3RXDA

Crystal structure of trypsin complexed with (3-methoxyphenyl)methanamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxdA02
5AVDA 1O2PA 4UFFH 3TJVA 2QAAA 1QURH 4RN6A 1GI6A 3SGBE 4TPIZ 2G4UA 1P57B 3A89A 4X8VH 1EJAA 5JBAS 4IN1A 1HAVA 1GHZA 4WXIA 5EXMA 1IQLA 2ZFRH 3M3SA 1GL1A 5EPYA 1EZXC 2KAIB 2PKAB 3MU8A 1C5RA 1FY4A 4Q80A 1YBWA 1Z8RA 3PMBB 3ZYEA 1TYNA 2WPLS 5HXFA 1Y3WA 2O8UA 2FOGA 2ZPSA 1SGFG 3LKWA 4M7GA 3RMOH 3UOPA 5LPFA 3RC6A 1MD8A 1P02A 1D6RA 1NU7B 3UQOA 1S6HA 5J4SA 1TLDA 1Q2WA 3MO6A 4D7GA 1AZZA 1OWHA 1DM4B 2YNAA 4Y7AA 1THSH 3SN8A 5T6FA 2YOLA 5C5NA 1KXCA 5C20A 3STJA 2HOBA 4GHQA 2ZDNA 1C1OA 1RTLA 4Q7ZA 1FUJA 3BTEE 1NRNH 2FO9A 2H9HA 4ZUHA 4INHA 2XWAA 4GCHF 4K8BA 1NZQH 1EUFA 1ZYOA 1LQEA 3PV4A 2BLWA 4ISIH 1Z8JB 1CGHA 2AMPA 4YOIA 4INLA 1CHOG 3U1IB 4IGDA 2ZFTA 1JOUB 1P03A 4J1YA 4JYTA 4MTBA 3IG6B 1GMCG 1FI8A 4AGKA 4K69A 1T8LA 4RKOB 4LXBH 5DP7A 1SQTA 2QY0B 3RXRA 3ZVBA 4ZKOU 5E2PA 1UCYH 1UVSH 3T25A 1VGCB 3RXMA 4UFDH 4ABGA 3PM3A 2C8XB 4IC6A 3FANA 1ZOMA 1W7GH 2Y7ZA 4E7RG 3P8OA 1CO7E 2PKSC 2BDYA 1C2MA 1TBZH 1TFXA 2BXUH 2BOKA 2A5IA 1TGTA 2C4FH 2HLCA 2TGAA 1BMLA 2NU4E 2BDIA 4JZDH 1Z8IB 2BQ7B 3SV6A 1YPJH 3AW0A 3HPTB 2WPMS 4B2CA 2ZU1A 2FTLE 1DUEA 1AB9C 1YF4A 4A7IB 1O32A 5LPRA 3KNXA 1O39A 1DS2E 3U98H 1C5LH 4I8GA 2JH6D 3SJIA 2Q6FA 1ZRBA 1XVOA 2VIVA 4R8TB 1Y5BT 1YLCA 2Z3CA 4CHAC 1P09A 1LPZB 5C3NA 1SB1H 2A4QA 9LPRA 2HVXA 2P3UB 5EODA 4B2AA 2TIOA 1L1NA 1O34A 4HZHA 4NIVA 4JZ1A 1OXGA 3OX7U 3RXFA 3BTKE 1PPGE 2TBSA 3P17H 4IS5A 3I29A 1DWCH 1A5HA 2FLRH 5A2MH 1LVYA 3DA9B 3Q76A 1YKTA 1PQAA 1MKWH 3QZRA 1SGEE 4JZIA 4B75A 2ZDLA 1SLVB 2UUJB 4A6LA 1P2KA 1ANEA 1HAYB 1SR5C 1O3HA 3MOCA 1KXFA 2NU1E 4AX9H 1V2PT 4K5ZA 2PLXA 1V2TT 2JETB 1C4V2 1AZ8A 3PMAB 1JIRA 1YP9A 4MPXA 1OS8A 1ARCA 4Y76A 2FXRA 4CRDA 2F91A 5H4IB 4UONA 4IBLH 3K65B 5E2OA 1C2JA 3PLBA 1MTNB 5EXNA 5TCAA 4AGJA 1AI8H 3KQBA 3QGNB 3AW1A 2ODPA 3TJUA 2XTTB 1J17T 1O3EA 4Y8YA 4ZH8A 3UIRA 3TVJB 1A3EH 4NA8A 1WCZA 3KQCA 2ZPQA 4ZAEA 1V2WT 3BG4C 1O2SA 4BAHB 2BQWB 3UOUA 1VCPA 1SGDE 4OS6A 4BXSA 1TBRH 3BEUA 1FY5A 3SGAE 1HYLA 1MZAA 1FLEE 1SVPA 1AKSA 1QB1A 3GY8A 4H6SB 3RXKA 4FXGH 1U6QA 3U8TH 4SGAE 2AIQA 4U2WA 1O2XA 3P8GA 1YPEH 2GKVE 3V3MA 3UFAA 1HAHH 1LQDB 1FY1A 2B0FA 1TMBH 2GCTB 1O3MA 2QGRA 1HGTH 1O3NA 3LJOA 1K1MA 2ZTZA 1V3XA 2BM2A 2O8TA 3GOVB 3KHVA 1QNJA 2JKHA 2J94A 4I8KA 3M7UA 1UCYE 7KMEH 1W14U 2BD7A 1S81A 9ESTA 2AS9A 1TPSA 1H9LB 2TGDA 1Y3YA 2ZNKH 8ESTE 2R0LA 1GHAF 4FVDA 2ZHQH 1GI8B 2OC7A 2RG3A 3O8RA 1C5UA 3Q00A 2ZWLH 3VEQB 2FP7B 1KXAA 1MTUA 1HCGA 1SHYA 2FYQA 4H42U 4SGBE 2VGCB 2A2XH 2CN0H 2EI8A 1ELGA 4Y79A 1Z1JA 4E7NA 4NCYA 1CA0B 2GD4B 1XXFA 2Z9GA 1FIZA 1HIAB 2XBVA 1S5SA 4MNXA 2HNTF 1TX6A 1QFKH 1GBFA 2HALA 3PLPA 1EJNA 1LVOA 3TPIZ 3SNEA 1EAWA 4CRAA 1SGTA 5EXLA 4JZFH 1SQOA 2K1QA 4XOJA 2GCHG 3UPEA 1ELEE 2Z9KA 2UUKB 1YPLH 1Y3VA 3RMNH 1TQ7B 2CMYA 2FM2A 4CRCA 1ID5H 3DFJA 1HAPH 2PHBA 2QN5T 2ZEBA 4UFEH 2CJIA 1O35A 1G3BA 1D3DB 2NU3E 1DWDH 2BVXH 2C90B 1D4PB 4FU8A 1XUHA 3T27A 1WV7H 1JRSA 1F5RA 2XC5A 1SGFA 1H9HE 1DXPA 1TBQH 3H7TA 1JRTA 5BPEA 2J4IA 2OINA 1FMGA 4FUHA 5A8XA 4FUDA 1MUEB 4YM9A 1TNIA 1BRUP 4X2YA 4F4OC 2J95A 2A7JA 1HFDA 2WUCA 2P8OB 3M5MA 5IDKA 1ETRH 4ABFA 1E35B 3H7OA 1GBDA 2RDLA 5E0GA 4HI3A 4DG4A 1TABE 4B76A 2OLGA 1TX7A 1CBWB 1K1NA 2FLBH 1O3CA 4Q7XA 1J16A 4KELA 3AASA 1O3GA 3EA7A 1UTKA 4CREA 2BLVA 1CVWH 2QIQA 3NWUA 2ZGBH 2OP9A 2VVVA 1PYTD 2UUYA 1KY9A 3ZZ8A 1NT1A 3QDZB 1F2SE 3SQEE 5LH8A 1DWEH 1OPHB 4K1TA 1K1IA 6CHAB 2O8LA 4BTIB 2EEKA 1XXDA 3RXAA 1O2VA 3FAOA 1QA0A 2JETC 1NFXA 1W7XH 1C2EA 3TGKE 3ZVEA 3RC4A 2Y5HA 1RTKA 1ZRKA 1ZSKA 1C5XB 5DP3A 1CA8B 1KLJH 1XUKA 3O8BA 4Y0ZE 2B8OH 1QL8A 1NM6A 1YCPH 2HGTH 2SGQE 4ZKRU 4E05H 1TNGA 7ESTE 2FDAA 2FX4A 3A83A 2P3TB 1IQIA 1SOTA 2XBWA 3STIA 3RXBA 1KYNA 2WYGA 1MTNC 4FUIA 1SLXB 1V2NT 1C1QA 1GJ5H 1KXDA 1MKXK 5DP5A 1VITG 2BY5X 2XCFA 2UWOA 3G01A 2RA3A 2BDHA 4CBOA 3A80A 3SNAA 4U01A 1GBLA 1A0JA 1C1PA 2ZCKP 4ABAA 1THRH 1AY6H 1FPHH 2HNTE 1VJ9U 1C5QA 1O3PB 4INKA 4GVUA 1OX1A 1CGIE 1HAGE 1IQGA 1N1LA 1QL7A 3UNSA 1O2MA 1BOQA 2KAIA 3Q3XA 2PKAA 5ABWA 1D3PB 2QA9E 1BTXA 3NUMA 2Y5FA 3D23A 1GBCA 3SZNA 5AFZH 4A92A 1S83A 1YC0A 2AYWA 1PQ7A 3BTWE 1V2VT 2A5AA 2FI3E 2GMTB 3MI4A 1B5GH 5FBEA 1A5IA 4I32A 3Q3YA 4X2WA 3TK9A 1O3IA 2GCTC 3MU0A 1E36B 1BTUA 2FESH 2HPQH 5JB8S 1MTSA 1DWBH 1MTVA 3LOXA 1ESTA 1HJAB 3GISB 1MCTA 2J9NA 5FPTA 3ZZ7A 2ODYB 1GJ6A 3O8DA 1NRPH 3AVZA 2Y81A 4MPVA 4R0IA 3K6YA 4I8LA 2VJ1A 3VXFH 2FS9A 4ISNA 4D76A 3HATH 5T3HA 3MH5A 1BHXF 1ZTKA 1AWHB 1S84A 1OWEA 1ZTLA 1LPGB 2OQ5A 3RXOA 3A7XA 3TH4H 2A32A 3SJ8A 1AMHA 1G3EA 2GZ7A 2BMGB 5J4QA 1GI9B 1JMOH 5DGJA 1O5FH 1AN1E 2OC8A 1DX5M 1V2RT 3CS7A 3SO3A 1F0RA 2RCEA 1YLDA 1GGDC 1MZDA 4BXWA 1C2FA 2TGTA 5GCHF 1NRRH 2VGCC 1DY9A 2XRCA 1PQ8A 4ISLA 1CA0C 3CS0A 3SU6A 3SUEA 1VCQA 1O2GH 4Y7BA 1EAXA 2EA3A 1TGBA 2OQUA 4TY7A 1N6YA 2XNIA 3RLYH 1SGPE 2BLOA 1NN6A 3D49H 3KF2A 1IQEA 4GUXA 1BBRH 4LZ4B 1SHHB 3BTTE 4IW4E 1PPBH 5HMAA 1TA2A 3PYHA 2W7SA 2P3FH 5DG6A 1QQUA 3UNQA 2BLQA 3QLPH 2B9LA 2ESTE 2FOHA 2GVFA 3H5CB 2NU0E 2SGAA 1GG6B 3RXSA 1ZTJA 2QV1A 3ATWA 3C1KA 1TQ0B 3K2UA 5FCRA 4KP0A 3SI3H 1ZJKA 1O3LA 3UY9A 1F0SA 4Q2KA 3DD2H 1IQJA 3SORA 3SV2H 1P06A 1BTYA 2BD4A 1T31A 1TRMA 4MNVA 3M7TA 4QT8C 3F9EA 2W5EA 4WH6A 4ZKSU 3IWMA 1ELVA 1FJSA 3RMMH 4X2XA 2SGEE 4YLUA 2FX6A 2ANMH 1C1TA 3HGPA 2G4TA 2J2UA 1TNKA 3DT0H 1OYTH 2ZGCA 4X8TH 2P8OC 4I8HA 1P10A 1UJ1A 2CV3A 4X8UH 3VXEH 1TB6H 2VWNA 2SNWA 3KN2A 2AFQB 2G81E 4ISOA 3HKJB 2FOBA 4WVPE 1CBWC 4FVBA 2WINI 3HGNA 4FUFA 3ELAH 7GCHF 3TGJE 8GCHF 1QY6A 2LNCA 4BANB 4BTTB 2ZU2A 1SSXA 3BIVH 4CBNA 1GMDG 2R0KA 2Z7FE 5A0BA 3U9AH 1EPTB 1BDAA 1XVMA 6CHAC 3HKIB 3ESTA 2PTCE 1Y3UA 3KQDA 2XW9A 1ZMJA 1XM1A 4AOQA 2QXHA 1K22H 3S0NA 1S0QA 2ULLA 1O5DH 1C4U2 3RXTA 4WJG2 1A46H 3UUZA 4YO9A 1TGCA 2IOTA 1GI1A 2PV9B 2H9TH 1O30A 1BIOA 1UK3A 1BRBE 3GYLB 2DE8A 3SU0A 2G52A 3W94A 1V2QT 2A5KA 1QHRB 1G37A 3VB4A 2ZU4A 1L0ZA 4MNWA 1OSSA 1S82A 1QIXB 1CT2E 1SC8U 1DXWA 1MH0A 4NSYA 2VH6A 1C1NA 1TNJA 5E0JA 4OS7A 1RIWB 2F9NA 1W0YH 1GJ4H 3P8FA 2GDEH 5A0CA 2D8WA 1D6WA 1L4ZA 3R0FA 3E0NB 1BRAA 5LGOA 1L1GA 1ANCA 2J34A 3M5LA 4K8YA 1FDPA 4B71A 3E0PB 1GCDA 3ZVGA 3ZVDA 2F83A 3KGPA 2GMTC 2HPPH 1QBNA 2OTVA 4MPUA 5GXPA 1O2ZA 1FY3A 3OSYA 3QX5H 5I25A 3O8CA 2GV7A 1V2JT 2Z3EA 1P2IA 2GZ9A 3MH7A 1HJAC 5EQRA 1O37A 1YCPM 2BY8X 2B7DH 4TYDA 1AFQC 1BTZA 4YOJA 4XBCA 3GCNA 1B0EA 1OOKB 2C3SA 3AAUA 1O3DA 2M5TA 2VINA 2FEQH 3BTHE 4X1NU 4UFGH 1UVOA 3MNBA 1C1VH 2ZG0H 1UTQA 4KTUA 1IQKA 3GYMA 2P93A 1ANBA 5ETXA 2XC0A 1RGQA 4X0WU 4JK6A 1FN8A 3TU7H 5GJ4B 1C5YB 4WY3A 2BVRH 1GBJA 1AIXH 1Y5AT 4AN7A 4IMQA 1G32B 3A8AA 2ZQ2A 1BBRE 4LOYH 1S0RA 3NPSA 1DSUA 2FODA 3T5FH 1BQYA 1AFEH 1WSSH 2BD8A 4HFPB 1BJUA 1RXPA 1RJXB 4UEHH 2VIDA 1GJBB 1HAZB 6GCHF 1GBIA 1HIAA 1ACBE 4DOQA 3GCHB 3QTOH 4K1SA 2VIOA 2PUXB 2QXGA 2ZO3H 1AO5A 2ZGJA 4GPGA 2CHAB 1TGNA 2AH4X 1AU8A 3SJKA 5L6NH 1O3KA 2WPJS 2P95A 1GJ7B 1YPHE 4PROA 4K2YA 3TJNA 1N8OB 1UVUH 2BXTH 5EQQA 2I6SA 1ZMLA 3MU5A 2R3YA 3Q77A 1S85A 1C2GA 2SGPE 1G2MA 1A7SA 1GG6C 3MO9A 3MNCA 2OCVB 3GY2A 4NWLA 3V12A 5DK1A 1MBMA 2BVSH 3S7KB 5GIBA 3SJOA 1FZZA 2AGEX 1O2OA 4KGAA 2ZHWH 4MPWA 3T29A 3T2NA 1K1PA 4FUCA 3LGYA 1O3FA 3BG8A 1FV9A 1P9UA 2ODQA 3SOSA 2ZFPH 2V3HH 3ZV9A 1D9IA 1O2QA 1VCWA 1MTWA 1P0SH 2ZCLP 2OD3B 4JYVH 3LPRA 2ZDKA 3GY6A 4WWYA 1BMNH 4ABDA 2BD5A 4JK5A 4UDWH 1ZR0A 1FAKH 2EI6A 1RRKA 1O2HA 1GBEA 4CRFA 2C8ZB 3ZZBA 5FCKA 1P2MA 4DURA 1DY8A 1RFNA 1HJ8A 2AGGX 3W95A 3LH1A 1Y5UT 2DE9A 2SGFE 3OY6U 5DJ7A 1GBBA 3SU5A 4CRGA 4IC5A 1HXEH 2O8MA 5GWZA 1EX3A 4XFQA 1VR1H 1P3CA 1N6XA 3QUMP 3MFJA 2A0QB 1O5CB 1KXEA 2ANKH 5JBBS 1ELFA 1YGCH 2OC0A 1MU8B 1EPTC 2HWLB 8GCHG 2ZP0H 1NRQH 1BCUH 1XX9A 2ZFFH 4GHTA 2G5VA 2BYAX 2ZGXH 3DFLA 1KSNA 1VZQH 2Y7XA 1CQQA 3SI4H 1GHYH 4THNH 1XUIA 1Q31A 3RUOA 3LGVA 1FXYA 2G5NA 2PUQH 3TH2H 3SNCA 1PPCE 4AFSA 3PROA 1BA8B 1UTLM 2A4OA 2BDAA 2P94A 2BD3A 3RDZA 1L4DA 1O3OA 3SNBA 1GBKA 5A0AE 1ZMNA 1DE7H 5L30H 1TPPA 3A84A 3M5OA 3LIWA 3HK6B 1O31A 4GCHG 2AGIX 2Y6TA 5E8EH 4ZXYH 1BTPA 2R2MB 3C27B 2AIPA 1O5BB 2QF3A 3A7YA 2A4GA 2PW8H 4MNYA 1VGCC 1Z1IA 3SU4A 2XC4A 1P8VC 5ESTE 1BRCE 3MHWU 3VFEA 1BMAA 4NIXA 5JBCS 1RIWC 2D1JA 2ILNA 3GICB 1F0TA 1P9SA 1GJDB 4Y10E 2QYIA 1PJPA 2HRVA 2ZFQH 1OWIA 2P16A 1ETTH 1OWKA 2Q6DA 3VGCB 2H5DA 5EPNA 4NZQA 3M37A 3M61U 1IQMA 2W26A 2A4RA 1HUTH 1SGNE 5FX5A 1ELBA 1QTFA 2BZAA 2IJOB 3A82A 1QR3E 2VNTA 1C9TA 4TWYA 1PPEE 4TWWA 5CHAB 4WXVA 2CGAA 4ZHAA 3ENSB 1Y8TA 2W3IA 3E16B 1QBOA 1PYTC 1AGJA 1SLWB 1ZLRA 4GSOA 3WY8A 1C5OH 1O3AA 5GDSH 3ZYDA 2BQ6B 1C1UH 1QJ6B 4Y8XA 3GCTF 1Z6EA 4CR5A 1K28D 2BDGA 1LKBA 2GX4A 3ZV8A 2ZHEH 1EQ9A 1GHBF 2EI7A 2ZF0H 5AF9H 2PTNA 1GHVH 3KCGH 1QRXA 3PB1E 2W3KA 1GMHF 4K3JA 3LGTA 1SGRE 2ZZUH 2VVUA 1UTOA 2RA0A 1O33A 1KTSB 4NZLA 2UUFB 5F03A 5SGAE 1GPZA 3RXVA 1FIWA 2ZI2H 2D26C 3QK1A 1TNLA 4ESTE 2V0BA 2ZHFH 1PQ5A 1TIOA 5LPEA 4I7YH 5IYTA 1MCVA 2UWPA 1C1MA 3GCHC 1DLEA 1RS0A 1DFPA 4D7FA 3NZIA 4FU7A 1CT0E 4WH8A 3PO1B 2THFB 3VB5A 5K7RA 1GBHA 2VU8E 2STBE 1LHDH 1AUTC 1FAXA 3EAJA 1EZUC 1GBAA 4AYYB 3A81A 4ZHMU 3UR9A 5AHGH 1EP6A 4OS5A 1TAWA 2Z6BD 3SGQE 3A8BA 3E91A 1G2LA 2FYRA 2OUAA 1TPOA 1GJAB 2GGVB 4X1PU 1O3BA 3M36A 1C2DA 1SGCA 1EKBB 4DVAU 1NPMA 1HAOH 1YYY1 3P6ZB 3RXPA 4B74A 1E38B 2OBQA 1O2YA 2ALPA 1T7CA 3LDXH 1GVZA 1AUJA 4NA9H 4AFQA 4DW2U 4AB9A 1EATA 3SBKA 1D3QB 1CSOE 2FOEA 2QCYA 1TA6A 3DUXH 3F68H 4H6TA 3A87A 1ZSLA 1KDQB 1EXFA 3EE0B 3B23B 3B9FH 1UK4A 3DHKH 3BSQA 1CHOF 1D3TB 2TGPZ 4Y8ZA 3M3VA 1NESE 2BDBA 4WMFA 3ATLA 5FBIA 4IN2A 1AVXA 1Z8GA 2H2ZA 4Y11E 3RXGA 2AERH 5JPMH 1GMCF 2ASUB 1QRZA 1NFWA 1SFQB 3F9HA 1NO9H 4OGXA 3EQ0H 1C2KA 2Q6GA 1XMNB 2QF0A 2SFAA 3GY5A 1SG8B 1UHBB 2BZ6H 2AMDA 1GWAA 1SL3A 1HRTH 3LJJA 1C5TA 1K1OA 4B73A 1HXFH 2F3CE 4AG2A 2FI5E 3RXEA 1A3BH 1JWTA 1P01A 1FONA 1ZPBA 2FOMB 2ALVA 3Q3KA 2PKSB 1T8NA 4CH2B 3V13A 1EPTA 1O2JA 3BIUH 5DP9A 1IQFA 1WAYB 1GDQA 1GI4A 1VJAU 1XKBC 5C1XA 5FXLA 3VB6A 1MKXH 4WMEA 3S9AA 4E06H 2FMJA 5C5OA 1O2NA 1LHFH 2C8YB 1ELDE 3MYWA 3RU4E 2BY9X 1ETSH 1O3JA 4ZROA 3VB7A 1RTFB 4AZ2B 2JH0D 2GT8A 1LMWB 3SUFA 1O5AB 2XCNA 1TRNA 3UR6A 2PFEA 2A1DB 2LPRA 1L1JA 1P04A 2ZTYA 4BAKB 1GHAG 2FTMA 2PSYA 4ISHH 5EGMA 3V0XA 1DVAH 1C5SA 1WOFA 1FY8E 3MNSA 2P59A 4BTUB 1ESBA 3MNXA 1FN6A 2FOFA 3NXPA 1O2TA 3PMJA 4A5TS 1K9OE 5DO4H 1OP2A 1P2JA 3VGCC 4YLQH 1CHGA 5FAHA 1ZHPA 4AB8A 1EAIA 1E34B 3GY4A 3UTUH 3QGJA 3A7WA 5CHAC 3TNTA 6ESTA 1P2NA 3SU3A 2GT7A 4NGAH 1L2EA 2Y5GA 1ARBA 1G36A 3ITIA 4FUBA 3P92A 5L2YH 5FX6A 4BAQB 4DT7B 1OWJA 3E90B 1C5VA 2Z3DA 4AORA 4XBBA 1LKAA 5EG4A 3CP7A 1E0FD 4GAWA 1EAUA 2VB0A 1IQNA 2ZA5A 2ZFSA 5HM2A 4NWKA 2G55A 2XBXA 2WV5A 4K60A 3QTVH 3SQHE 1ABJH 3ODDA 1QB9A 1W3CA 4XDEA 3SHAH 1G30B 5EW1H 4ABIA 2DUCA 4B1TA 3A86A 3ATIA 1TGSZ 3B8JA 4X6NA 5T6DA 2BB4A 1NFYA 3BTQE 4U30A 2BX3A 4YESB 4MG3A 4AFUA 1ORFA 1EASA 3SV9A 3KQEA 4UD9H 3K6ZA 3PO1C 5EOKA 2VIPA 1EJMA 4O9VA 1MAYA 2NWNA 1LPKB 2XXLA 4X6MA 3S69A 3A7VA 3ODFA 3BG4B 1BHXB 1GJCB 1HBTH 1V6DA 2VIQA 1TNHA 5HM9A 2H9EH 3PTBA 2CF8H 4FUJA 1MQ5A 2OXSA 3ZVFA 5JB9S 1IQHA 2VIWA 3T28A 1UCYK 3SV7A 1YPMH 2CXVA 1LHCH 1EZQA 4WMDA 3ZVCA 1C2IA 3TK5A 1W8BH 4O03A 1O2WA 3OTJE 2F9VA 1WBGB 3A7ZA 2HNTC 2VH0A 4NIWA 3A7TA 3RLWH 3SHCH 1K1LA 2OC1A 4BNRA 1HAIH 3N7OA 3QWCH 2BY7X 1YM0A 1DICA 3AAVA 1Z6JH 4X1QU 3MMGA 1O2UA 4LZ1H 1ELCA 3R3GB 3TGIE 3RXQA 1QCPA 1SGIB 1T8MA 1NC6A 1V2LT 2AMQA 1GL0E 4OS1A 3FZDA 5I46H 1HNEE 3PWCA 8LPRA 1A5GH 1W12U 2PSXA 3LC5A 4NFFA 4IMZA 3E6PH 1HJ9A 3BTGE 3T26A 4DGJA 1XUJA 1TX8A 1FQ3A 2BHGA 5DKMA 1UK2A 4I8JA 2IPHA 1JXPA 3TJOA 3UQVA 1S6FA 1ZPCA 3PLKA 3BEFB 3U8RH 2CF9H 1WYKA 4U32A 2GCHF 1GI5A 4JCNA 2A7CA 3ZZDA 2B5TB 3GDUA 3EYDA 1BMMH 2XBYA 3VPKA 4I33A 3M3TA 2FOAA 1WQSA 1KXBA 1BTWA 4VGCB 1V2MT 4KTCA 4A1XA 1GHWH 2FI4E 2FWWA 5DP6A 1SBWA 4OS4A 2Z94A 2ZQ1A 3LGUA 1JBUH 1QGFA 2ANYA 4ABBA 4JYUH 4O97A 1MKWK 1UTMA 1X7AC 3L33A 3SUGA 3OYPA 1MAXA 1OYQA 1SI5H 1WQVH 3QN7A 1C5WB 1QJ1B 5TJXA 4KKDA 1T8OA 2ZGHA 3CENA 4YT6H 3F9GA 3URCA 5GCHG 3FVFB 8KME2 4X6OA 1VITH 4XBDA 1HAVB 3RXCA 3BTDE 1BUIA 1GI0A 3FFGA 1OP8A 1SMFE 1A0HB 1C4Y2 2A31A 3PWBA 1QRWA 2BY6X 3RU4D 2VWMA 3S9CA 1IHSH 5HGGA 1ZZZA 2WPHS 2F9PA 4NG9H 3KL6A 4ZHLU 1CU1A 1LDTT 1F92A 2ZDVH 1PPHE 1QB6A 1EP5A 1LTOA 3UREA 1HAXB 2C8WB 3MH4A 4RSPA 3E3TA 1RD3B 2R3UA 4DIIH 2ZCHP 4KTSA 1LVMA 2BD9A 1J15A 1T4VH 1UMAH 1AVWA 1J9CH 2XYAA 4ZXXH 4B2BA 4BOHA 3D65E 1G9IE 1GI2A 3U1JB 1QJ7B 2H6MA 1PPFE 1VITF 1Q3XA 3EA9A 2Q1JA 2JH5D 1NY22 5CMXH 1AWFH 1SPJA 2BD2A 3RXHA 5A8YA 3PMHB 1INCA 1GJ8B 3P8NA 1J8AA 2A7HA 2Z9IA 3A8DA 1AHTH 7GCHG 5JYIA 1AE8H 3OY5U 5GPIB 1GI7B 1Z71A 3RXJA 3MU1A 1C5MD 1CE5A 1OP0A 3RC5A 3V7TA 3BTFE 3TLOA 2ZC9H 1GDNA 1DITH 1UVPA 1ZGIA 2GV6A 3NKKA 2I6QA 1OKXA 2J38A 1NROH 1KLIH 4Y71A 4YTAA 3UNRA 1YPGH 2F9BH 4AYVB 1W13U 2GDDA 5DP4A 2SNVA 1LHEH 4ZKNU 3TIUA 1C1RA 1BZXE 2ZDAH 1MU6B 3LU9B 3M7QA 3LH3A 5F8ZA 3BN9A 4CH8B 2V6NA 1LO6A 5F8XA 1P12E 1P2OA 4YZUA 2OBOA 3GY3A 5EU8A 2EC9H 3MU4A 1Y59T 1JIMA 1IAUA 3NCLA 4MQAA 2ZTXA 1OWDA 3RU4T 4X6PA 3E8LA 1CGJE 2R2WU 3LC3A 1K1JA 1M9UA 3QZQA 1DT2A 1KDQA 3SNDA 2WUBA 4JMYA 2O9QA 1MQ6A 3L6PA 1FPCH 3GCOA 1J14A 3U69H 1YPKH 1ZHMA 2FS8A 1QBVH 3TK6A 1WU1A 3RMLH 2FOCA 1EB1H 3MH6A 3EGKH 1WTHD 4ZMAH 3TH3H 1F0UA 3I77A 5C1YA 1C2HA 5L2ZH 1K21H 1IOEA 1QA7A 1MD7A 1TWXB 1GGDB 1O2IA 1UHBA 3F6UH 4Z6AH 5EQSA 4CR9A 3QO6A 1SOZA 3RM2H 3SJ9A 4OGYA 6LPRA 1QQ4A 3ZZ6A 3GDVA 4LK4A 1UTPA 4MVNA 1TMUH 1HPGA 1ABIH 1C2LA 3F9FA 1BJVA 1DSTA 4RKJB 1FNIA 1DDJA 1AD8H 1THPB 3ZVAA 1TOCB 3JZ2B 1SFIA 2GP9B 2V35A 3MWIU 5JDUB 4Q7YA 1WTGH 1ZHRA 3UWIA 2H1UA 1P11E 1SLUB 2D2DA 1G3CA 4ASHA 1DUAA 1PFXC 1C5PA 3URDA 4A1VA 4VGCC 1GCTB 4AFZA 2ZIQH 4D8NA 3IITA 3RM0H 1H9IE 3EDXB 3ZZ5A 4X8SH 1A61H 3SU1A 3U8OH 2AEIH 1PPZA 5C67A 2Y80A 1K2I1 1GJ9B 2G51A 3I78A 3KIDU 4X2VA 1UTNA 1AE5A 3K9XB 3LT3A 4X1RU 3SW2B 1IHTH 1UVTH 1LVBA 2O8WA 1TRYA 2TPIZ 4BAMB 3FP6E 3RP2A 2ZU3A 5FPYA 1O2LA 5F6MA 1ANDA 1TALA 3MO3A 1AVGH 1C1SA 3M5NA 1YPHC 1TONA 4I31A 1SGQE 1GVLA 1HB0B 2QXIA 6GCHG 3ATKA 1O38A 1TE0A 5AFYH 2BOHB 2CHAC 2WPIS 1A2CH 3EA8A 4FUGA 1YCPK 3BF6H 4J2YB 1QL9A 4ABJA 3F1SB 1ZSJA 2QC2A 2ZHDA 3NK8A 4Y0YE 3GY7A 1N8OC 3LGIA 2PGQB 4GLYA 1AKSB 2R9PA 2F9UA 1KTTB 5PTPA 4XE4A 2FZZA 1GMDF 1T32A 4D9QA 1WUNH 3P70B 1O36A 4HTCH 1DANH 1G3DA 2GTBA 2Y82A 4OS2A 1NS3A 5EW2H 1H8DH 3L3TA 4CRBA 1V2ST 2H5CA 4HGCA 5T6GA 1LCYA 1HV7A 1V2OT 1A1RA 2PWXA 1XUFA 1EB2A 1H1BA 1GVKB 3SV8A 1CT4E 1SQAA 1F7ZA 3TNSA 5C1UA 1Y3XA 3SUDA 1GBTA 5F8TA 4DY7B 1O2KA 1W10U 3M35A 1NU9A 1TMTH 2ZDMA 1AQ7A 1V2UT 1SGYE 2SGDE 3ZZ4A 5C2ZA 1W2KH 1MMJN 1EOJA 4FU9A 1EZSC 1UTJA 3OU0A 5TCCA 1P2QA 2C93B 3FZZA 5E0HA 1BT7A 2ANWA 3RXIA 3A85A 3FP7E 1C1WH 1B0FA 4YOGA 2F9OA 1H4WA 1XUGA 5BRRE 2VWOA 3ZZCA 1MBQA 1TPAE 3A8CA 5G4BA 1P3EA 5K0HA 1P05A 2J92A 1XKAC 3JZ1B 3BEIB 1GHXH 1TOMH 1BITA 4NSVA 5FPSA 3RXUA 4MDSA 2FPZA 3D62A 1H8IH 4Y6DA 1O5EH 4DJZB 7LPRA 3LGWA 5JBTA 1DLKB 1AB9B 1NTPA 3TITA 3E1XB 1DPOA 2FIRH 2TRMA 3RXDA 1W11U 2A2QH 1C5NH 5ESBA 2G8TA 3FP8E 2QXJA 4FUEA 1A4WH 1DOJA 4NA7A 1T4UH 1AFQB 5CE1A 5B6OA 3S7HB 2G00A 4DIHH 1BBRK 2WV4A 4TY6A 3T62A 1BTHH 4ABHA 3BV9B 4H4FA 4CHAB 1KLTA 1LHGH 2YNBA 1F5LA 2PGBB 1O0DH 4X1SU 2Z9LA 2BDCA 1A0LA 4YT7H 1O2RA 4AG1A 5A09A 4D9RA 4K1EA 2IN2A 1GBMA 2A45B 1ZJDA 1UO6A 3KEEA 3ZZ9A 3UWJH 3VB3A 1F5KU 5A8ZA 1ELAA 2ZU5A 3S9BA 2ZECA 1C5ZB 4A1TA 2WPKS 1ZPZA 1GDUA 2VVCA 4DCDA 4MLFB 5DP8A 3GDSA 3MTYA 1HLTH 1V2KT 4NIYA 3ZZAA 1ELTA 3ATMA 3RXLA 4WF8A 2GZ8A 1ESAA 4Z0KA 2ZKSA 4NFEA 3P95A 1EOLA 2STAE 1O5GH 5FHTA 1E37B 2UWLA 3LONA 5DPAA 2W7UA 4TPYA 2XWBI 2WYJA 1GCTC 1GI3A 2V3OH 4UE7H 1Z7KA 3GCTG 2ZPRA 5HYOA 2BX4A 4ABEA 3SU2A 4F49A 2BTCE 1NRSH 3A88A 3HK3B 2NU2E 4O3TA 1NFUA 4O3UA 1GHBG 2PR3A 4JZEH 1BB0B 1HDTH 2Z9JA 1KIGH 3BTME 1B7XB 1C9PA 3PTNA 2VWLA 3ZZ3A 1W0ZU 1GMHG 1ZGVA 4BAOB 4XSKU
chains in the Genus database with same CATH superfamily
5AVDA 1O2PA 4UFFH 3TJVA 2QAAA 1QURH 4RN6A 1GI6A 3SGBE 4TPIZ 2G4UA 3DCLA 1P57B 3A89A 4X8VH 1EJAA 5JBAS 4IN1A 1HAVA 1GHZA 4WXIA 5EXMA 1IQLA 2ZFRH 3M3SA 1GL1A 5EPYA 1EZXC 2KAIB 2AHME 2PKAB 3MU8A 1C5RA 1FY4A 4Q80A 1YBWA 1Z8RA 3PMBB 3ZYEA 1TYNA 2WPLS 5HXFA 1Y3WA 2O8UA 2FOGA 2ZPSA 1SGFG 3LKWA 4M7GA 3RMOH 3UOPA 5LPFA 3RC6A 1MD8A 1P02A 1D6RA 1NU7B 3UQOA 1S6HA 5J4SA 1TLDA 1Q2WA 3MO6A 4D7GA 1AZZA 1OWHA 1DM4B 2YNAA 5C17A 4Y7AA 1THSH 3SN8A 5T6FA 2YOLA 5C5NA 1KXCA 5C20A 2L74A 4Q4LA 3STJA 2HOBA 4Q63A 4GHQA 2ZDNA 1C1OA 1RTLA 4Q7ZA 1FUJA 3BTEE 1NRNH 2FO9A 2H9HA 4ZUHA 4INHA 2XWAA 4GCHF 4K8BA 1NZQH 1EUFA 1ZYOA 1LQEA 3PV4A 2BLWA 4ISIH 1Z8JB 1CGHA 2AMPA 4YOIA 4INLA 1FX0B 1CHOG 3U1IB 4IGDA 2ZFTA 2HVYB 1JOUB 1P03A 4J1YA 4JYTA 4MTBA 3IG6B 1GMCG 1FI8A 4AGKA 4K69A 1T8LA 4RKOB 4LXBH 5DP7A 1SQTA 2QY0B 3RXRA 3ZVBA 4ZKOU 5E2PA 1UCYH 1UVSH 3T25A 1VGCB 3RXMA 4UFDH 4ABGA 3PM3A 2C8XB 4IC6A 3FANA 1ZOMA 1W7GH 2Y7ZA 4E7RG 3P8OA 1CO7E 2PKSC 1VKYA 2BDYA 1H8HD 1C2MA 1TBZH 1TFXA 2BXUH 3FO8D 1SQRA 1YWUA 2A5IA 2BOKA 1TGTA 2C4FH 2HLCA 2TGAA 1BMLA 2NU4E 2BDIA 5F53A 4JZDH 1Z8IB 2BQ7B 4XD7D 3SV6A 1YPJH 3AW0A 5HKKD 3HPTB 2WPMS 4B2CA 2ZU1A 2FTLE 1DUEA 1AB9C 1SKYE 1YF4A 1O32A 4A7IB 5LPRA 3KNXA 1O39A 1DS2E 3OEHD 3U98H 2YMSB 1C5LH 4I8GA 3F0OA 2JH6D 3SJIA 2Q6FA 1ZRBA 1XVOA 2VIVA 4R8TB 1Y5BT 1YLCA 2Z3CA 4CHAC 1P09A 1LPZB 1OHHD 5C3NA 1SB1H 2A4QA 9LPRA 2HVXA 2P3UB 5EODA 4B2AA 2TIOA 1L1NA 1O34A 4HZHA 4NIVA 4JZ1A 1OXGA 3OX7U 3RXFA 3BTKE 2J98A 1PPGE 2TBSA 3P17H 4IS5A 3I29A 5C0TA 1DWCH 1A5HA 2FLRH 5A2MH 1LVYA 3DA9B 3Q76A 1YKTA 1PQAA 1MKWH 3QZRA 1SGEE 4JZIA 4B75A 2ZDLA 1SLVB 2UUJB 4A6LA 1P2KA 1ANEA 1HAYB 1SR5C 1O3HA 3MOCA 1KXFA 2NU1E 4AX9H 1V2PT 4K5ZA 2PLXA 1V2TT 2JETB 1C4V2 1AZ8A 3PMAB 1JIRA 1YP9A 4MPXA 2JIZD 1OS8A 1ARCA 4Y76A 1E1QD 3DSGA 2FXRA 4CRDA 2F91A 5H4IB 4UONA 4IBLH 3K65B 5E2OA 1C2JA 3PLBA 1MTNB 5EXNA 5TCAA 4AGJA 1AI8H 3KQBA 3QGNB 3AW1A 2ODPA 3TJUA 2XTTB 1J17T 1O3EA 4Y8YA 4ZH8A 3UIRA 3TVJB 1A3EH 4NA8A 1WCZA 3KQCA 2ZPQA 4ZAEA 1V2WT 3BG4C 1O2SA 4BAHB 2BQWB 3UOUA 1VCPA 1SGDE 4OS6A 4BXSA 1TBRH 3BEUA 1FY5A 3SGAE 1HYLA 1MZAA 1FLEE 1SVPA 2KX4A 3PRDA 1AKSA 1QB1A 3GY8A 4H6SB 2L6OA 3RXKA 4FXGH 1U6QA 2KZ4A 4SGAE 3U8TH 2AIQA 4U2WA 1O2XA 3P8GA 1YPEH 2GKVE 3V3MA 3UFAA 1HAHH 1LQDB 1FY1A 2B0FA 1TMBH 2GCTB 1O3MA 2QGRA 1HGTH 1O3NA 3LJOA 1K1MA 2ZTZA 1V3XA 2BM2A 2O8TA 3GOVB 3KHVA 1QNJA 2JKHA 2J94A 4I8KA 3M7UA 1UCYE 7KMEH 1W14U 2BD7A 1S81A 9ESTA 2AS9A 1TPSA 1H9LB 2TGDA 1Y3YA 2ZNKH 8ESTE 2R0LA 1GHAF 4FVDA 2ZHQH 1GI8B 3N7EA 2OC7A 2RG3A 3O8RA 4TT3D 1C5UA 2HLDD 3Q00A 2ZWLH 3VEQB 2FP7B 1KXAA 1MTUA 1HCGA 1SHYA 2FYQA 4H42U 4SGBE 2VGCB 2A2XH 2CN0H 2EI8A 1ELGA 4Y79A 1Z1JA 4E7NA 4NCYA 1CA0B 2GD4B 1XXFA 2Z9GA 1FIZA 1HIAB 2XBVA 1S5SA 4MNXA 2HNTF 1TX6A 1QFKH 1GBFA 2HALA 4ACBA 3PLPA 1EJNA 1LVOA 3TPIZ 5CHBA 1EAWA 3SNEA 4CRAA 1SGTA 5EXLA 4JZFH 1SQOA 2K1QA 4XOJA 2GCHG 3UPEA 1ELEE 2Z9KA 2UUKB 1YPLH 1Y3VA 3RMNH 1TQ7B 2CMYA 2FM2A 2YMSC 4CRCA 1ID5H 3DFJA 1HAPH 2QE7D 2PHBA 3FOAA 2QN5T 2ZEBA 4UFEH 2CJIA 4AC9A 1O35A 1G3BA 1D3DB 2NU3E 1DWDH 2BVXH 2C90B 3WWBA 1D4PB 4FU8A 1XUHA 3T27A 1WV7H 1JRSA 1F5RA 2XC5A 1SGFA 1H9HE 1DXPA 1TBQH 3H7TA 1JRTA 5BPEA 2J4IA 2OINA 1FMGA 4FUHA 5A8XA 4FUDA 1MUEB 4YM9A 5FL7D 1TNIA 1BRUP 4X2YA 4F4OC 2J95A 2A7JA 1HFDA 2WUCA 2P8OB 3M5MA 5IDKA 1ETRH 4ABFA 3F3BA 1E35B 3H7OA 1GBDA 2RDLA 5E0GA 4HI3A 4DG4A 1TABE 3WW7A 4B76A 2OLGA 1TX7A 1CBWB 1K1NA 2FLBH 1O3CA 4Q7XA 1J16A 4KELA 3AASA 1O3GA 3EA7A 1UTKA 4CREA 2BLVA 1CVWH 2QIQA 3NWUA 2ZGBH 2OP9A 4M9FA 2VVVA 1PYTD 2UUYA 1KY9A 3ZZ8A 1NT1A 3QDZB 3GS9A 1F2SE 3SQEE 5LH8A 1DWEH 1OPHB 4K1TA 1K1IA 6CHAB 2O8LA 4BTIB 2EEKA 1XXDA 3RXAA 1O2VA 3FAOA 1QA0A 2JETC 1NFXA 1W7XH 1C2EA 4YXWD 3TGKE 3ZVEA 3RC4A 2Y5HA 1RTKA 1ZRKA 1ZSKA 1C5XB 5DP3A 1CA8B 1KLJH 1XUKA 3O8BA 4Y0ZE 2B8OH 1QL8A 1NM6A 1YCPH 2HGTH 4RT0A 2SGQE 4ZKRU 4E05H 1TNGA 7ESTE 2FDAA 2FX4A 3A83A 2P3TB 3N7DA 1IQIA 1SOTA 2XBWA 3STIA 3RXBA 3CNRA 1KYNA 2WYGA 1MTNC 4FUIA 1SLXB 1V2NT 1C1QA 1GJ5H 1KXDA 1MKXK 5DP5A 1VITG 2BY5X 2XCFA 2UWOA 3G01A 2RA3A 2BDHA 4CBOA 3A80A 3SNAA 4U01A 1GBLA 1A0JA 1C1PA 2ZCKP 4ABAA 1THRH 1AY6H 1FPHH 2HNTE 1VJ9U 1C5QA 1O3PB 2JJ1D 4INKA 4GVUA 1OX1A 1CGIE 1HAGE 1IQGA 1N1LA 1QL7A 3UNSA 1E1RD 1O2MA 1BOQA 2KAIA 3Q3XA 2PKAA 5ABWA 1D3PB 2QA9E 1BTXA 2F4LA 3NUMA 2Y5FA 3D23A 1GBCA 3SZNA 5AFZH 4A92A 1S83A 1YC0A 2AYWA 1PQ7A 3BTWE 1V2VT 2A5AA 2FI3E 2GMTB 3MI4A 1B5GH 5FBEA 1A5IA 4I32A 3Q3YA 4X2WA 3TK9A 1O3IA 2GCTC 3MU0A 1E36B 1BTUA 2FESH 2HPQH 5JB8S 1MTSA 1DWBH 1MTVA 3LOXA 1ESTA 1HJAB 3GISB 1MCTA 2J9NA 5FPTA 3ZZ7A 4B6FA 2ODYB 1GJ6A 3O8DA 1NRPH 3AVZA 2Y81A 4MPVA 4R0IA 3K6YA 2V7QD 2IPQX 4I8LA 2GJGA 2VJ1A 3VXFH 2FS9A 4ISNA 4D76A 3HATH 5T3HA 3MH5A 1BHXF 1ZTKA 1AWHB 1S84A 1OWEA 1ZTLA 1LPGB 2OQ5A 3RXOA 3A7XA 3TH4H 2A32A 3SJ8A 1AMHA 1G3EA 2GZ7A 3DSPA 2BMGB 5J4QA 1GI9B 1JMOH 4P00A 5DGJA 1O5FH 3KQ5A 1AN1E 2OC8A 1DX5M 1V2RT 3CS7A 2WSSD 3SO3A 1F0RA 2RCEA 1YLDA 1GGDC 1MZDA 4BXWA 3F2GA 1C2FA 2TGTA 5KGOA 5GCHF 1NRRH 2VGCC 1DY9A 2XRCA 1PQ8A 4ISLA 1CA0C 3CS0A 3SU6A 3SUEA 1VCQA 1O2GH 4Y7BA 1EAXA 2EA3A 1TGBA 2OQUA 4TY7A 1N6YA 1E79D 2J5UA 2XNIA 3RLYH 1SGPE 2XNDD 2BLOA 1NN6A 3D49H 3KF2A 1IQEA 5KEDA 4GUXA 1BBRH 4LZ4B 1SHHB 3BTTE 4IW4E 1PPBH 5HMAA 1TA2A 2KFWA 3PYHA 2W7SA 2P3FH 5DG6A 5KECA 3F2HA 1QQUA 3UNQA 2BLQA 3QLPH 2B9LA 2ESTE 2FOHA 2GVFA 3H5CB 2NU0E 2SGAA 1GG6B 3RXSA 1ZTJA 2QV1A 3ATWA 3C1KA 1TQ0B 3K2UA 1COWD 5FCRA 4KP0A 3SI3H 1ZJKA 1O3LA 2WHXA 3UY9A 1F0SA 4Q2KA 3DD2H 1IQJA 3SORA 3SV2H 1P06A 1BTYA 2BD4A 1T31A 1TRMA 4MNVA 3M7TA 4QT8C 3F9EA 2W5EA 3EE7A 4WH6A 4ZKSU 3IWMA 1ELVA 1FJSA 3RMMH 4X2XA 2SGEE 4YLUA 2FX6A 2ANMH 1YLNA 1C1TA 3HGPA 2G4TA 2J2UA 1TNKA 3DT0H 2M2AA 1OYTH 2ZGCA 4X8TH 2P8OC 4I8HA 2OK5A 1P10A 1UJ1A 2WV9A 2CV3A 4X8UH 2RFKC 3VXEH 1TB6H 2VWNA 2SNWA 3KN2A 2AFQB 2G81E 4ISOA 3F0PA 3HKJB 2FOBA 4WVPE 1CBWC 4FVBA 2WINI 3HGNA 4FUFA 3ELAH 7GCHF 3TGJE 8GCHF 1QY6A 2LNCA 4BANB 4BTTB 5EIYA 2ZU2A 1SSXA 3BIVH 4CBNA 1GMDG 2CK3D 2R0KA 2Z7FE 2JDID 5A0BA 3U9AH 1EPTB 1BDAA 1XVMA 6CHAC 3HKIB 3ESTA 2PTCE 2KR7A 1Y3UA 3KQDA 5HIYA 2XW9A 1ZMJA 3WWFA 1XM1A 4AOQA 2QXHA 1K22H 3S0NA 1S0QA 2ULLA 1O5DH 1C4U2 3RXTA 1QZ8A 4WJG2 1A46H 3UUZA 4YO9A 1NBMD 1TGCA 2IOTA 1GI1A 2PV9B 2H9TH 1O30A 1BIOA 1UK3A 1BRBE 3GYLB 2DE8A 3SU0A 2G52A 3W94A 1V2QT 2A5KA 1QHRB 1G37A 3VB4A 4F48B 2ZU4A 1L0ZA 3SZEA 4MNWA 1OSSA 1S82A 1QIXB 1CT2E 1SC8U 1DXWA 5DSFA 1MH0A 4NSYA 2VH6A 1C1NA 1TNJA 5E0JA 4OS7A 1RIWB 2F9NA 1W0YH 1GJ4H 3P8FA 2GDEH 5A0CA 2D8WA 1D6WA 1L4ZA 3R0FA 4DT4A 3E0NB 1BRAA 5LGOA 1L1GA 1ANCA 2J34A 3M5LA 4K8YA 1FDPA 4B71A 3E0PB 4TSFD 1GCDA 3ZVGA 3ZVDA 2F83A 3KGPA 2GMTC 2HPPH 1QBNA 2OTVA 4MPUA 5GXPA 1O2ZA 1FY3A 3UAIC 3OSYA 3QX5H 5I25A 3O8CA 2GV7A 1V2JT 2Z3EA 1P2IA 5EJ1A 2GZ9A 3MH7A 1HJAC 5EQRA 1O37A 1YCPM 2BY8X 2B7DH 4TYDA 1AFQC 1BTZA 4YOJA 4XBCA 3GCNA 1B0EA 1OOKB 2C3SA 3AAUA 1O3DA 2M5TA 2VINA 2FEQH 3BTHE 2W6JD 4X1NU 4UFGH 1UVOA 3MNBA 1C1VH 2ZG0H 1UTQA 4KTUA 1IQKA 3GYMA 4RI0A 2P93A 1ANBA 5ETXA 2XC0A 1RGQA 4X0WU 4JK6A 1FN8A 3TU7H 5GJ4B 1C5YB 4WY3A 2BVRH 1GBJA 1AIXH 1Y5AT 4AN7A 4IMQA 1G32B 3A8AA 2ZQ2A 1BBRE 4LOYH 1S0RA 3NPSA 1DSUA 2FODA 2KCOA 3T5FH 1BQYA 3OFND 1AFEH 1WSSH 2BD8A 4HFPB 1BJUA 1RXPA 1RJXB 4UEHH 2VIDA 1GJBB 1HAZB 6GCHF 1GBIA 2RDEA 1HIAA 1ACBE 4DOQA 3GCHB 3QTOH 4K1SA 2VIOA 2PUXB 2QXGA 2ZO3H 2KCAA 1AO5A 4P02A 2ZGJA 4GPGA 2CHAB 1TGNA 2AH4X 1AU8A 3SJKA 5L6NH 1O3KA 2WPJS 2P95A 1GJ7B 1YPHE 4PROA 4K2YA 3TJNA 1N8OB 1UVUH 2BXTH 5EQQA 2I6SA 1ZMLA 3MU5A 2R3YA 3Q77A 1S85A 1C2GA 2SGPE 1G2MA 1A7SA 1GG6C 3MO9A 3MNCA 2OCVB 3GY2A 4NWLA 3V12A 5DK1A 1MBMA 2BVSH 3S7KB 5GIBA 3SJOA 1FZZA 2AGEX 1O2OA 4KGAA 2ZHWH 4MPWA 3T29A 2V3MA 3T2NA 2J97A 1K1PA 3OTPA 3LGYA 4FUCA 1O3FA 3BG8A 1FV9A 1P9UA 2ODQA 3SOSA 2ZFPH 2V3HH 3ZV9A 1D9IA 1O2QA 1VCWA 1MTWA 1P0SH 2ZCLP 2OD3B 4JYVH 3LPRA 2ZDKA 3GY6A 4WWYA 1BMNH 4ABDA 2BD5A 4JK5A 4UDWH 1ZR0A 1FAKH 2EI6A 1RRKA 1O2HA 1GBEA 4CRFA 2C8ZB 3ZZBA 5FCKA 1P2MA 4HG6A 4DURA 1DY8A 1RFNA 1HJ8A 2AGGX 3U28C 3LH1A 3W95A 1Y5UT 2DE9A 2SGFE 3OY6U 5DJ7A 1GBBA 3SU5A 4CRGA 4IC5A 1HXEH 2O8MA 5GWZA 1EX3A 3FN8A 4XFQA 1VR1H 1P3CA 1N6XA 3QUMP 3OAAD 3MFJA 2PP6A 2A0QB 1O5CB 1KXEA 2ANKH 5JBBS 1ELFA 1YGCH 2OC0A 1MU8B 1EPTC 2HWLB 8GCHG 2ZP0H 1NRQH 1BCUH 1XX9A 2ZFFH 4GHTA 2G5VA 2BYAX 2ZGXH 3DFLA 1KSNA 1VZQH 2Y7XA 1CQQA 3SI4H 1GHYH 4THNH 1XUIA 1Q31A 3RUOA 3LGVA 1FXYA 2G5NA 2PUQH 3TH2H 3SNCA 1PPCE 4AFSA 3PROA 1BA8B 1UTLM 2A4OA 2BDAA 2P94A 2BD3A 3RDZA 1L4DA 1O3OA 3SNBA 1GBKA 5A0AE 1ZMNA 1DE7H 5L30H 1TPPA 3A84A 3M5OA 3LIWA 3HK6B 1O31A 4GCHG 2AGIX 2Y6TA 5E8EH 4ZXYH 1BTPA 2R2MB 3C27B 2AIPA 1O5BB 2QF3A 3A7YA 3FKSD 3KYGA 2A4GA 2PW8H 4MNYA 1VGCC 1Z1IA 3SU4A 2XC4A 1P8VC 5ESTE 1BRCE 3MHWU 3VFEA 1BMAA 4NIXA 5JBCS 1RIWC 2D1JA 2ILNA 3GICB 1F0TA 1P9SA 1GJDB 4Y10E 2QYIA 1PJPA 2HRVA 2ZFQH 1OWIA 2P16A 1ETTH 1OWKA 2Q6DA 3VGCB 2H5DA 5EPNA 4NZQA 3M37A 3M61U 1IQMA 2W26A 2A4RA 1HUTH 1SGNE 5FX5A 1ELBA 1QTFA 2BZAA 2IJOB 3A82A 1QR3E 2VNTA 1C9TA 4TWYA 1PPEE 3ZIAD 4TWWA 5CHAB 4WXVA 2CGAA 4ZHAA 3ENSB 1Y8TA 2W3IA 3E16B 1QBOA 1PYTC 1AGJA 1SLWB 1ZLRA 4GSOA 3WY8A 1C5OH 1O3AA 5GDSH 3ZYDA 2BQ6B 1C1UH 1QJ6B 4Y8XA 3GCTF 1Z6EA 4CR5A 1K28D 2BDGA 1LKBA 2GX4A 3ZV8A 2ZHEH 1EQ9A 2K8IA 1GHBF 2EI7A 2ZF0H 5AF9H 2PTNA 1GHVH 3KCGH 1QRXA 1WDIA 3PB1E 2W3KA 1GMHF 4K3JA 3LGTA 1SGRE 2ZZUH 2VVUA 1NBME 1UTOA 1O33A 1KTSB 2RA0A 4NZLA 2UUFB 5F03A 5SGAE 1GPZA 3RXVA 1FIWA 2ZI2H 2D26C 3QK1A 1TNLA 4ESTE 2V0BA 2ZHFH 1PQ5A 1TIOA 5LPEA 2WZQA 5IYTA 4I7YH 1MCVA 2UWPA 1C1MA 3GCHC 1DLEA 1RS0A 1DFPA 4D7FA 3NZIA 4FU7A 1CT0E 4WH8A 3PO1B 2THFB 3VB5A 5K7RA 1GBHA 2VU8E 2STBE 1LHDH 1AUTC 1FAXA 3EAJA 1EZUC 1GBAA 4AYYB 3A81A 4ZHMU 3UR9A 5AHGH 1EP6A 4OS5A 1TAWA 3F2FA 2Z6BD 3SGQE 3A8BA 3E91A 1G2LA 2FYRA 2OUAA 1TPOA 1GJAB 2GGVB 4X1PU 1O3BA 3M36A 1C2DA 2W6ID 1SGCA 1EKBB 4DVAU 1NPMA 1HAOH 1YYY1 5EJZA 3P6ZB 3RXPA 4B74A 4ACAA 1E38B 2OBQA 1O2YA 2ALPA 1T7CA 3LDXH 1GVZA 1AUJA 4NA9H 4AFQA 4DW2U 3VG8A 4AB9A 1EATA 3SBKA 1D3QB 1CSOE 2FOEA 2QCYA 1TA6A 2EY4C 3DUXH 3F68H 1UW7A 3A87A 1ZSLA 4H6TA 1KDQB 1EXFA 3EE0B 3B23B 3B9FH 1UK4A 3DHKH 3BSQA 1CHOF 1D3TB 2XOKD 2TGPZ 4Y8ZA 3M3VA 1NESE 2BDBA 4WMFA 3ATLA 5FBIA 4IN2A 1AVXA 1Z8GA 2H2ZA 4Y11E 3RXGA 2AERH 5JPMH 1GMCF 2ASUB 1QRZA 1NFWA 1SFQB 3F9HA 1NO9H 4OGXA 3EQ0H 1C2KA 2Q6GA 1XMNB 2QF0A 2SFAA 3GY5A 1SG8B 1UHBB 2BZ6H 2AMDA 1GWAA 1SL3A 1HRTH 3LJJA 1C5TA 1K1OA 4B73A 1HXFH 2F3CE 4AG2A 2FI5E 3RXEA 1A3BH 1JWTA 1P01A 1FONA 1ZPBA 2FOMB 2ALVA 3Q3KA 2PKSB 1T8NA 4CH2B 3PV2A 1EPTA 1O2JA 3BIUH 3V13A 5DP9A 1IQFA 1WAYB 1GDQA 1GI4A 1VJAU 1XKBC 5C1XA 5FXLA 3VB6A 1MKXH 4WMEA 3S9AA 4E06H 2FMJA 5C5OA 1O2NA 1LHFH 2C8YB 1ELDE 3MYWA 3RU4E 2BY9X 1ETSH 1O3JA 4ZROA 3VB7A 1RTFB 4AZ2B 2JH0D 2GT8A 1LMWB 3SUFA 1O5AB 4FOUC 2XCNA 1EFRD 2F43B 1TRNA 3UR6A 2PFEA 2A1DB 2LPRA 1L1JA 1P04A 2ZTYA 4XRNA 4BAKB 1GHAG 2FTMA 2PSYA 4ISHH 2QF5A 5EGMA 3V0XA 1DVAH 1C5SA 1WOFA 1FY8E 3MNSA 2P59A 4BTUB 1ESBA 3MNXA 1FN6A 2FOFA 3NXPA 1O2TA 3PMJA 4A5TS 3AK5A 1K9OE 5DO4H 1OP2A 1P2JA 3VGCC 3PV5A 4YLQH 1CHGA 5FAHA 1ZHPA 4AB8A 1EAIA 1E34B 3GY4A 3UTUH 3QGJA 3A7WA 5CHAC 3TNTA 6ESTA 1P2NA 3KYFA 2VBCA 3SU3A 2GT7A 4NGAH 1L2EA 2Y5GA 1ARBA 1G36A 3ITIA 4FUBA 3P92A 5L2YH 5FX6A 4BAQB 4DT7B 1OWJA 3E90B 1C5VA 2Z3DA 4AORA 4XBBA 1LKAA 5EG4A 3CP7A 1E0FD 4GAWA 1W0JD 1EAUA 2VB0A 1IQNA 2ZA5A 2ZFSA 5HM2A 4NWKA 2G55A 2XBXA 2WV5A 4K60A 3QTVH 3SQHE 1ABJH 3ODDA 1QB9A 1W3CA 4XDEA 3SHAH 1G30B 5EW1H 4ABIA 2DUCA 4B1TA 1BMFD 3A86A 3ATIA 1TGSZ 3B8JA 4X6NA 5T6DA 2BB4A 1NFYA 3BTQE 4U30A 2BX3A 4YESB 4MG3A 4AFUA 1ORFA 1EASA 3SV9A 3KQEA 4UD9H 3K6ZA 3PO1C 5EOKA 2VIPA 1EJMA 4O9VA 1MAYA 2NWNA 1LPKB 2XXLA 4X6MA 3S69A 3A7VA 3ODFA 3BG4B 1BHXB 1GJCB 1HBTH 1V6DA 2VIQA 4F55A 1TNHA 5HM9A 2H9EH 3PTBA 2CF8H 4FUJA 1MQ5A 2OXSA 3ZVFA 5JB9S 1IQHA 2VIWA 3T28A 1S6LA 1UCYK 3SV7A 1YPMH 2CXVA 1LHCH 1EZQA 4WMDA 3ZVCA 1YY3A 1C2IA 3TK5A 1W8BH 4O03A 1O2WA 3OTJE 2F9VA 1WBGB 3A7ZA 2HNTC 2VH0A 4NIWA 3A7TA 3RLWH 3SHCH 1K1LA 2OC1A 4BNRA 1HAIH 3N7OA 3QWCH 2BY7X 5GNDA 1YM0A 1DICA 3AAVA 1Z6JH 4X1QU 3MMGA 1O2UA 4LZ1H 1ELCA 3R3GB 3NRLA 3TGIE 3RXQA 1QCPA 1SGIB 1T8MA 1NC6A 3N99A 1V2LT 2AMQA 4B6EA 1GL0E 4OS1A 3FZDA 5I46H 1HNEE 3PWCA 8LPRA 1A5GH 1W12U 2PSXA 3LC5A 4NFFA 4IMZA 3E6PH 1HJ9A 3BTGE 3T26A 4DGJA 1XUJA 1TX8A 1FQ3A 2BHGA 5DKMA 1UK2A 4I8JA 2IPHA 1JXPA 3TJOA 3UQVA 1S6FA 1ZPCA 3PLKA 3BEFB 3U8RH 2CF9H 1WYKA 4U32A 2GCHF 1GI5A 4JCNA 2A7CA 3ZZDA 2B5TB 3GDUA 3EYDA 1BMMH 2XBYA 3VPKA 4I33A 3M3TA 2FOAA 1W0KD 1WQSA 1KXBA 4OM9A 1BTWA 4VGCB 1V2MT 4KTCA 4A1XA 1GHWH 2FI4E 2FWWA 5DP6A 1SBWA 4OS4A 2Z94A 2ZQ1A 3LGUA 1JBUH 1QGFA 2ANYA 4ABBA 4JYUH 4O97A 1MKWK 1UTMA 1X7AC 3L33A 3SYJA 3SUGA 3OYPA 1MAXA 1OYQA 1SI5H 1WQVH 3QN7A 3H09A 1C5WB 1QJ1B 5TJXA 4KKDA 1T8OA 2ZGHA 3CENA 4YT6H 5IK2D 3F9GA 3URCA 5GCHG 3FVFB 8KME2 5CDFE 4X6OA 4Z1MD 5B6LA 1VITH 4XBDA 1HAVB 3RXCA 3BTDE 1BUIA 1GI0A 3FFGA 1OP8A 1SMFE 1A0HB 1C4Y2 2A31A 3PWBA 1QRWA 2BY6X 3RU4D 2VWMA 3S9CA 1IHSH 2KCPA 5HGGA 1ZZZA 2WPHS 2F9PA 4NG9H 3KL6A 1MABB 4ZHLU 1CU1A 1LDTT 3PRBA 1F92A 2ZDVH 1PPHE 1QB6A 1EP5A 1LTOA 3UREA 1HAXB 2C8WB 3MH4A 4RSPA 3E3TA 1RD3B 2R3UA 4DIIH 2ZCHP 4KTSA 1LVMA 2BD9A 1J15A 1T4VH 1UMAH 1AVWA 1J9CH 1H8ED 2IJD1 2XYAA 4I86A 4ZXXH 4B2BA 4BOHA 3D65E 5C94A 1G9IE 1GI2A 3U1JB 1QJ7B 2H6MA 1KMHB 1PPFE 1VITF 1Q3XA 3EA9A 2Q1JA 2JH5D 1NY22 5CMXH 1AWFH 1SPJA 2BD2A 3RXHA 5A8YA 3PMHB 1INCA 1GJ8B 3P8NA 1J8AA 2A7HA 2Z9IA 2JJ2D 3A8DA 1AHTH 7GCHG 5JYIA 1AE8H 3OY5U 5GPIB 1GI7B 1Z71A 3RXJA 3MU1A 1C5MD 1CE5A 1OP0A 3RC5A 5T1VA 3V7TA 3BTFE 3TLOA 2ZC9H 1GDNA 1DITH 1UVPA 1ZGIA 2GV6A 3NKKA 2I6QA 1OKXA 2J38A 1NROH 1KLIH 4Y71A 4YTAA 3UNRA 1YPGH 2F9BH 4AYVB 1W13U 2GDDA 5DP4A 2SNVA 1LHEH 4ZKNU 3DSOA 3TIUA 1C1RA 1BZXE 2ZDAH 1MU6B 3LU9B 3M7QA 3LH3A 5F8ZA 3BN9A 4CH8B 2V6NA 1LO6A 5F8XA 1P12E 1P2OA 4YZUA 2OBOA 3GY3A 5EU8A 2EC9H 3MU4A 1Y59T 1JIMA 1IAUA 3NCLA 4MQAA 4ZCNA 2ZTXA 1OWDA 3RU4T 4X6PA 3E8LA 1CGJE 2R2WU 3LC3A 1K1JA 1M9UA 3QZQA 1DT2A 1KDQA 3SNDA 2WUBA 4JMYA 2O9QA 1MQ6A 3L6PA 1FPCH 3GCOA 1J14A 3U69H 1YPKH 1ZHMA 2FS8A 1QBVH 3TK6A 1WU1A 3RMLH 2FOCA 1EB1H 3MH6A 3EGKH 5EJLA 3UB0A 1WTHD 4ZMAH 3TH3H 1F0UA 3I77A 5C1YA 1C2HA 5L2ZH 1K21H 1IOEA 1QA7A 1MD7A 1TWXB 2J98B 1GGDB 1O2IA 1UHBA 3F6UH 4Z6AH 5EQSA 4CR9A 3QO6A 1SOZA 3RM2H 3SJ9A 4OGYA 6LPRA 1QQ4A 3ZZ6A 3GDVA 4LK4A 1UTPA 4MVNA 1TMUH 1HPGA 1ABIH 1C2LA 3F9FA 1BJVA 1DSTA 4RKJB 1FNIA 1DDJA 1AD8H 1THPB 3ZVAA 1TOCB 3JZ2B 1SFIA 2GP9B 2V35A 3MWIU 5JDUB 4Q7YA 1WTGH 1ZHRA 3UWIA 2H1UA 1P11E 1SLUB 2D2DA 1G3CA 2KM0A 4ASHA 1DUAA 1PFXC 1C5PA 3URDA 4A1VA 4VGCC 1GCTB 4AFZA 2ZIQH 4D8NA 3IITA 5HIZA 3RM0H 1H9IE 3EDXB 3ZZ5A 4X8SH 1A61H 3SU1A 3U8OH 4RT1A 2AEIH 1PPZA 5C67A 2Y80A 1K2I1 1GJ9B 2G51A 3I78A 3KIDU 4X2VA 1UTNA 1AE5A 3K9XB 3LT3A 4X1RU 3SW2B 1IHTH 1UVTH 2QF4A 1LVBA 2O8WA 1TRYA 2TPIZ 4BAMB 3FP6E 3RP2A 2ZU3A 5FPYA 1O2LA 5F6MA 1ANDA 1TALA 3MO3A 1AVGH 1C1SA 3M5NA 1YPHC 1TONA 4I31A 1SGQE 5C0UA 1GVLA 1HB0B 2QXIA 6GCHG 3ATKA 1O38A 1TE0A 5AFYH 2BOHB 2CHAC 2WPIS 1A2CH 3EA8A 4FUGA 1YCPK 3BF6H 4J2YB 1QL9A 4ABJA 3F1SB 1ZSJA 2QC2A 2ZHDA 3NK8A 4Y0YE 3GY7A 1N8OC 3LGIA 2PGQB 4GLYA 1AKSB 2R9PA 2F9UA 1KTTB 5PTPA 4XE4A 2FZZA 1GMDF 1T32A 4D9QA 1WUNH 3P70B 2WPDD 1O36A 4HTCH 1DANH 1G3DA 2GTBA 2Y82A 4FETA 4OS2A 2YMSD 3OEED 1NS3A 5EW2H 1H8DH 3L3TA 4CRBA 1V2ST 2H5CA 4HGCA 5T6GA 1LCYA 1HV7A 1V2OT 1A1RA 2PWXA 1XUFA 1EB2A 1H1BA 1GVKB 3SV8A 1CT4E 1SQAA 1F7ZA 3TNSA 5C1UA 1Y3XA 3SUDA 2K0QA 1GBTA 5F8TA 4ASUD 4DY7B 1O2KA 1W10U 3M35A 1NU9A 1TMTH 2EQNA 2ZDMA 1AQ7A 1V2UT 1SGYE 2SGDE 3ZZ4A 5C2ZA 1W2KH 1MMJN 1EOJA 4FU9A 1EZSC 1UTJA 3OU0A 5TCCA 1P2QA 2C93B 3FZZA 5E0HA 1BT7A 2ANWA 2LP6A 3RXIA 3A85A 3FP7E 1C1WH 1B0FA 4YOGA 2F9OA 1H4WA 3OE7D 1XUGA 5BRRE 2VWOA 3ZZCA 1MBQA 1TPAE 3A8CA 5G4BA 1P3EA 5K0HA 1P05A 2J92A 1XKAC 3JZ1B 3BEIB 1GHXH 1TOMH 1BITA 4NSVA 5FPSA 3RXUA 4MDSA 5DN6D 2FPZA 3D62A 1H8IH 4Y6DA 1O5EH 4DJZB 7LPRA 3LGWA 5JBTA 1DLKB 1AB9B 1NTPA 3TITA 3E1XB 1DPOA 3MQKC 2FIRH 2TRMA 3RXDA 1W11U 2A2QH 1C5NH 5ESBA 2G8TA 3FP8E 2QXJA 4FUEA 3W1EA 1A4WH 1DOJA 1WXRA 2KCYA 4NA7A 1T4UH 1AFQB 5CE1A 5B6OA 3S7HB 2G00A 4DIHH 1BBRK 2WV4A 4TY6A 3T62A 1BTHH 4ABHA 3BV9B 4H4FA 4CHAB 1KLTA 1LHGH 2YNBA 1F5LA 2PGBB 1O0DH 4X1SU 2Z9LA 2BDCA 1A0LA 4YT7H 1O2RA 4AG1A 5A09A 4D9RA 4K1EA 2IN2A 1GBMA 2A45B 1ZJDA 1UO6A 3KEEA 3ZZ9A 3UWJH 3VB3A 1F5KU 5A8ZA 1ELAA 2ZU5A 3S9BA 2ZECA 1C5ZB 4A1TA 2WPKS 1ZPZA 1GDUA 2VVCA 4DCDA 4MLFB 5DP8A 3GDSA 3MTYA 1HLTH 1V2KT 4NIYA 3ZZAA 1ELTA 3ATMA 3RXLA 4WF8A 2GZ8A 1ESAA 4Z0KA 2ZKSA 4NFEA 3P95A 1EOLA 2STAE 1O5GH 5FHTA 1E37B 2LELA 2UWLA 3LONA 5DPAA 2W7UA 4TPYA 2XWBI 2WYJA 1GCTC 1GI3A 2V3OH 4UE7H 1Z7KA 3GCTG 2ZPRA 5HYOA 2BX4A 4ABEA 1K0HA 3SU2A 4F49A 2BTCE 1NRSH 3A88A 3HK3B 2NU2E 4O3TA 1NFUA 4O3UA 1GHBG 2PR3A 4JZEH 1BB0B 1HDTH 2Z9JA 1KIGH 3BTME 1B7XB 1C9PA 3PTNA 2VWLA 3ZZ3A 1W0ZU 1GMHG 1ZGVA 4BAOB 4XSKU
chains in the Genus database with same CATH topology
5AVDA 1O2PA 4UFFH 3TJVA 2QAAA 1QURH 4RN6A 1GI6A 3SGBE 4TPIZ 2G4UA 1P57B 3A89A 4X8VH 1EJAA 5JBAS 4IN1A 1HAVA 1GHZA 4WXIA 5EXMA 1IQLA 2ZFRH 3M3SA 1GL1A 5EPYA 1EZXC 2KAIB 2PKAB 3MU8A 1C5RA 1FY4A 4Q80A 1YBWA 1Z8RA 3PMBB 3ZYEA 1TYNA 2WPLS 5HXFA 1Y3WA 2O8UA 2FOGA 2ZPSA 1SGFG 3LKWA 4M7GA 3RMOH 3UOPA 5LPFA 3RC6A 1MD8A 1P02A 1D6RA 1NU7B 3UQOA 1S6HA 5J4SA 1TLDA 1Q2WA 3MO6A 4D7GA 1AZZA 1OWHA 1DM4B 2YNAA 4Y7AA 1THSH 3SN8A 5T6FA 2YOLA 5C5NA 1KXCA 5C20A 3STJA 2HOBA 4GHQA 2ZDNA 1C1OA 1RTLA 4Q7ZA 1FUJA 3BTEE 1NRNH 2FO9A 2H9HA 4ZUHA 4INHA 2XWAA 4GCHF 4K8BA 1NZQH 1EUFA 1ZYOA 1LQEA 3PV4A 2BLWA 4ISIH 1Z8JB 1CGHA 2AMPA 4YOIA 4INLA 1CHOG 3U1IB 4IGDA 2ZFTA 1JOUB 1P03A 4J1YA 4JYTA 4MTBA 3IG6B 1GMCG 1FI8A 4AGKA 4K69A 1T8LA 4RKOB 4LXBH 5DP7A 1SQTA 2QY0B 3RXRA 3ZVBA 4ZKOU 5E2PA 1UCYH 1UVSH 3T25A 1VGCB 3RXMA 4UFDH 4ABGA 3PM3A 2C8XB 4IC6A 3FANA 1ZOMA 1W7GH 2Y7ZA 4E7RG 3P8OA 1CO7E 2PKSC 2BDYA 1C2MA 1TBZH 1TFXA 2BXUH 2BOKA 2A5IA 1TGTA 2C4FH 2HLCA 2TGAA 1BMLA 2NU4E 2BDIA 4JZDH 1Z8IB 2BQ7B 3SV6A 1YPJH 3AW0A 3HPTB 2WPMS 4B2CA 2ZU1A 2FTLE 1DUEA 1AB9C 1YF4A 4A7IB 1O32A 5LPRA 3KNXA 1O39A 1DS2E 3U98H 1C5LH 4I8GA 2JH6D 3SJIA 2Q6FA 1ZRBA 1XVOA 2VIVA 4R8TB 1Y5BT 1YLCA 2Z3CA 4CHAC 1P09A 1LPZB 5C3NA 1SB1H 2A4QA 9LPRA 2HVXA 2P3UB 5EODA 4B2AA 2TIOA 1L1NA 1O34A 4HZHA 4NIVA 4JZ1A 1OXGA 3OX7U 3RXFA 3BTKE 1PPGE 2TBSA 3P17H 4IS5A 3I29A 1DWCH 1A5HA 2FLRH 5A2MH 1LVYA 3DA9B 3Q76A 1YKTA 1PQAA 1MKWH 3QZRA 1SGEE 4JZIA 4B75A 2ZDLA 1SLVB 2UUJB 4A6LA 1P2KA 1ANEA 1HAYB 1SR5C 1O3HA 3MOCA 1KXFA 2NU1E 4AX9H 1V2PT 4K5ZA 2PLXA 1V2TT 2JETB 1C4V2 1AZ8A 3PMAB 1JIRA 1YP9A 4MPXA 1OS8A 1ARCA 4Y76A 2FXRA 4CRDA 2F91A 5H4IB 4UONA 4IBLH 3K65B 5E2OA 1C2JA 3PLBA 1MTNB 5EXNA 5TCAA 4AGJA 1AI8H 3KQBA 3QGNB 3AW1A 2ODPA 3TJUA 2XTTB 1J17T 1O3EA 4Y8YA 4ZH8A 3UIRA 3TVJB 1A3EH 4NA8A 1WCZA 3KQCA 2ZPQA 4ZAEA 1V2WT 3BG4C 1O2SA 4BAHB 2BQWB 3UOUA 1VCPA 1SGDE 4OS6A 4BXSA 1TBRH 3BEUA 1FY5A 3SGAE 1HYLA 1MZAA 1FLEE 1SVPA 1AKSA 1QB1A 3GY8A 4H6SB 3RXKA 4FXGH 1U6QA 3U8TH 4SGAE 2AIQA 4U2WA 1O2XA 3P8GA 1YPEH 2GKVE 3V3MA 3UFAA 1HAHH 1LQDB 1FY1A 2B0FA 1TMBH 2GCTB 1O3MA 2QGRA 1HGTH 1O3NA 3LJOA 1K1MA 2ZTZA 1V3XA 2BM2A 2O8TA 3GOVB 3KHVA 1QNJA 2JKHA 2J94A 4I8KA 3M7UA 1UCYE 7KMEH 1W14U 2BD7A 1S81A 9ESTA 2AS9A 1TPSA 1H9LB 2TGDA 1Y3YA 2ZNKH 8ESTE 2R0LA 1GHAF 4FVDA 2ZHQH 1GI8B 2OC7A 2RG3A 3O8RA 1C5UA 3Q00A 2ZWLH 3VEQB 2FP7B 1KXAA 1MTUA 1HCGA 1SHYA 2FYQA 4H42U 4SGBE 2VGCB 2A2XH 2CN0H 2EI8A 1ELGA 4Y79A 1Z1JA 4E7NA 4NCYA 1CA0B 2GD4B 1XXFA 2Z9GA 1FIZA 1HIAB 2XBVA 1S5SA 4MNXA 2HNTF 1TX6A 1QFKH 1GBFA 2HALA 3PLPA 1EJNA 1LVOA 3TPIZ 3SNEA 1EAWA 4CRAA 1SGTA 5EXLA 4JZFH 1SQOA 2K1QA 4XOJA 2GCHG 3UPEA 1ELEE 2Z9KA 2UUKB 1YPLH 1Y3VA 3RMNH 1TQ7B 2CMYA 2FM2A 4CRCA 1ID5H 3DFJA 1HAPH 2PHBA 2QN5T 2ZEBA 4UFEH 2CJIA 1O35A 1G3BA 1D3DB 2NU3E 1DWDH 2BVXH 2C90B 1D4PB 4FU8A 1XUHA 3T27A 1WV7H 1JRSA 1F5RA 2XC5A 1SGFA 1H9HE 1DXPA 1TBQH 3H7TA 1JRTA 5BPEA 2J4IA 2OINA 1FMGA 4FUHA 5A8XA 4FUDA 1MUEB 4YM9A 1TNIA 1BRUP 4X2YA 4F4OC 2J95A 2A7JA 1HFDA 2WUCA 2P8OB 3M5MA 5IDKA 1ETRH 4ABFA 1E35B 3H7OA 1GBDA 2RDLA 5E0GA 4HI3A 4DG4A 1TABE 4B76A 2OLGA 1TX7A 1CBWB 1K1NA 2FLBH 1O3CA 4Q7XA 1J16A 4KELA 3AASA 1O3GA 3EA7A 1UTKA 4CREA 2BLVA 1CVWH 2QIQA 3NWUA 2ZGBH 2OP9A 2VVVA 1PYTD 2UUYA 1KY9A 3ZZ8A 1NT1A 3QDZB 1F2SE 3SQEE 5LH8A 1DWEH 1OPHB 4K1TA 1K1IA 6CHAB 2O8LA 4BTIB 2EEKA 1XXDA 3RXAA 1O2VA 3FAOA 1QA0A 2JETC 1NFXA 1W7XH 1C2EA 3TGKE 3ZVEA 3RC4A 2Y5HA 1RTKA 1ZRKA 1ZSKA 1C5XB 5DP3A 1CA8B 1KLJH 1XUKA 3O8BA 4Y0ZE 2B8OH 1QL8A 1NM6A 1YCPH 2HGTH 2SGQE 4ZKRU 4E05H 1TNGA 7ESTE 2FDAA 2FX4A 3A83A 2P3TB 1IQIA 1SOTA 2XBWA 3STIA 3RXBA 1KYNA 2WYGA 1MTNC 4FUIA 1SLXB 1V2NT 1C1QA 1GJ5H 1KXDA 1MKXK 5DP5A 1VITG 2BY5X 2XCFA 2UWOA 3G01A 2RA3A 2BDHA 4CBOA 3A80A 3SNAA 4U01A 1GBLA 1A0JA 1C1PA 2ZCKP 4ABAA 1THRH 1AY6H 1FPHH 2HNTE 1VJ9U 1C5QA 1O3PB 4INKA 4GVUA 1OX1A 1CGIE 1HAGE 1IQGA 1N1LA 1QL7A 3UNSA 1O2MA 1BOQA 2KAIA 3Q3XA 2PKAA 5ABWA 1D3PB 2QA9E 1BTXA 3NUMA 2Y5FA 3D23A 1GBCA 3SZNA 5AFZH 4A92A 1S83A 1YC0A 2AYWA 1PQ7A 3BTWE 1V2VT 2A5AA 2FI3E 2GMTB 3MI4A 1B5GH 5FBEA 1A5IA 4I32A 3Q3YA 4X2WA 3TK9A 1O3IA 2GCTC 3MU0A 1E36B 1BTUA 2FESH 2HPQH 5JB8S 1MTSA 1DWBH 1MTVA 3LOXA 1ESTA 1HJAB 3GISB 1MCTA 2J9NA 5FPTA 3ZZ7A 2ODYB 1GJ6A 3O8DA 1NRPH 3AVZA 2Y81A 4MPVA 4R0IA 3K6YA 4I8LA 2VJ1A 3VXFH 2FS9A 4ISNA 4D76A 3HATH 5T3HA 3MH5A 1BHXF 1ZTKA 1AWHB 1S84A 1OWEA 1ZTLA 1LPGB 2OQ5A 3RXOA 3A7XA 3TH4H 2A32A 3SJ8A 1AMHA 1G3EA 2GZ7A 2BMGB 5J4QA 1GI9B 1JMOH 5DGJA 1O5FH 1AN1E 2OC8A 1DX5M 1V2RT 3CS7A 3SO3A 1F0RA 2RCEA 1YLDA 1GGDC 1MZDA 4BXWA 1C2FA 2TGTA 5GCHF 1NRRH 2VGCC 1DY9A 2XRCA 1PQ8A 4ISLA 1CA0C 3CS0A 3SU6A 3SUEA 1VCQA 1O2GH 4Y7BA 1EAXA 2EA3A 1TGBA 2OQUA 4TY7A 1N6YA 2XNIA 3RLYH 1SGPE 2BLOA 1NN6A 3D49H 3KF2A 1IQEA 4GUXA 1BBRH 4LZ4B 1SHHB 3BTTE 4IW4E 1PPBH 5HMAA 1TA2A 3PYHA 2W7SA 2P3FH 5DG6A 1QQUA 3UNQA 2BLQA 3QLPH 2B9LA 2ESTE 2FOHA 2GVFA 3H5CB 2NU0E 2SGAA 1GG6B 3RXSA 1ZTJA 2QV1A 3ATWA 3C1KA 1TQ0B 3K2UA 5FCRA 4KP0A 3SI3H 1ZJKA 1O3LA 3UY9A 1F0SA 4Q2KA 3DD2H 1IQJA 3SORA 3SV2H 1P06A 1BTYA 2BD4A 1T31A 1TRMA 4MNVA 3M7TA 4QT8C 3F9EA 2W5EA 4WH6A 4ZKSU 3IWMA 1ELVA 1FJSA 3RMMH 4X2XA 2SGEE 4YLUA 2FX6A 2ANMH 1C1TA 3HGPA 2G4TA 2J2UA 1TNKA 3DT0H 1OYTH 2ZGCA 4X8TH 2P8OC 4I8HA 1P10A 1UJ1A 2CV3A 4X8UH 3VXEH 1TB6H 2VWNA 2SNWA 3KN2A 2AFQB 2G81E 4ISOA 3HKJB 2FOBA 4WVPE 1CBWC 4FVBA 2WINI 3HGNA 4FUFA 3ELAH 7GCHF 3TGJE 8GCHF 1QY6A 2LNCA 4BANB 4BTTB 2ZU2A 1SSXA 3BIVH 4CBNA 1GMDG 2R0KA 2Z7FE 5A0BA 3U9AH 1EPTB 1BDAA 1XVMA 6CHAC 3HKIB 3ESTA 2PTCE 1Y3UA 3KQDA 2XW9A 1ZMJA 1XM1A 4AOQA 2QXHA 1K22H 3S0NA 1S0QA 2ULLA 1O5DH 1C4U2 3RXTA 4WJG2 1A46H 3UUZA 4YO9A 1TGCA 2IOTA 1GI1A 2PV9B 2H9TH 1O30A 1BIOA 1UK3A 1BRBE 3GYLB 2DE8A 3SU0A 2G52A 3W94A 1V2QT 2A5KA 1QHRB 1G37A 3VB4A 2ZU4A 1L0ZA 4MNWA 1OSSA 1S82A 1QIXB 1CT2E 1SC8U 1DXWA 1MH0A 4NSYA 2VH6A 1C1NA 1TNJA 5E0JA 4OS7A 1RIWB 2F9NA 1W0YH 1GJ4H 3P8FA 2GDEH 5A0CA 2D8WA 1D6WA 1L4ZA 3R0FA 3E0NB 1BRAA 5LGOA 1L1GA 1ANCA 2J34A 3M5LA 4K8YA 1FDPA 4B71A 3E0PB 1GCDA 3ZVGA 3ZVDA 2F83A 3KGPA 2GMTC 2HPPH 1QBNA 2OTVA 4MPUA 5GXPA 1O2ZA 1FY3A 3OSYA 3QX5H 5I25A 3O8CA 2GV7A 1V2JT 2Z3EA 1P2IA 2GZ9A 3MH7A 1HJAC 5EQRA 1O37A 1YCPM 2BY8X 2B7DH 4TYDA 1AFQC 1BTZA 4YOJA 4XBCA 3GCNA 1B0EA 1OOKB 2C3SA 3AAUA 1O3DA 2M5TA 2VINA 2FEQH 3BTHE 4X1NU 4UFGH 1UVOA 3MNBA 1C1VH 2ZG0H 1UTQA 4KTUA 1IQKA 3GYMA 2P93A 1ANBA 5ETXA 2XC0A 1RGQA 4X0WU 4JK6A 1FN8A 3TU7H 5GJ4B 1C5YB 4WY3A 2BVRH 1GBJA 1AIXH 1Y5AT 4AN7A 4IMQA 1G32B 3A8AA 2ZQ2A 1BBRE 4LOYH 1S0RA 3NPSA 1DSUA 2FODA 3T5FH 1BQYA 1AFEH 1WSSH 2BD8A 4HFPB 1BJUA 1RXPA 1RJXB 4UEHH 2VIDA 1GJBB 1HAZB 6GCHF 1GBIA 1HIAA 1ACBE 4DOQA 3GCHB 3QTOH 4K1SA 2VIOA 2PUXB 2QXGA 2ZO3H 1AO5A 2ZGJA 4GPGA 2CHAB 1TGNA 2AH4X 1AU8A 3SJKA 5L6NH 1O3KA 2WPJS 2P95A 1GJ7B 1YPHE 4PROA 4K2YA 3TJNA 1N8OB 1UVUH 2BXTH 5EQQA 2I6SA 1ZMLA 3MU5A 2R3YA 3Q77A 1S85A 1C2GA 2SGPE 1G2MA 1A7SA 1GG6C 3MO9A 3MNCA 2OCVB 3GY2A 4NWLA 3V12A 5DK1A 1MBMA 2BVSH 3S7KB 5GIBA 3SJOA 1FZZA 2AGEX 1O2OA 4KGAA 2ZHWH 4MPWA 3T29A 3T2NA 1K1PA 4FUCA 3LGYA 1O3FA 3BG8A 1FV9A 1P9UA 2ODQA 3SOSA 2ZFPH 2V3HH 3ZV9A 1D9IA 1O2QA 1VCWA 1MTWA 1P0SH 2ZCLP 2OD3B 4JYVH 3LPRA 2ZDKA 3GY6A 4WWYA 1BMNH 4ABDA 2BD5A 4JK5A 4UDWH 1ZR0A 1FAKH 2EI6A 1RRKA 1O2HA 1GBEA 4CRFA 2C8ZB 3ZZBA 5FCKA 1P2MA 4DURA 1DY8A 1RFNA 1HJ8A 2AGGX 3W95A 3LH1A 1Y5UT 2DE9A 2SGFE 3OY6U 5DJ7A 1GBBA 3SU5A 4CRGA 4IC5A 1HXEH 2O8MA 5GWZA 1EX3A 4XFQA 1VR1H 1P3CA 1N6XA 3QUMP 3MFJA 2A0QB 1O5CB 1KXEA 2ANKH 5JBBS 1ELFA 1YGCH 2OC0A 1MU8B 1EPTC 2HWLB 8GCHG 2ZP0H 1NRQH 1BCUH 1XX9A 2ZFFH 4GHTA 2G5VA 2BYAX 2ZGXH 3DFLA 1KSNA 1VZQH 2Y7XA 1CQQA 3SI4H 1GHYH 4THNH 1XUIA 1Q31A 3RUOA 3LGVA 1FXYA 2G5NA 2PUQH 3TH2H 3SNCA 1PPCE 4AFSA 3PROA 1BA8B 1UTLM 2A4OA 2BDAA 2P94A 2BD3A 3RDZA 1L4DA 1O3OA 3SNBA 1GBKA 5A0AE 1ZMNA 1DE7H 5L30H 1TPPA 3A84A 3M5OA 3LIWA 3HK6B 1O31A 4GCHG 2AGIX 2Y6TA 5E8EH 4ZXYH 1BTPA 2R2MB 3C27B 2AIPA 1O5BB 2QF3A 3A7YA 2A4GA 2PW8H 4MNYA 1VGCC 1Z1IA 3SU4A 2XC4A 1P8VC 5ESTE 1BRCE 3MHWU