C2MA 2OC8A 3TK9A 5J4QA 4XFQA 3W94A 2KCPA 1XM1A 4OS6A 1E36B 2J95A 4GUXA 3T5FH 3TPIZ 2J4IA 1JBUH 5IYTA 4X8VH 3TGIE 1O2XA 2FLBH 3UQOA 3SORA 1SGIB 1P2IA 5F53A 3ZZCA 2H9EH 4GPGA 4OS2A 1KY9A 1ZMNA 3D65E 3MWIU 3RMNH 1V2TT 1SPJA 1LPKB 1S0RA 4Q4LA 3RC4A 1SFQB 4WMFA 5EJZA 3O8RA 4JZIA 3GY4A 4X6PA 2O8UA 3QZRA 5EPYA 1DWCH 1X7AC 1KTTB 1AVXA 1LHCH 1N6YA 3NWUA 4X6MA 1AD8H 5F8XA 1G9IE 1RD3B 5PTPA 1QJ7B 4NCYA 2KZ4A 3SBKA 2BLVA 2QIQA 1ETTH 3LGUA 2SGPE 1C2LA 3RC5A 4ZCNA 5ESTE 4X8UH 1XX9A 2Y80A 4FUJA 3S9AA 5HIZA 1ZZZA 2OD3B 1O2UA 2YOLA 5EXNA 3NXPA 3P70B 4I7YH 3F0PA 3V7TA 2F9UA 4Y0ZE 3ZZ7A 1NBMD 1Z71A 4AORA 1H1BA 2Y7ZA 1BRCE 1DSTA 4I8LA 1UTKA 5DN6D 4FVDA 1UTPA 3W1EA 1A3BH 3UAIC 3F68H 1NY22 1T4UH 1P2MA 5DP9A 1GPZA 1P2QA 3B8JA 2GZ9A 1G2MA 2G4TA 3LU9B 1FXYA 3RLWH 4DT7B 1C2FA 1DT2A 5GCHF 2Z9GA 2HVYB 2V3HH 1AQ7A 1ZSJA 3W95A 5T6GA 3E91A 2JJ1D 1ESBA 2SGFE 2V6NA 3VG8A 1Q3XA 5H4IB 1TOMH 4GCHG 3MH5A 2GCHF 4FU8A 2SGQE 1O38A 3SGQE 4B71A 1VJAU 2Z3DA 3OSYA
chains in the Genus database with same CATH topology
1E38B 3LJOA 2K1QA 5CHAC 4BAKB 1P06A 1DVAH 1GI1A 1GVLA 4DURA 1RJXB 4K60A 1EATA 2A4GA 1O3CA 1QY6A 4WXVA 3U1JB 1YPMH 5EW2H 1FY1A 3FVFB 1GBBA 2GX4A 5AFYH 4RN6A 1SSXA 1BHXB 2FLRH 2ZFRH 3KQBA 5GPIB 5DPAA 1CT4E 2FO9A 3F9GA 4IS5A 4ZMAH 1QRZA 3FAOA 1AB9C 3ELAH 1LO6A 3SI4H 2Y5GA 4NA7A 8LPRA 2ZP0H 5LGOA 3OY5U 5E0GA 1T8OA 2QXJA 1GMDF 3SI3H 3SU1A 4IC5A 2G5NA 2ZGCA 1ZPCA 3U8OH 1MKWH 3RXIA 1HYLA 1BB0B 2XCNA 2J92A 4MNWA 2BDCA 1QIXB 3RMMH 1G32B 1ZRKA 4X0WU 1KXBA 1MZDA 3TVJB 3O8CA 1UTMA 1DE7H 4U2WA 1MMJN 3K6ZA 4ZKSU 2OTVA 5JBCS 2ZWLH 1GI8B 1JRTA 2FMJA 2FOCA 1TNGA 3H7TA 1WBGB 2R3UA 3SN8A 3QUMP 1HAHH 1SGYE 4JZFH 1GHAG 5EODA 2HNTE 1YPHE 1MZAA 3U9AH 1P12E 3L33A 2QXHA 2FOEA 4A1VA 1EASA 1F5RA 1B0FA 4AGKA 1MU8B 3LONA 1EAWA 1BTUA 1FY4A 1GVZA 2R2WU 4RSPA 4MPVA 1S6FA 1B5GH 2HRVA 4ZKNU 4GHQA 1ZOMA 5E0HA 5C67A 2BTCE 2HNTC 2BYAX 3M3SA 2XBWA 4A1XA 4A5TS 3GY3A 3AW1A 4YESB 1A0HB 1ZPZA 2BXUH 3JZ1B 1C4Y2 1HNEE 4FU9A 1PYTC 1NRSH 3SU2A 4K1TA 5EU8A 3MO6A 1S85A 3UPEA 2ZO3H 1F5KU 1O2IA 1S5SA 3MI4A 4X6NA 4GCHF 7GCHG 1UHBA 4E7RG 5GIBA 1LHGH 2ZDMA 5ESBA 2ZDAH 2D8WA 3S0NA 2BD3A 1FZZA 1GJAB 2BZ6H 3RXTA 4NZQA 1F0SA 1H9IE 2A1DB 2BOKA 1GBCA 3M7UA 1DM4B 3MYWA 1FY5A 3PTNA 3VPKA 1C1VH 1GJ7B 3CS0A 4GSOA 4U32A 3GYLB 2CXVA 4CH2B 1TPOA 3BTME 4JZ1A 1HAGE 1THSH 2D1JA 1FIZA 5FCKA 3PB1E 3UNSA 2VIVA 3BSQA 1TA2A 2XWAA 3VXEH 3RXMA 7ESTE 1T8MA 2ZGJA 5EXMA 2SGEE 5L2YH 1BOQA 1SHYA 3A8DA 3E16B 4X1PU 4Y71A 3SV6A 3BEIB 3SJOA 1DICA 3MU4A 3A86A 2ODPA 1K1LA 4CH8B 1PPCE 3A83A 3RM0H 1L4DA 3ZZBA 3GDVA 4E7NA 3T28A 1YC0A 1RIWB 1RTKA 1O3FA 1IQMA 3V13A 1QB1A 3EQ0H 1GBFA 4Q80A 2AIQA 1ARCA 2CHAC 3VGCB 1EXFA 3F9FA 3Q3KA 5HM9A 2FOFA 1AUJA 2ZFPH 3TH3H 4AGJA 1OWIA 1C5YB 1O2OA 1SGDE 2VIOA 2O8LA 3V3MA 1ELGA 3RP2A 3TH4H 2UUJB 1BCUH 2FYQA 1GHAF 1QBOA 3BG4C 5JDUB 4HFPB 1QNJA 5I46H 1O33A 1O37A 4KKDA 1IQIA 2H9TH 1O2PA 1P8VC 1FONA 3QGNB 1ABIH 1UTJA 3A8BA 1BBRH 2O8WA 3RU4D 2BDGA 3BTTE 2HGTH 3UR9A 2AS9A 1GDQA 1SQOA 1MCTA 3M5NA 3PLBA 4DJZB 1EB1H 3S7KB 4AFQA 1DITH 1O32A 2AMPA 4AX9H 1L1JA 2Z3CA 3MOCA 1LVYA 3GISB 1QBNA 4D76A 1P03A 4WMEA 2AGEX 1TBZH 3H5CB 3BIUH 2ZU1A 2OC1A 2A4OA 2ZHWH 4YZUA 4VGCC 9ESTA 3VB7A 1O3MA 3P8NA 1NFXA 1CO7E 3ZVGA 1OKXA 1SG8B 1VITG 2UWOA 1MD7A 1TGNA 7KMEH 1BITA 7GCHF 2V3OH 1TMTH 1OX1A 1KXFA 1Z8IB 4LXBH 3SJIA 3F6UH 5LH8A 1GJ4H 2PLXA 1J8AA 1OS8A 3PYHA 2HVXA 4NSYA 5C1YA 1GGDB 1M9UA 3A7WA 1D9IA 3LJJA 1MTVA 2G4UA 5FXLA 3M37A 1QJ6B 1GI3A 3A85A 1GJBB 1QA0A 4MNXA 1AKSB 1FDPA 4Q7YA 4B74A 4ASHA 1F92A 1GHVH 3UREA 1BTZA 4H6TA 3SUFA 5TJXA 1AZ8A 4ZAEA 1L1GA 1SGRE 1KLIH 1O3JA 2ZFSA 2TGTA 1TGBA 1N6XA 3RXCA 3QO6A 5GXPA 1GJ8B 1RTFB 1O2RA 2C4FH 5GJ4B 3PROA 1J14A 5C20A 4K1SA 1LVOA 4OGYA 1YPKH 2AERH 1QQUA 4Q7ZA 3TK6A 3P6ZB 1GJCB 1EZSC 1O5CB 3LKWA 2HWLB 2ZPQA 2OBQA 2WPHS 1GI4A 2GTBA 1NPMA 1YPJH 4ABGA 3DUXH 1EB2A 4LZ4B 1CHOG 1ZTJA 3FZDA 4NSVA 2VWNA 2QF3A 1AMHA 1ZGIA 3Q76A 1UMAH 1P05A 4OS5A 5L30H 1TABE 3DA9B 1W13U 1GHBF 5E2OA 1DY8A 2A0QB 2C90B 3LGTA 3BIVH 1QTFA 2VJ1A 1UJ1A 1AE8H 1C5NH 4NGAH 1LKAA 4XOJA 4IN1A 4UFFH 1UK4A 3U8TH 1PPZA 4ABDA 3BTQE 2NU1E 3NPSA 1V2ST 3UNRA 2SGDE 1GJ5H 1NN6A 3ZZ5A 4F49A 1HAPH 5HGGA 4NZLA 1LHEH 1WAYB 2VIPA 1TWXB 2ZHQH 4DIHH 1ZHMA 1O39A 4BAMB 1ZJDA 1C4V2 1RS0A 2ALVA 3SNDA 1VITF 1QQ4A 5T6FA 1AWFH 1K1MA 2B7DH 1Y8TA 1LHFH 1UHBB 3MNSA 1TE0A 3ZZ4A 4X2VA 4ZH8A 5EXLA 4TY7A 3RM2H 1W7GH 3ZYDA 2GD4B 1XKBC 2A5IA 2BQ6B 1A5HA 1ID5H 2J2UA 4JK6A 4MPXA 4ESTE 4E05H 1SGQE 1O2TA 2WYGA 3MH4A 4FUCA 2P3FH 1EOLA 2W7UA 1ESAA 1PQ5A 5ETXA 2PGQB 1EAXA 1KXEA 1BHXF 3MFJA 1C2JA 2J94A 1O0DH 1TALA 5GCHG 1CVWH 2I6QA 2P94A 2ANYA 5DP7A 2Q6FA 1SI5H 3U1IB 1P10A 3PMJA 3FP6E 4K2YA 1Q31A 3SNEA 1NRPH 4XE4A 1P2OA 1PFXC 1UVSH 2P3TB 1FY3A 1TIOA 1S82A 4B76A 5HYOA 2EA3A 4WY3A 2VGCB 2FI4E 1N1LA 1H8IH 1P2NA 1XUJA 3MU5A 2ZHFH 2THFB 2LNCA 1EAUA 5E2PA 3K6YA 6LPRA 1RTLA 1CHOF 3RU4E 2P8OC 2QCYA 1O31A 1QGFA 1Z1JA 1KSNA 2PSYA 4FUDA 3RXVA 3PTBA 4YOGA 4MPWA 2XC5A 1G3BA 3OYPA 1Y5BT 1FPHH 1GCTC 5DP8A 1FIWA 3PWBA 1GBTA 3F9EA 3QZQA 1BBRE 1IHTH 1THPB 1WQVH 4FVBA 2ZNKH 4OS1A 5DO4H 1YYY1 2ILNA 1TBQH 3AASA 1GMDG 3P8FA 1BT7A 1BZXE 1P09A 4CRCA 3BEUA 3K9XB 1HIAA 2CF8H 5I25A 4AN7A 2PKSC 1MKWK 3GY6A 4IW4E 2XW9A 1AN1E 1SMFE 1BMMH 1H9LB 5T6DA 2ZCKP 5DK1A 2JKHA 1NRNH 5A09A 2AMDA 1AU8A 3RXEA 5HMAA 1ZHRA 3GCHB 1NESE 1AE5A 1P01A 4NIVA 2ZHEH 1BRBE 3GOVB 1MBMA 4IMQA 1XXFA 4AB9A 5EQSA 1GJ6A 1T8LA 3DFLA 3TH2H 2PGBB 2FEQH 2ZI2H 2ZGXH 3DT0H 2PHBA 4FUFA 1PQAA 1MTNB 1QJ1B 3E1XB 1EP5A 4AFUA 3LH1A 4SGAE 1PQ8A 1AFQB 2F9VA 3SW2B 1EP6A 3KHVA 3QK1A 8ESTE 2A7CA 1PPBH 2R0KA 3T62A 2WINI 1G3EA 4X1NU 1XVOA 1FN8A 1ZJKA 4KTUA 4R8TB 2R2MB 1SGTA 1GBMA 1TPAE 1VGCC 2FESH 5L2ZH 1C5RA 1ELDE 1MTSA 4JZDH 4Z6AH 3RMLH 2H6MA 2PKAA 1BJUA 1GI5A 1SL3A 1YCPM 4BTIB 1KYNA 1WYKA 1GCDA 1O2QA 4JZEH 1SGPE 4BXSA 1HXFH 1LPZB 2BY7X 4WJG2 1CE5A 3ZVBA 4MDSA 1IOEA 2CV3A 2F9BH 1A0LA 3VGCC 2XCFA 1IQEA 2G8TA 3GDSA 1O3IA 4ISOA 1MAYA 5CE1A 4B2CA 2FX6A 1HJAB 1V2WT 1AIXH 5B6OA 1AKSA 1N8OB 2VU8E 5EG4A 1OWDA 1JXPA 2FOGA 1BTYA 1EQ9A 4NIWA 1C1RA 3SU6A 1F0TA 1BMAA 1AZZA 1A61H 2BY6X 4KELA 1Z6EA 2Y5HA 4O97A 3A7ZA 3T2NA 4ISIH 1A5IA 2W26A 1TGSZ 2XXLA 3ITIA 3V0XA 4K3JA 1L1NA 1A3EH 1EUFA 1INCA 1O3OA 3KF2A 4X1RU 1NRRH 1ZTKA 1GHZA 3STIA 1HB0B 3T26A 2NU3E 2WPKS 2Q6DA 3M3VA 3E90B 4DY7B 2AIPA 2VVVA 1TPSA 2TGPZ 1C1SA 3RMOH 4CREA 1UCYH 2Q6GA 3NKKA 4UDWH 2Y5FA 5A8XA 1W7XH 1GG6B 1V2PT 5A0CA 1O3KA 3RXKA 3VEQB 1ETSH 4ABBA 2ZQ1A 1W10U 2C8WB 1O34A 5DGJA 1XKAC 5E0JA 1HJ8A 1FPCH 1MUEB 1SQTA 3ZVAA 2BY8X 1IHSH 1GGDC 2TGAA 4YM9A 3O8BA 2V0BA 5JYIA 1VITH 1IQGA 4DGJA 1ZRBA 3N7OA 4AFSA 1GMHF 2G51A 2VH6A 3M5MA 2ZCHP 2FS8A 3M7QA 2UWLA 2UUFB 1BJVA 1HCGA 4RKJB 1C9PA 2WPLS 3GY8A 1NFYA 1BBRK 1D4PB 4MNYA 3ZVDA 1XMNB 3JZ2B 5EQRA 2JH6D 2QV1A 3ZZ9A 3HKIB 3R3GB 1HAVB 2BM2A 5A0BA 2ESTE 2OINA 4OGXA 1QURH 1J16A 4H42U 2ZFFH 2Z6BD 3LGIA 5C2ZA 3MU1A 2G00A 1EOJA 5FPTA 2Z3EA 3HGNA 5FPSA 1S83A 2QN5T 1XUFA 2BX3A 1P3EA 4D7FA 3M5OA 4AG1A 4Z0KA 1G36A 4ABJA 4MTBA 1TMUH 2VWOA 4B73A 1Y3UA 3D62A 3GCNA 3RXBA 2BD8A 2HNTF 1S84A 4INLA 3ZZAA 1A4WH 4MQAA 2XBVA 1GHYH 2VIQA 4FXGH 3SU0A 3RXSA 7LPRA 2ZECA 1QCPA 1HAIH 1T31A 4ZHLU 1ZHPA 3M61U 2Y82A 1J17T 4UD9H 1EX3A 4OS7A 5EGMA 5G4BA 3SUGA 1DWEH 3P17H 1IQJA 3OTJE 3V12A 1H4WA 3BV9B 2OC7A 5FCRA 5F8TA 1ZTLA 2PFEA 2QY0B 1C5OH 2EEKA 2RCEA 2BD4A 2GCTC 2AGIX 1G30B 2B5TB 1HIAB 1NZQH 3C27B 3SJKA 3BTKE 4Y7BA 3RXGA 4FUEA 1Z7KA 2D26C 3RXQA 2HLCA 1BMNH 4Y0YE 4D7GA 2RA0A 4TPYA 3P8OA 4NIXA 1GBJA 2QC2A 1K21H 4J2YB 3A88A 1FLEE 2YNBA 1QBVH 4MNVA 1T32A 4D9QA 2VVUA 1W0ZU 1C1MA 2BHGA 3LT3A 4KTCA 1B0EA 4DOQA 3TJUA 3VFEA 1C9TA 2GV6A 1NC6A 4TY6A 3UIRA 1UK3A 2F9NA 2BOHB 5C3NA 2PV9B 1W2KH 1GHBG 4HGCA 5DJ7A 2R3YA 5FX5A 3AW0A 1VZQH 2ANMH 3UY9A 1O35A 3SO3A 2A31A 1TNLA 3PMHB 1FJSA 8GCHF 3FP7E 4O03A 1LPGB 1F0RA 4LK4A 4Y8XA 2C93B 4JK5A 1TYNA 3RXOA 1C1PA 1XVMA 2G52A 1IQLA 1ABJH 1ACBE 5HXFA 1FUJA 1FV9A 1QB9A 4I8JA 1Q2WA 3E3TA 3RXDA 3EA7A 4UFEH 1MKXH 4NG9H 3RXFA 2BLQA 2CJIA 2FIRH 4GHTA 4CRFA 1NU9A 4Y8ZA 5IDKA 4LZ1H 4D8NA 3P92A 4I31A 4CR5A 1DWBH 1AB9B 1YGCH 4YLQH 3TJOA 2ZU2A 3ZZ8A 1ORFA 1OXGA 1UTNA 3URCA 3A89A 3KNXA 4YOJA 2PKAB 1O2KA 2GV7A 1O3LA 5T3HA 1CA0C 1LMWB 1K22H 1SLVB 4I8GA 1EPTA 1HXEH 2WPJS 5FHTA 1CU1A 4KGAA 2STAE 4BOHA 4ZKOU 4AOQA 1GBAA 3QN7A 2HPQH 1NT1A 1NFUA 1C2DA 1TRMA 2FI3E 2PSXA 1C1TA 2I6SA 3GY2A 1EZUC 1TGTA 3BF6H 3KQEA 2P16A 2BDHA 4CHAB 4D9RA 2WUCA 2HPPH 3ODFA 2ALPA 1CBWB 1ELFA 1G2LA 4HI3A 1YKTA 4UFDH 4TPIZ 4HTCH 1V2MT 2NU0E 4BANB 3GY7A 2TPIZ 3HKJB 1SC8U 2JH0D 1UTLM 2O9QA 3E0NB 3S7HB 3ZVCA 2QA9E 1GI6A 2H5CA 2LPRA 1SVPA 2EC9H 1UO6A 2Y6TA 3TJVA 2FDAA 2TGDA 1CHGA 4ABHA 2XNIA 1GI7B 3QX5H 1RFNA 1GL0E 2W5EA 4UEHH 3QLPH 1PJPA 4NFEA 5AFZH 8KME2 3ATWA 1KXAA 4WWYA 1O2WA 2GT7A 4GVUA 1EJAA 4I8HA 2GKVE 1SLUB 1UCYE 2CF9H 1MU6B 3QGJA 2M5TA 5FX6A 1TGCA 4Y6DA 6CHAB 1J15A 1T7CA 1ELAA 2ZGBH 4MPUA 1NO9H 4ISNA 1YPEH 1ANDA 3D49H 3HK3B 4UFGH 1T4VH 5BRRE 5DKMA 1VCQA 3I78A 1ZYOA 1GMCF 2QXIA 3RLYH 3SOSA 1JRSA 1JIRA 2GGVB 1FMGA 4M7GA 5AVDA