3RXDA

Crystal structure of trypsin complexed with (3-methoxyphenyl)methanamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxdA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxdA02
1O2PA 4MNXA 1TRYA 3BTFE 4UDWH 2ZDNA 2ZCLP 4ABBA 4ZKRU 4UEHH 2Z3CA 1T32A 3A89A 4E7RG 1HFDA 1O5GH 8LPRA 3SNDA 2VIWA 4M7GA 1VJ9U 2OC0A 1DOJA 4WVPE 1EB2A 2R0LA 3NUMA 1NRRH 2ZHEH 2WINI 1EJMA 1VJAU 2WYGA 4D7GA 1UHBA 3H7TA 1MAYA 1K1JA 2WPLS 1ZMLA 3M5LA 5C20A 3BN9A 1C1OA 4A1VA 1Q2WA 1SGFA 1GG6B 5K7RA 1DWBH 5FX5A 1TQ0B 1SHYA 3IG6B 1NRQH 1MQ5A 2LNCA 1CT4E 2GMTC 3AAUA 4NZLA 4I32A 2AMPA 3PYHA 2IJOB 2XTTB 2R3UA 1QGFA 3BEFB 3STIA 4ESTE 1QHRB 1Z1JA 1ZPCA 5E0GA 3S9BA 2P3UB 1ZR0A 7GCHG 1HUTH 5GJ4B 1QIXB 1AGJA 1EAXA 4MNVA 1J17T 4ZROA 1ZRKA 2GP9B 2GZ7A 4FU8A 1J15A 3O8RA 1K1MA 4CREA 3VPKA 2ANYA 1IOEA 2J34A 1EP6A 2OBQA 4NFEA 1F92A 5FPYA 2QC2A 1K28D 4DVAU 5C1UA 1E37B 1S83A 1FAXA 2BYAX 3Q3KA 1NRPH 1AN1E 1QRXA 1AHTH 1MUEB 1BMAA 3GYLB 1EAIA 3AW0A 3UNRA 2VB0A 1GVZA 3TLOA 3MI4A 2EEKA 4ZKSU 4HTCH 1PJPA 3SJ9A 1O5CB 2QXGA 2F9OA 1HPGA 1G30B 3HK3B 2XNIA 2Z9IA 3BTGE 2LPRA 1FN6A 1IHSH 1QL9A 2J95A 3UTUH 3RXDA 1BHXF 1CGHA 3CS0A 1FONA 4D8NA 3ZYEA 2G55A 1O3FA 1HJ8A 2F9PA 3A87A 2HLCA 1H9HE 4FUIA 2GKVE 2KAIA 3RLYH 2BVXH 5AVDA 4MDSA 5I25A 1H8DH 1BTZA 1TGNA 1TBQH 4Q7XA 1C5WB 1ZMJA 1VITH 1YPEH 4BTIB 2QF0A 4DT7B 2ZZUH 4X2WA 4K5ZA 1ZPBA 1UCYE 1BBRK 2OUAA 1KSNA 2GZ8A 4A5TS 2PSYA 4MNWA 4RN6A 1HJ9A 3S69A 5C1XA 3MYWA 1F7ZA 1P2OA 1ZTLA 2GV7A 2VIVA 2W3IA 1SGEE 1MKXH 1UVUH 4GVUA 1IAUA 1YCPH 1EUFA 3V0XA 3K6ZA 2WV5A 4X1SU 1GBJA 2ZF0H 4IC5A 1KY9A 1OWJA 1G3CA 2XC4A 4WF8A 1RIWC 2RA0A 4CRGA 8GCHG 1XUKA 4B1TA 5E8EH 1H8IH 3HGPA 5I46H 2Q1JA 2TRMA 1NN6A 4FVDA 2VNTA 2HGTH 3BF6H 4I8HA 1QQ4A 1V2OT 1HAHH 1SVPA 3NKKA 4YLQH 1PPGE 3RXRA 2EI8A 2FO9A 2FS8A 1SGFG 3D23A 1TPOA 2HNTC 1MD8A 4CBNA 4ABIA 2XBYA 4ABFA 1E35B 1SGDE 4BOHA 4GSOA 1OPHB 3CP7A 1TA6A 2UUYA 3QGJA 1GHYH 2XBXA 2F83A 1NPMA 5ETXA 1LQDB 2FS9A 1O2KA 1VGCB 4X8TH 1EJAA 3A8CA 1TGTA 4U32A 1TFXA 1Y3UA 5E2PA 1C1TA 1EJNA 1C2DA 1J14A 1G2MA 1OWKA 1TPSA 1YPMH 2FYQA 1W0YH 1HNEE 1P2IA 4E05H 3LGUA 2ZGJA 4YOGA 1O3OA 3SV7A 1KIGH 1DLEA 2STAE 3BG4C 4A92A 3C1KA 2ZDLA 3NK8A 3P8OA 1QJ1B 1T7CA 2A2QH 3EGKH 1UCYK 4JCNA 2BXTH 1MTWA 4FUCA 5CMXH 4ZAEA 2Q6DA 1ANEA 1W7XH 2F9NA 4VGCC 5DP6A 1WQVH 3UUZA 1P3EA 3E16B 1YC0A 1BBRE 2IPHA 1HV7A 3BTQE 1YBWA 3SUEA 4Q2KA 1LPZB 2B8OH 4B2AA 1S84A 1AFQB 2BLQA 1GJCB 1W12U 2Y80A 1TA2A 1CO7E 4XOJA 1GHVH 2FOBA 2P94A 3U8RH 3PB1E 1CE5A 1TNGA 4K3JA 3SU6A 1THSH 1YLCA 6GCHF 1GVKB 1P02A 1P03A 1ZMNA 1N8OB 3UWIA 5F03A 2NU4E 3QTOH 3V3MA 1GBFA 1C1VH 2P3FH 3U8TH 3VEQB 4O3TA 1FUJA 5E2OA 1GGDB 3BIVH 2FOAA 4CR9A 1LO6A 1MU6B 2A0QB 2J94A 3RDZA 1GI7B 4B74A 4CHAC 4B75A 2PSXA 5TJXA 1RS0A 1QY6A 4XSKU 3LJOA 3L3TA 4YT6H 1G3EA 2ZI2H 1BTUA 1JWTA 2CHAB 3RMNH 4JMYA 3FAOA 1T4UH 5ESTE 1TLDA 3AASA 2V6NA 4I8KA 2BD8A 1O3IA 3ZZ8A 3RC4A 2A5AA 4X6PA 2ZFTA 1DY8A 1GJ5H 3I77A 1TPPA 5H4IB 2FEQH 1O38A 2Q6GA 3VB7A 1UTLM 2B0FA 3ATLA 3W95A 3FP6E 1LVMA 2VWNA 1C1WH 3TPIZ 2XC5A 4JZIA 3ZZ9A 3MO6A 4ZH8A 3TGIE 1EASA 1HJAC 1TRMA 4BAOB 1GJ9B 1C4U2 1E38B 1O2RA 3SNCA 2UWOA 2ZO3H 1JRTA 1EAUA 4IN1A 3PROA 3HKJB 1Z7KA 3BEIB 1DFPA 1BTWA 1GJAB 3ZZAA 5L2ZH 1LDTT 2GT8A 1K1LA 4ABJA 1PFXC 1UK3A 2EC9H 5HMAA 2PWXA 1P09A 1UTQA 2FLRH 2OQUA 1HRTH 1K1PA 5EODA 3RXHA 1AZZA 4NWKA 3K6YA 1ZTKA 3MH6A 1FI8A 1V2KT 3ATWA 1KXEA 1OWIA 1VCWA 1AKSB 1HAVB 1AE8H 1AMHA 1C4V2 3A7WA 1ACBE 1ETSH 2NU0E 2ODQA 2TIOA 1OP0A 1E0FD 3EE0B 2ZGXH 1FDPA 1Y59T 1FXYA 3ZVDA 3EDXB 2QGRA 4MPWA 2HALA 3MOCA 1O2QA 2WUCA 1PQ7A 3RU4T 4AX9H 1MCTA 3GCTG 2BDCA 5JBBS 1T4VH 4NSYA 1V2TT 2JH6D 4ZMAH 2TBSA 1TX6A 3RXOA 3SU5A 2PUQH 2A31A 3GY2A 1O2NA 4ZKNU 2GCHG 1T8LA 1C5SA 2A4OA 1UJ1A 3SHAH 1PPFE 1C1SA 1GI2A 3NXPA 5HYOA 2BDYA 1DT2A 1A0LA 3B9FH 2EI6A 1ID5H 2GMTB 2R2MB 2O9QA 3AW1A 1T8MA 1NFYA 1OYQA 2FI5E 2R0KA 1AZ8A 2OD3B 3BTDE 1EKBB 1SLWB 3QK1A 2BD2A 2ZWLH 3RMLH 1ETTH 1UTOA 3TH3H 2O8LA 1C2IA 3WY8A 3SU2A 3OX7U 2Z6BD 1MMJN 3LGTA 1C5PA 3HPTB 1O3AA 1A2CH 1XUFA 2PFEA 4OS7A 1S0RA 1VCQA 1V2JT 1A4WH 1QA0A 2PGQB 1OSSA 1O37A 1C5TA 1SPJA 4GLYA 4CH2B 2UUKB 3QUMP 2CN0H 4K1EA 4TWYA 1ZOMA 1BJVA 4JZ1A 2AGGX 2ZPSA 1RJXB 1DITH 1SB1H 4XE4A 3E90B 2XWAA 2Z9JA 3KIDU 3GY8A 5LPRA 5ESBA 1YKTA 4MQAA 2HOBA 2HVXA 2BY6X 5C5NA 1GBHA 1LCYA 4X6MA 3GISB 4A6LA 3RXVA 2YOLA 2Y7XA 2BD7A 5DP3A 1AB9C 3A7VA 6CHAB 1P01A 4HFPB 1GI8B 1GDUA 1J9CH 2J4IA 3URDA 4Y11E 3UNSA 3URCA 2GD4B 5GXPA 1TONA 5F6MA 1W8BH 3ZV8A 3M3VA 3QO6A 4JK6A 4A1XA 1KLJH 5A0BA 2OTVA 3S9AA 3QLPH 1KDQB 1H4WA 4INKA 3SW2B 4K1TA 3RXUA 3SJKA 3UOPA 4J1YA 1JOUB 1QRWA 1A0JA 1O3MA 1Y5BT 1LTOA 4X6NA 2H6MA 1KXBA 3LGVA 5C2ZA 4AGJA 3ZZ5A 2A2XH 1DXWA 2WPKS 4H4FA 3RXKA 3NPSA 2Z7FE 1O2XA 3M5NA 1FZZA 5A0CA 3A8DA 4O97A 3F9HA 1TNHA 4OS2A 3SNAA 2AFQB 1UVPA 2RG3A 4Y7BA 4ZXYH 1HBTH 1IQEA 1FIWA 1S82A 1ABIH 3E0PB 4FUHA 2D26C 1TNIA 3MNXA 2GTBA 3HGNA 3VB5A 1TABE 3SU4A 1GBCA 2O8WA 3LH3A 3DFLA 4GCHF 4D9QA 2VIQA 3UR9A 1BTYA 2ODYB 2XYAA 1BRBE 4A7IB 1LHEH 1TGSZ 5DK1A 1ZGVA 2D1JA 1AU8A 1DUAA 5EQQA 4XFQA 5JDUB 2H9EH 1Z8GA 3SU0A 3RXMA 1Z8RA 2WYJA 4SGAE 4OS1A 3ATKA 4BAKB 3Q76A 3PV4A 4ABAA 1FIZA 2FDAA 1U6QA 2DUCA 4UONA 1AVGH 3T62A 1QJ6B 1NU9A 4X1PU 3RXJA 2OBOA 1O5BB 3RXCA 5DP4A 3MO3A 1C1QA 1GCTB 1MCVA 1CGIE 1Y5UT 1UTMA 4OS4A 3NCLA 1E34B 1BDAA 3ZZ7A 1SL3A 2AMQA 3UWJH 3M3SA 2TGDA 5FXLA 1WU1A 3UY9A 2RDLA 4R0IA 5GIBA 3SI4H 1P11E 5IDKA 1C5ZB 2PKAB 4OS5A 1BTPA 3TJNA 2BY8X 3SUDA 3F6UH 1QBNA 1P9SA 1Y5AT 3RXTA 1QTFA 1P57B 2ZHDA 2CMYA 2BM2A 2XXLA 1UHBB 1LHFH 1LPKB 1O2ZA 3ZZDA 1E36B 1SR5C 1A7SA 1BJUA 1PPEE 4B76A 1NFXA 1UO6A 4UFGH 4TYDA 1HAOH 1SLVB 3MNBA 2TGPZ 2TPIZ 1W0ZU 2ZPRA 3P92A 1N8OC 1C1MA 3GICB 4XBBA 3HK6B 1DSTA 4DW2U 6GCHG 1GI6A 3Q3YA 2GX4A 1DY9A 2D2DA 2FPZA 1TPAE 1MTVA 4Y8YA 1P2KA 2OC7A 2IOTA 1C5QA 2VWOA 1YPKH 1C5XB 1O3BA 2XW9A 2BQ6B 1EQ9A 1EAWA 2XBVA 2OCVB 1EP5A 2BXUH 4DY7B 1HCGA 1WAYB 2BLOA 2HNTE 1UTJA 4U30A 1NFWA 1O3LA 3A8AA 2VVCA 1LHDH 2BDAA 1EPTC 3MU0A 1BMLA 2VU8E 3RLWH 3B8JA 1C5VA 1DUEA 3S9CA 1WYKA 5JBCS 4DCDA 3MH5A 1F0SA 2GDDA 4X2VA 2PUXB 3VGCB 5ABWA 1C5YB 3P8GA 1XKBC 2DE9A 1T8NA 3MWIU 1G36A 2F3CE 1SQOA 4I31A 1CT0E 3M5MA 3SQEE 3BTTE 1GL1A 2SNVA 5FCKA 1Y3XA 4DIIH 2ZNKH 2G52A 2ZDMA 4B73A 1AQ7A 3STJA 4GPGA 1C2JA 1TRNA 5J4QA 1IQNA 1C2FA 1OXGA 2BOKA 2WPMS 3DFJA 1Y3VA 1FY4A 1HIAB 4H6TA 4YESB 1G3BA 1T31A 2FTMA 3ZZ4A 2J9NA 1F0TA 3M37A 4D9RA 1BTHH 2BDHA 1TNJA 2Z9LA 1VR1H 3RU4E 3RXSA 2BHGA 3TVJB 3RXQA 2FIRH 3PWCA 1BRUP 3KN2A 3MO9A 3TNSA 4Y76A 2BX3A 1ZSKA 1IQGA 3KCGH 1V2WT 1ESAA 1N6YA 4MLFB 3H7OA 4KKDA 1O33A 3LDXH 3M5OA 4KTSA 1YPHC 1ZHMA 3LGWA 5EW1H 4RSPA 1GMDF 3LT3A 5FBEA 1LVOA 1PPHE 3E1XB 2ASUB 1TX8A 1GJDB 1MTSA 2ZTZA 1KXCA 5FHTA 2FLBH 4FUBA 1O3GA 2ZIQH 2Z9KA 3G01A 5DP9A 1O5EH 7KMEH 3B23B 3T28A 1THPB 5C5OA 3D49H 3ZZBA 5AHGH 1XUGA 1IQKA 1DWEH 4X6OA 4I7YH 3HKIB 2SGDE 4Q7ZA 2P95A 2G4UA 3PWBA 1FPCH 6LPRA 5C1YA 3ATIA 8ESTE 1NC6A 1RFNA 1RD3B 4AFUA 2GT7A 4BAHB 3OTJE 2KAIB 5EW2H 1GI0A 2ZECA 1QR3E 2Z3DA 1C2MA 4Y0ZE 1QFKH 2SGFE 4FU7A 3SQHE 3GDVA 3ESTA 4FUFA 2J92A 4JZFH 1ORFA 1XX9A 3V13A 2FOCA 3S0NA 2JETB 1YPHE 1P04A 5JBAS 3QX5H 1GVLA 1OX1A 1QBOA 1XKAC 2Z3EA 1HLTH 1SC8U 1SGIB 1OYTH 2STBE 3KQBA 1EXFA 1DX5M 3M61U 1K1NA 2G8TA 1NU7B 1A3BH 2XBWA 5DP8A 1O5FH 2ZU3A 1PYTC 2Q6FA 2BD3A 1TOCB 4YO9A 4X2XA 5F8ZA 3T5FH 4LZ1H 1Z1IA 3JZ1B 2ZC9H 3PTBA 1RIWB 2I6QA 4U2WA 3TNTA 1BB0B 1AY6H 4OS6A 1WV7H 2CJIA 3HATH 1O39A 4IN2A 5DJ7A 2QN5T 2R2WU 3GY6A 4DJZB 1WTGH 1GJ7B 1KLTA 1SGNE 2BY9X 1SI5H 2A1DB 5FAHA 1P06A 1GBKA 1LHGH 3Q77A 2Y5GA 2C90B 4JYVH 3LH1A 5BPEA 2WPIS 2AS9A 1HAGE 4UFFH 4Y79A 4YOJA 2SGPE 4BAQB 4WXIA 1GDNA 1J8AA 1DSUA 3OU0A 2FODA 1BZXE 9ESTA 3MU5A 1ELAA 2B5TB 3BTWE 1B0EA 1FY5A 3LC3A 3ZVEA 1XUHA 5JB9S 1SOTA 4X1QU 3A83A 1MZDA 1BTXA 2ZFFH 5EGMA 5C67A 3ZZ6A 1O2MA 1XUIA 5DO4H 2W7SA 2P3TB 3VXFH 3BG4B 1SGYE 2A5IA 2FX4A 2PTCE 1L4DA 2UWLA 3GY7A 3ZVGA 4MPUA 1CSOE 3DA9B 4AZ2B 1QBVH 2H9TH 2PGBB 4GAWA 2AEIH 1XXDA 3LGYA 3UIRA 5BRRE 1DE7H 3BTME 4JK5A 4OGXA 3RXAA 1EOLA 2G51A 3KGPA 4FUDA 1C2HA 3SUFA 1V2LT 1SSXA 5JB8S 5F8TA 3ELAH 3F9FA 1SHHB 5T6GA 4YT7H 1TIOA 3VB6A 2ZQ1A 3ZVCA 1ABJH 3RXEA 3CENA 4O03A 1YYY1 3BEUA 1GI4A 3TGJE 2VIDA 3A7XA 1GL0E 4UFEH 1UVSH 3MNSA 1GMDG 4MPXA 1MQ6A 3GCTF 4UD9H 3UPEA 2ANKH 3QDZB 1HAYB 1K21H 1BRCE 1O3PB 2VWMA 1XVOA 4NGAH 3U8OH 3GCHC 1MKXK 1Z6JH 4R8TB 3SI3H 1EZUC 3LPRA 2XWBI 1O2TA 2SGQE 5J4SA 2A45B 4NIVA 1Q3XA 2P8OB 4F4OC 3RXIA 3EQ0H 1IQJA 1S5SA 4Q80A 3SUGA 1VITG 1ELFA 4GUXA 1ANDA 3CS7A 4YZUA 3R3GB 4MVNA 4ZHMU 5L30H 3RXGA 5GWZA 1CQQA 2FI3E 3Q3XA 1HIAA 1V6DA 3TIUA 3TJOA 1PQ5A 1XUJA 4WMEA 1ESTA 3GYMA 2FP7B 1ELBA 4RKJB 3FZZA 1YM0A 5CE1A 1QL8A 2PKSC 3RP2A 5AFYH 4BTTB 2VH0A 1IHTH 1MBQA 1V3XA 4NIYA 2PW8H 1C5RA 2AERH 2ZHQH 7LPRA 4ZKOU 1YCPM 4AFZA 1UTPA 1OP2A 1M9UA 1TALA 1TNLA 2NWNA 4GHTA 2C8ZB 3W94A 3SO3A 9LPRA 3SN8A 1QJ7B 7GCHF 1FQ3A 1SGQE 2TGTA 2ZU2A 4ABGA 1D3QB 1C1RA 4H6SB 3DD2H 2M5TA 2UUFB 3O8CA 2VVUA 1LPGB 2RCEA 2HPQH 1OP8A 4XBCA 2GDEH 1O3JA 1DWDH 3S7KB 1K1IA 1G2LA 1S85A 3L33A 3RMOH 5FBIA 4K8YA 5G4BA 1QB1A 2BX4A 3QZQA 3OY6U 1BMMH 1PYTD 1LVYA 1KYNA 3A80A 3MMGA 1RRKA 2ZGBH 1GGDC 4FXGH 1OWEA 1GJ4H 5EG4A 3E0NB 1O3DA 2BDBA 3TJVA 1NROH 4DIHH 1A5HA 4ZXXH 1C4Y2 1G37A 2ZPQA 4XBDA 1AIXH 1DICA 1PPBH 4Y8XA 4TPYA 1O3EA 5LPEA 2V3HH 1QNJA 2H2ZA 4Y6DA 5HM9A 1T8OA 2CHAC 2JH0D 2ZFQH 2B9LA 5IYTA 2R9PA 2QF3A 1DS2E 4FUEA 3KL6A 2BY5X 5A09A 8GCHF 1GHBF 3PLPA 1ZZZA 2XRCA 2ZG0H 4B2BA 2CF9H 2UUJB 1MTNB 2A7JA 5FPSA 3UREA 1JBUH 1SGRE 5EXLA 2CXVA 2JKHA 1UTKA 3SJOA 2QCYA 2HNTF 3M3TA 2Y5HA 1XXFA 4AGKA 5GPIB 1PPCE 1ZTJA 4ISOA 1AWHB 1IQHA 2VINA 1HJAB 4NCYA 2I6SA 1SFIA 1K9OE 2ZGCA 3KQEA 1FJSA 2GCTC 1EOJA 1VZQH 4AYVB 1GHZA 3SV2H 1TOMH 4D7FA 2HPPH 1P05A 5A8ZA 4WY3A 1DLKB 1L1NA 1MTUA 1YGCH 3EA9A 3SU3A 1C9PA 4ABDA 1AFEH 3BTHE 3F9EA 1ZPZA 2ZFRH 1LMWB 2OLGA 3LOXA 1GDQA 2VGCC 2OP9A 3TK6A 4AN7A 1GPZA 5EPYA 1C1PA 1TE0A 1BHXB 1GMHG 3E6PH 2Y82A 1IQFA 1LQEA 1AD8H 2ALPA 1GG6C 4D76A 1LVBA 2BZ6H 1GI3A 3A7ZA 2Y6TA 1ELTA 1XM1A 5T6FA 1NS3A 1SMFE 1ELDE 1A3EH 4KP0A 1F0RA 2AIQA 2OC8A 4I8GA 1W10U 1GBLA 3MU4A 1KLIH 1GHWH 4INLA 2EA3A 1IQMA 2ZDAH 4ISNA 2FXRA 3M7TA 3R0FA 2BLWA 2BD4A 1P2QA 2ILNA 2A7HA 2ZHWH 2VGCB 3O8DA 3V12A 2TGAA 3ZVFA 2NU1E 4IW4E 1QURH 1TMTH 4NA7A 1W13U 1SBWA 1ZHPA 5EPNA 4AYYB 1KXFA 5FCRA 2GVFA 5E0JA 5EOKA 1B5GH 4IBLH 4Q7YA 1AVWA 1WBGB 2BVRH 4YM9A 3SBKA 3F9GA 1DDJA 3SV9A 1P10A 3SOSA 1ETRH 2OINA 1C5MD 1UVTH 2H1UA 4WH6A 6CHAC 1YCPK 1GMCG 4B71A 1S81A 4NZQA 5TCAA 1ELGA 3P8NA 3SJIA 1BT7A 2W7UA 3I29A 1SGTA 3U69H 4Z6AH 1MAXA 1IQLA 1JMOH 4LOYH 5GCHF 2ALVA 1O2GH 3LC5A 5HGGA 2Y7ZA 3ATMA 4AFSA 4ISHH 1HAPH 1C2GA 3NWUA 3MH7A 1UK2A 1BCUH 1UMAH 2BMGB 2P93A 4KTCA 3TK5A 5DPAA 2Y5FA 3TK9A 5JYIA 1JXPA 3N7OA 5A8XA 1O3HA 3M35A 1V2ST 1AWFH 3U1IB 3MU8A 3MHWU 1NESE 5C3NA 1EZSC 2P59A 1UCYH 5GDSH 4KGAA 1QCPA 1L1GA 2NU2E 5HXFA 4MTBA 2BY7X 1A5IA 6ESTA 3U9AH 1K2I1 2THFB 1GBDA 2G81E 3C27B 1GBMA 1F5KU 3DHKH 1AB9B 1ELEE 1ZSLA 4TY6A 4TPIZ 3TGKE 5EU8A 3RM2H 1MU8B 1L0ZA 4ISIH 1FAKH 1UVOA 2FZZA 3DUXH 2ZDKA 1JIRA 3SU1A 4WWYA 1JRSA 4BXSA 2ZU1A 4I33A 3BIUH 1DPOA 3ZVAA 1NO9H 1O3KA 1BRAA 3RUOA 2F9UA 1WOFA 3OY5U 2WPHS 3E91A 2O8MA 4O9VA 3SGAE 3ZZ3A 2UWPA 3PM3A 1Z6EA 2D8WA 3T27A 4JYTA 1A0HB 4AG2A 4ZHAA 4DG4A 2XC0A 1RXPA 1W7GH 4MPVA 2PTNA 4JZDH 2FOEA 3KQCA 4Y10E 1D3TB 2G5NA 2GZ9A 4ASHA 1GCTC 1H9LB 2QXJA 1Y3WA 1D3PB 1YPGH 3KEEA 3PTNA 1QRZA 2J2UA 5L2YH 1GI1A 2BTCE 2GCHF 3RU4D 3TJUA 1GBEA 1CT2E 1EX3A 2AH4X 2OC1A 4GCHG 1Z8IB 1F5LA 3RC6A 1V2PT 3FVFB 4NWLA 1DWCH 3D65E 1RTKA 1GMCF 3VXEH 1PQAA 4MG3A 1P2MA 3T26A 1RGQA 1L2EA 2RA3A 2CGAA 2BQWB 2XCNA 3KHVA 2SFAA 4CRAA 3U98H 2ZEBA 1WTHD 4DOQA 4X8VH 3M7UA 1OS8A 5TCCA 2A32A 4HZHA 1EATA 2P16A 3T2NA 1SGPE 3P8FA 4TY7A 1C2KA 3Q00A 1O34A 2BD9A 1A1RA 2P8OC 4NSVA 1O35A 1GHXH 1O2LA 2G4TA 3GY5A 1Z71A 1ZYOA 1AUTC 1EZQA 3PLBA 3KF2A 2ESTE 1F0UA 1W14U 3A81A 5K0HA 5LH8A 1FNIA 5A2MH 1O2YA 4IMQA 3MTYA 4LK4A 2VVVA 2FI4E 2QIQA 2ZTYA 3F1SB 4CH8B 3RC5A 5E0HA 2PKAA 3BTEE 4NA8A 1RTLA 4NG9H 1SOZA 1Z8JB 1DM4B 1BBRH 4CHAB 2FYRA 1Y8TA 1AI8H 2VH6A 3IWMA 1DXPA 3M7QA 5DP7A 1BA8B 1O32A 4VGCB 4UE7H 1QL7A 1F5RA 3LGIA 1RTFB 2C3SA 2CF8H 3ENSB 3PMJA 1TNKA 1FLEE 2F91A 1AFQC 2AIPA 2A4QA 4I8LA 1HAXB 2A4RA 3PMHB 3TITA 5LPFA 1GI9B 1GJ6A 3MH4A 1KXDA 1O30A 2AMDA 1O0DH 3ZVBA 5AF9H 1O2UA 5DG6A 2DE8A 2FOFA 5CHAB 1SQTA 1L4ZA 1TX7A 2QYIA 2V3OH 3P6ZB 1KTTB 2BZAA 3V7TA 3K65B 3P17H 1BMNH 3SZNA 1GHBG 2ZCHP 3GY3A 2F9BH 4IC6A 1K1OA 2BOHB 4X1RU 2B7DH 1C5NH 1EPTB 3ZV9A 3SORA 1PPZA 3TU7H 7ESTE 2PLXA 4TWWA 2K1QA 4SGBE 1ARCA 4JZEH 4X8UH 3LIWA 1NT1A 3GCNA 3VGCC 1EZXC 1HAZB 4X0WU 2AYWA 5EQRA 1PQ8A 1P12E 1GBBA 1MTNC 1YPJH 1O2WA 1C1UH 1Q31A 5FPTA 2BD5A 2SGAA 1TBZH 2IN2A 2A7CA 2ZKSA 4KTUA 1C1NA 2V35A 4FUJA 2C8XB 1DVAH 1P2JA 1HAIH 3E3TA 5A8YA 3A7TA 3RXPA 3SV8A 1EPTA 2ZGHA 1D9IA 1KDQA 1O36A 2ZFSA 1MBMA 2VJ1A 1A61H 3UFAA 1O2OA 2ZP0H 4ISLA 3OYPA 4WMDA 3TH2H 2GCTB 4BTUB 2V0BA 4RKOB 3FZDA 3L6PA 3QN7A 4AFQA 2JETC 1GI5A 4AORA 2PHBA 1O3NA 1P8VC 1P0SH 4LXBH 4OGYA 2H5CA 2FOMB 1G32B 3A88A 4ABHA 1O2IA 1H9IE 4Z0KA 4KELA 1WCZA 2EI7A 1ANCA 4AB8A 3UR6A 3E8LA 1ZLRA 1P2NA 1SFQB 1D4PB 4F49A 1TGBA 2BDGA 1GBAA 3EAJA 4BXWA 4FU9A 2VIPA 4O3UA 1AUJA 3UQVA 3T25A 1GBTA 3AAVA 1TGCA 3UNQA 3RMMH 1O2SA 4Y7AA 2ZTXA 2NU3E 5EXNA 2QY0B 1H1BA 2VIOA 5F8XA 1KTSB 1EB1H 1O31A 1V2UT 1S6FA 4X2YA 1ANBA 3A84A 1FY1A 2G5VA 2WPJS 1CA8B 4CBOA 1GHAF 1WSSH 3SHCH 2ZHFH 5DP5A 1LKAA 5AFZH 3NZIA 3K9XB 3MFJA 4MNYA 1MH0A 1C5LH 2Z9GA 3UQOA 3GDSA 2BB4A 4K2YA 3TH4H 1XMNB 2C93B 2FOGA 1O5DH 4CRDA 1WUNH 3FP7E 1QB6A 1VITF 3SNEA 4NA9H 2O8UA 1GWAA 1NRNH 4PROA 2QXHA 1SLXB 4E7NA 2FX6A 3BTKE 1TQ7B 4K8BA 5LGOA 3A85A 1N1LA 1TAWA 3P70B 4NIXA 2ZQ2A 1BOQA 1O2VA 1TMUH 1ELCA 1BIOA 2ZU4A 3FANA 2Y81A 4DGJA 1B7XB 3AVZA 1OWDA 1O2HA 2GV6A 1NTPA 2C8YB 2GGVB 5T6DA 1TWXB 2CV3A 2FM2A 2O8TA 3FFGA 3QWCH 2ZFPH 1NY22 1HDTH 1K22H 4U01A 3U1JB 4UFDH 2OXSA 1CHOF 1FMGA 2HWLB 1FV9A 2ULLA 2BLVA 1YLDA 3K2UA 1MKWK 1SG8B 3S7HB 1NM6A 2OQ5A 2YNAA 4ZHLU 2ZDVH 1S0QA 4FVBA 1ELVA 2H5DA 4INHA 3UOUA 5JBTA 1XVMA 2ODPA 3QTVH 3GCHB 4NFFA 4LZ4B 3ODFA 5EQSA 4QT8C 2QV1A 1AKSA 1HAVA 1JIMA 1KXAA 1L1JA 1G9IE 1MD7A 4AB9A 2FMJA 3BG8A 3RXBA 2HRVA 3SNBA 4XDEA 2SGEE 1GBIA 3VB3A 1CHOG 5SGAE 8KME2 1QQUA 1OWHA 1GJ8B 3LONA 4HGCA 2QA9E 2WUBA 1C5UA 1TMBH 3PLKA 2PKSB 3M36A 3QGNB 1VGCC 3PMBB 4Y8ZA 5DKMA 3A8BA 3A7YA 4NIWA 4J2YB 1D6WA 2FESH 2PV9B 1FPHH 3RM0H 2J38A 2ANMH 1CU1A 3QZRA 1C9TA 1AO5A 3BV9B 3F68H 5DGJA 1MKWH 1W2KH 2BDIA 1LKBA 4CRCA 3SV6A 4ZUHA 1C2EA 2W5EA 4A1TA 4H42U 1GMHF 4B2CA 1VCPA 3H5CB 3D62A 3T29A 3ZYDA 2W3KA 3ZZCA 1GHAG 1A46H 1GCDA 1HYLA 2A5KA 3GCOA 1YP9A 3LJJA 1TB6H 1HB0B 1OOKB 1O2JA 4YTAA 3PMAB 1V2MT 2QAAA 2PR3A 1YF4A 1BQYA 1HXEH 1ESBA 3EA8A 3BSQA 1S6HA 2FOHA 3EYDA 1X7AC 5FX6A 4GHQA 3SJ8A 1D6RA 1Y3YA 1OKXA 2BVSH 2A4GA 1TYNA 4AG1A 1SLUB 2BQ7B 1BUIA 1CVWH 1FY8E 1ZJKA 1DANH 1MZAA 2QXIA 5GCHG 1FN8A 3ODDA 5HM2A 3VFEA 4Y71A 1CA0B 1N6XA 2SNWA 3VB4A 2JH5D 2ZCKP 3RXLA 4WH8A 1QA7A 1AE5A 1UK4A 2F9VA 3LU9B 1G3DA 1V2VT 1BITA 3RXFA 2XCFA 4X1NU 2FTLE 3I78A 4JYUH 1CBWB 3PO1C 2ANWA 4E06H 4YLUA 4BAMB 3JZ2B 1FY3A 3GOVB 1CHGA 3ITIA 1WQSA 2H9HA 4CR5A 2ZA5A 3SGQE 5B6OA 1W11U 2AGEX 2R3YA 2Z94A 4K69A 2AGIX 1ARBA 4ABEA 2C8WB 4I8JA 3MNCA 4BANB 1CA0C 1NZQH 5EXMA 1ZRBA 4CRBA 5JPMH 1V2RT 3A82A 3OSYA 4AOQA 4X8SH 1V2NT 1P3CA 3GY4A 1IQIA 3MU1A 3FP8E 4YOIA 2VWLA 1CBWC 1SGCA 3PO1B 1A5GH 2WV4A 3SGBE 1INCA 1P9UA 3EA7A 1SQAA 1O5AB 2C4FH 3DT0H 1ZHRA 3KNXA 4THNH 1ZSJA 5A0AE 1J16A 3IITA 4IS5A 4BNRA 3P95A 3GDUA 4K60A 1GJBB 1V2QT 2YNBA 4FUGA 4WXVA 1C5OH 3KQDA 5CHAC 1O3CA 2G00A 4Y0YE 1AVXA 1B0FA 4HI3A 4WMFA 1W3CA 1YPLH 1CGJE 3A86A 5L6NH 1F2SE 1NRSH 1NFUA 4IGDA 1QB9A 4IMZA 4CRFA 1TBRH 1HGTH 1LHCH 2ZU5A 5PTPA 4WJG2 2FWWA 3O8BA 1THRH 1UTNA 3LKWA 1D3DB 2W26A 1HXFH 5T3HA 4K1SA 1C2LA 4DURA 1ZGIA 1ZJDA
chains in the Genus database with same CATH superfamily
1O2PA 4MNXA 1TRYA 3BTFE 4UDWH 2ZDNA 2ZCLP 2W6JD 4ABBA 4ZKRU 4UEHH 2Z3CA 1T32A 3AK5A 3A89A 4E7RG 3ZIAD 1HFDA 1O5GH 8LPRA 3SNDA 2VIWA 4XRNA 4M7GA 1VJ9U 2OC0A 1DOJA 2J98A 4WVPE 1EB2A 2R0LA 3NUMA 1NRRH 2ZHEH 2WINI 1EJMA 1VJAU 2WYGA 4D7GA 1UHBA 3H7TA 2XNDD 1MAYA 1K1JA 3F2FA 2WPLS 1ZMLA 2JJ2D 3M5LA 5C20A 3BN9A 1C1OA 4A1VA 1Q2WA 1SGFA 1GG6B 2JDID 5K7RA 1DWBH 5FX5A 1TQ0B 1SHYA 2WPDD 1NRQH 3IG6B 1MQ5A 2LNCA 5HIYA 1CT4E 2GMTC 3AAUA 4NZLA 4I32A 2AMPA 3PYHA 2IJOB 2XTTB 2R3UA 1QGFA 3BEFB 3OEHD 3STIA 4ESTE 1QHRB 1Z1JA 1ZPCA 5E0GA 3S9BA 2P3UB 1ZR0A 7GCHG 1HUTH 5GJ4B 1QIXB 1AGJA 1EAXA 4MNVA 1J17T 4ZROA 1ZRKA 2GP9B 3WW7A 2GZ7A 4FU8A 1J15A 3O8RA 1K1MA 3OEED 3VPKA 4CREA 2ANYA 1IOEA 2J34A 1EP6A 2OBQA 4NFEA 1F92A 5FPYA 2QC2A 1K28D 4DVAU 5C1UA 1E37B 1S83A 1FAXA 2BYAX 3Q3KA 1NRPH 1AN1E 1QRXA 1AHTH 2KX4A 5KEDA 1MUEB 1BMAA 3GYLB 1EAIA 3AW0A 3UNRA 2VB0A 1GVZA 3GS9A 3MI4A 2EEKA 4ZKSU 3TLOA 4HTCH 1PJPA 3SJ9A 1O5CB 2QXGA 2F9OA 1HPGA 5CHBA 1G30B 3HK3B 2XNIA 2Z9IA 3BTGE 2LPRA 1FN6A 1IHSH 1QL9A 2GJGA 2J95A 3UTUH 3RXDA 1BHXF 1CGHA 3CS0A 1FONA 1YLNA 4D8NA 3ZYEA 2G55A 1O3FA 1HJ8A 2F9PA 4I86A 3A87A 2HLCA 1H9HE 4FUIA 2GKVE 2KAIA 3RLYH 2BVXH 5AVDA 4P00A 4MDSA 5I25A 1H8DH 1BTZA 1TGNA 1TBQH 4Q7XA 1C5WB 1ZMJA 1VITH 1YPEH 4BTIB 2QF0A 4DT7B 2ZZUH 4X2WA 4K5ZA 1ZPBA 1UCYE 5B6LA 1BBRK 2OUAA 1KSNA 2GZ8A 4A5TS 2PSYA 4MNWA 1FX0B 4RN6A 1HJ9A 3S69A 5C1XA 3MYWA 1F7ZA 1P2OA 1ZTLA 2GV7A 2CK3D 2VIVA 2W3IA 1SGEE 1MKXH 1UVUH 4GVUA 1IAUA 1YCPH 1EUFA 3V0XA 3K6ZA 2WV5A 4X1SU 1GBJA 2ZF0H 4IC5A 1KY9A 1OWJA 1G3CA 2XC4A 4WF8A 1RIWC 2RA0A 4CRGA 8GCHG 1XUKA 4B1TA 5E8EH 1H8IH 3HGPA 5I46H 2Q1JA 2TRMA 1NN6A 4FVDA 2VNTA 2HGTH 3BF6H 4I8HA 1QQ4A 1V2OT 1HAHH 1SVPA 3NKKA 4YLQH 1PPGE 3RXRA 2EI8A 2FO9A 2FS8A 1SGFG 3D23A 1TPOA 2HNTC 4RT0A 1MD8A 4CBNA 4ABIA 2XBYA 4ABFA 1E35B 1SGDE 4BOHA 4GSOA 1OPHB 3CP7A 1TA6A 2UUYA 3QGJA 1GHYH 2XBXA 2F83A 1NPMA 5ETXA 1LQDB 2FS9A 1O2KA 1VGCB 4X8TH 1EJAA 3A8CA 1TGTA 4U32A 1TFXA 1Y3UA 5E2PA 1C1TA 1EJNA 1C2DA 1J14A 1G2MA 1OWKA 1KMHB 1TPSA 1YPMH 2FYQA 1W0YH 1HNEE 1P2IA 4E05H 3LGUA 2ZGJA 4YOGA 1O3OA 3SV7A 1KIGH 1DLEA 2STAE 3BG4C 4A92A 3C1KA 2ZDLA 3NK8A 3P8OA 1QJ1B 1T7CA 2A2QH 3EGKH 1UCYK 2KFWA 4JCNA 2BXTH 1MTWA 4FUCA 5CMXH 4ZAEA 2Q6DA 1ANEA 1W7XH 2F9NA 4VGCC 5DP6A 1WQVH 3UUZA 1P3EA 3E16B 1YC0A 1BBRE 2IPHA 1HV7A 3BTQE 1YBWA 4ACAA 3SUEA 4Q2KA 1LPZB 2B8OH 4B2AA 1S84A 5F53A 1AFQB 2BLQA 1GJCB 1W12U 2Y80A 1TA2A 1CO7E 4XOJA 1GHVH 2FOBA 2P94A 3U28C 3U8RH 3PB1E 1CE5A 1TNGA 4K3JA 1YWUA 2KCOA 3SU6A 1THSH 1YLCA 6GCHF 1GVKB 1P02A 1P03A 1QZ8A 1ZMNA 1N8OB 3UWIA 5F03A 2NU4E 3QTOH 3V3MA 1GBFA 1C1VH 2P3FH 3U8TH 3VEQB 4O3TA 1FUJA 5E2OA 1GGDB 3BIVH 2FOAA 4CR9A 1LO6A 1MU6B 2A0QB 2J94A 3RDZA 1GI7B 4B74A 4CHAC 4TSFD 4B75A 2PSXA 5TJXA 1RS0A 1QY6A 4XSKU 3LJOA 3L3TA 4YT6H 1G3EA 2ZI2H 1BTUA 1JWTA 2CHAB 3RMNH 4JMYA 3FAOA 1T4UH 5ESTE 1TLDA 3AASA 2V6NA 4I8KA 2BD8A 1O3IA 3ZZ8A 3RC4A 2A5AA 4X6PA 2ZFTA 1DY8A 1GJ5H 3I77A 1TPPA 5H4IB 2FEQH 1O38A 2Q6GA 3VB7A 1UTLM 2B0FA 3ATLA 3W95A 3FP6E 1LVMA 2VWNA 1C1WH 3TPIZ 2XC5A 2JIZD 4JZIA 3ZZ9A 3MO6A 4ZH8A 3TGIE 1EASA 1HJAC 2HLDD 1TRMA 4BAOB 1GJ9B 3FN8A 1C4U2 1E38B 1O2RA 3SNCA 2UWOA 2ZO3H 1JRTA 1EAUA 4IN1A 3PROA 3HKJB 1Z7KA 3BEIB 1DFPA 1BTWA 1GJAB 3ZZAA 5L2ZH 1LDTT 2GT8A 1K1LA 4ABJA 1PFXC 1UK3A 2EC9H 5HMAA 2PWXA 1P09A 1UTQA 2FLRH 2OQUA 1HRTH 1K1PA 5EODA 3RXHA 1AZZA 4NWKA 3K6YA 1ZTKA 3MH6A 1FI8A 1V2KT 3ATWA 1KXEA 3OAAD 1OWIA 1VCWA 1AKSB 1HAVB 1AE8H 1AMHA 1C4V2 3A7WA 1ACBE 5CDFE 1ETSH 3H09A 2NU0E 2ODQA 2TIOA 1OP0A 1E0FD 3EE0B 2ZGXH 1FDPA 1Y59T 1FXYA 3ZVDA 3EDXB 2QGRA 4MPWA 2HALA 3MOCA 1O2QA 2WUCA 1PQ7A 3RU4T 4AX9H 1MCTA 2KCYA 3GCTG 2BDCA 5JBBS 1T4VH 4NSYA 1V2TT 2JH6D 4ZMAH 2TBSA 1TX6A 3RXOA 3SU5A 2PUQH 2A31A 3GY2A 1O2NA 4ZKNU 2GCHG 3NRLA 1T8LA 1C5SA 2A4OA 1UJ1A 3SHAH 1PPFE 1C1SA 1GI2A 3NXPA 5HYOA 2BDYA 1DT2A 1A0LA 3B9FH 2EI6A 1ID5H 2GMTB 2R2MB 2O9QA 3AW1A 2QF4A 1T8MA 1NFYA 1OYQA 2FI5E 2R0KA 1AZ8A 2OD3B 3BTDE 1EKBB 1SLWB 3QK1A 2BD2A 2ZWLH 3RMLH 1ETTH 1UTOA 3TH3H 2O8LA 1C2IA 3WY8A 3SU2A 3OX7U 2Z6BD 1MMJN 3LGTA 1C5PA 3HPTB 1O3AA 1A2CH 1XUFA 2PFEA 4OS7A 1S0RA 1VCQA 1V2JT 1A4WH 1QA0A 2PGQB 1OSSA 1O37A 1C5TA 1SPJA 4GLYA 4CH2B 2UUKB 3QUMP 2CN0H 4K1EA 4TWYA 1ZOMA 1BJVA 4JZ1A 2AGGX 2ZPSA 1RJXB 1DITH 5FL7D 1SB1H 4XE4A 3E90B 2XWAA 2Z9JA 3KIDU 2F4LA 3GY8A 5LPRA 5ESBA 1YKTA 4MQAA 2HOBA 2HVXA 2BY6X 5C5NA 1GBHA 1LCYA 4X6MA 3GISB 2KZ4A 4A6LA 3RXVA 2YOLA 2Y7XA 2BD7A 5DP3A 1AB9C 3A7VA 6CHAB 1P01A 4HFPB 1GI8B 1GDUA 1J9CH 2J4IA 3URDA 4Y11E 3UNSA 3URCA 2GD4B 5GXPA 1TONA 5F6MA 1W8BH 3ZV8A 3M3VA 3QO6A 2F43B 4JK6A 1KLJH 4A1XA 5A0BA 2OTVA 3S9AA 3QLPH 1KDQB 1H4WA 4INKA 3SW2B 4K1TA 3RXUA 3SJKA 3UOPA 4J1YA 2YMSB 1JOUB 1QRWA 1A0JA 1O3MA 1Y5BT 1LTOA 4X6NA 2H6MA 1KXBA 3LGVA 5C2ZA 4AGJA 3ZZ5A 2A2XH 1DXWA 2WPKS 4H4FA 3RXKA 3NPSA 2Z7FE 2K8IA 1O2XA 3M5NA 1FZZA 5A0CA 3A8DA 4O97A 3F9HA 1TNHA 4OS2A 3SNAA 2AFQB 1UVPA 2RG3A 4Y7BA 4ZXYH 1HBTH 1IQEA 1H8ED 1FIWA 1S82A 1ABIH 3E0PB 4FUHA 2D26C 1TNIA 3MNXA 2GTBA 3HGNA 3VB5A 1TABE 3SU4A 1GBCA 2O8WA 3LH3A 3DFLA 4GCHF 4D9QA 2VIQA 3UR9A 1BTYA 2ODYB 2XYAA 1BRBE 4A7IB 1LHEH 1TGSZ 5DK1A 1ZGVA 2D1JA 1AU8A 1DUAA 5EQQA 4XFQA 5JDUB 2H9EH 1Z8GA 3SU0A 3RXMA 1Z8RA 2WYJA 3F2GA 4SGAE 4OS1A 3ATKA 4BAKB 3Q76A 3PV4A 4ABAA 1FIZA 2FDAA 3FOAA 1U6QA 2DUCA 3KYGA 4UONA 1AVGH 3T62A 1QJ6B 1NU9A 4X1PU 3RXJA 2OBOA 1O5BB 3RXCA 5DP4A 3MO3A 1C1QA 1GCTB 1MCVA 1CGIE 1Y5UT 1UTMA 4OS4A 3NCLA 1E34B 1BDAA 3ZZ7A 1SL3A 2AMQA 3UWJH 3M3SA 2TGDA 5FXLA 1WU1A 3UY9A 2RDLA 4R0IA 5GIBA 3SI4H 1P11E 5IDKA 1C5ZB 2PKAB 4OS5A 1BTPA 3TJNA 1YY3A 2BY8X 3SUDA 3F6UH 1QBNA 1P9SA 1Y5AT 3RXTA 1QTFA 1P57B 2ZHDA 2CMYA 2BM2A 2XXLA 1UHBB 1LHFH 1LPKB 1O2ZA 3ZZDA 1E36B 1SR5C 1A7SA 2EY4C 1BJUA 1PPEE 4B76A 1NFXA 1UO6A 4UFGH 4TYDA 1HAOH 1S6LA 1SLVB 3MNBA 2TGPZ 2TPIZ 1W0ZU 2ZPRA 3P92A 1N8OC 1C1MA 3GICB 4XBBA 3HK6B 1DSTA 4DW2U 6GCHG 2WZQA 1GI6A 3Q3YA 2GX4A 1DY9A 2D2DA 2FPZA 1TPAE 1MTVA 4Y8YA 1P2KA 2OC7A 2IOTA 1C5QA 2VWOA 1YPKH 1C5XB 1O3BA 2BQ6B 2XW9A 1EQ9A 1EAWA 2XBVA 2OCVB 1EP5A 2BXUH 3DSPA 4DY7B 1HCGA 2L74A 1WAYB 2BLOA 2HNTE 1UTJA 4U30A 1NFWA 1O3LA 3A8AA 5T1VA 2VVCA 1LHDH 2BDAA 1EPTC 3MU0A 1BMLA 2VU8E 3RLWH 3B8JA 1C5VA 1DUEA 3S9CA 1WYKA 3WWFA 5JBCS 4DCDA 3MH5A 1F0SA 2GDDA 4X2VA 2PUXB 3VGCB 5ABWA 1C5YB 3P8GA 1XKBC 2DE9A 1T8NA 3MWIU 1G36A 2F3CE 1SQOA 4I31A 1CT0E 3M5MA 3SQEE 3BTTE 1GL1A 2SNVA 5FCKA 1Y3XA 4DIIH 2ZNKH 2G52A 2ZDMA 4B73A 1AQ7A 2W6ID 3STJA 4GPGA 1C2JA 1TRNA 5J4QA 1IQNA 1C2FA 1OXGA 2BOKA 2WPMS 3DFJA 1Y3VA 2J98B 1FY4A 1HIAB 2PP6A 4H6TA 4YESB 1G3BA 1T31A 3KQ5A 2FTMA 3ZZ4A 2J9NA 1F0TA 3M37A 4D9RA 1BTHH 2BDHA 1TNJA 2Z9LA 1VR1H 3RU4E 3RXSA 2BHGA 3TVJB 3RXQA 2FIRH 3PRBA 3PWCA 1BRUP 4Q4LA 3KN2A 3MO9A 3TNSA 4Y76A 2RFKC 2BX3A 1ZSKA 1IQGA 3KCGH 1V2WT 1ESAA 1N6YA 4MLFB 3H7OA 4KKDA 1O33A 3LDXH 3M5OA 4KTSA 1YPHC 1ZHMA 3LGWA 5EW1H 4RSPA 1GMDF 3LT3A 5FBEA 1LVOA 2J97A 1PPHE 3E1XB 3DSGA 2ASUB 1TX8A 4B6FA 1GJDB 1MTSA 2ZTZA 1KXCA 5FHTA 2FLBH 4FUBA 1O3GA 2ZIQH 2Z9KA 3G01A 2VBCA 5DP9A 1O5EH 7KMEH 3B23B 3T28A 1THPB 5C5OA 3D49H 3ZZBA 5AHGH 1XUGA 1IQKA 1DWEH 4X6OA 4I7YH 3HKIB 2SGDE 4Q7ZA 2P95A 2G4UA 3PWBA 1FPCH 6LPRA 5C1YA 3ATIA 8ESTE 1NC6A 1RFNA 1RD3B 4AFUA 2GT7A 4BAHB 3OTJE 2KAIB 5EW2H 1GI0A 2ZECA 1QR3E 2Z3DA 1C2MA 4Y0ZE 1K0HA 1QFKH 2SGFE 4FU7A 3SQHE 3GDVA 3ESTA 4FUFA 2J92A 4JZFH 1ORFA 5EJLA 1XX9A 3V13A 2FOCA 3S0NA 2JETB 1YPHE 1P04A 5JBAS 3QX5H 1GVLA 1OX1A 1QBOA 1XKAC 2Z3EA 1HLTH 1SC8U 1SGIB 1OYTH 2STBE 3KQBA 1EXFA 1DX5M 3M61U 1K1NA 2JJ1D 2G8TA 1NU7B 1A3BH 2XBWA 5DP8A 1O5FH 2ZU3A 1PYTC 2Q6FA 2BD3A 1TOCB 4YO9A 4X2XA 5F8ZA 3T5FH 4LZ1H 1Z1IA 3JZ1B 2ZC9H 3PTBA 1RIWB 2I6QA 4U2WA 3TNTA 4XD7D 1BB0B 1AY6H 4OS6A 1WV7H 2CJIA 3HATH 1O39A 4IN2A 5DJ7A 2QN5T 2R2WU 3GY6A 4DJZB 1WTGH 1COWD 1GJ7B 1KLTA 1SGNE 4RI0A 2BY9X 1SI5H 2A1DB 4ZCNA 5FAHA 1P06A 1GBKA 1LHGH 3Q77A 2Y5GA 2C90B 4JYVH 3LH1A 5BPEA 2WPIS 2AS9A 1HAGE 4UFFH 4Y79A 4YOJA 2SGPE 4BAQB 4WXIA 1GDNA 1J8AA 1DSUA 3OU0A 2FODA 1BZXE 9ESTA 3MU5A 1ELAA 2B5TB 3BTWE 1B0EA 1FY5A 3LC3A 3ZVEA 1XUHA 3OE7D 5JB9S 1SOTA 4X1QU 4ACBA 3A83A 1MZDA 3CNRA 1BTXA 2ZFFH 5EGMA 5C67A 3ZZ6A 1O2MA 1XUIA 5DO4H 2W7SA 2P3TB 3VXFH 3BG4B 1SGYE 2A5IA 2FX4A 2PTCE 1L4DA 2UWLA 3GY7A 3ZVGA 4MPUA 1CSOE 3DA9B 4AZ2B 1QBVH 2H9TH 2PGBB 4GAWA 2AEIH 1XXDA 3LGYA 3UIRA 5BRRE 1DE7H 3BTME 4JK5A 4OGXA 3RXAA 1EOLA 2G51A 3KGPA 4FUDA 1C2HA 3SUFA 1V2LT 1SSXA 5JB8S 5F8TA 3ELAH 3F9FA 1SHHB 5T6GA 4YT7H 1TIOA 3VB6A 2ZQ1A 3ZVCA 1ABJH 3RXEA 3CENA 4O03A 1YYY1 3BEUA 1GI4A 3TGJE 2VIDA 3A7XA 1GL0E 4UFEH 1UVSH 3MNSA 1GMDG 4MPXA 1MQ6A 3GCTF 4UD9H 3UPEA 2ANKH 3QDZB 1HAYB 1K21H 1BRCE 1O3PB 2L6OA 1XVOA 2VWMA 4NGAH 3U8OH 3GCHC 3UB0A 1MKXK 1Z6JH 4R8TB 3SI3H 1EZUC 3LPRA 2XWBI 1W0KD 1O2TA 2SGQE 5J4SA 2A45B 4NIVA 2IJD1 1Q3XA 2P8OB 4F4OC 3RXIA 3EQ0H 1IQJA 1S5SA 4Q80A 3SUGA 1VITG 1ELFA 4GUXA 1ANDA 3CS7A 4YZUA 3R3GB 4MVNA 4ZHMU 5L30H 3RXGA 5GWZA 1CQQA 2FI3E 3Q3XA 1HIAA 1V6DA 3TIUA 3TJOA 1PQ5A 1XUJA 4WMEA 1ESTA 3GYMA 2FP7B 1ELBA 4RKJB 3FZZA 1YM0A 5CE1A 1QL8A 3MQKC 2PKSC 3RP2A 5AFYH 4BTTB 2VH0A 1IHTH 1MBQA 1V3XA 2QF5A 4NIYA 2PW8H 1C5RA 2AERH 2ZHQH 7LPRA 4ZKOU 1YCPM 4AFZA 1UTPA 1OP2A 1M9UA 1TALA 1TNLA 2NWNA 4GHTA 2C8ZB 3W94A 3SO3A 9LPRA 3SN8A 1QJ7B 7GCHF 1FQ3A 1SGQE 2TGTA 2ZU2A 4ABGA 1D3QB 1C1RA 4H6SB 3DD2H 2M5TA 2UUFB 3O8CA 2VVUA 1LPGB 2RCEA 2HPQH 1OP8A 4XBCA 3VG8A 2GDEH 1O3JA 1DWDH 3S7KB 1K1IA 1G2LA 1S85A 4FOUC 3L33A 3RMOH 5FBIA 4K8YA 5G4BA 1QB1A 2BX4A 3QZQA 3OY6U 1BMMH 2WHXA 1PYTD 1VKYA 1LVYA 1KYNA 3A80A 3MMGA 1RRKA 2ZGBH 1GGDC 4FXGH 1OWEA 1GJ4H 5EG4A 3E0NB 1O3DA 2BDBA 3TJVA 1NROH 4DIHH 1A5HA 4ZXXH 1C4Y2 1G37A 2ZPQA 4XBDA 1AIXH 1DICA 1PPBH 4Y8XA 4TPYA 1H8HD 1O3EA 5LPEA 2V3HH 1QNJA 2H2ZA 4Y6DA 5HM9A 1T8OA 2CHAC 2JH0D 2ZFQH 2B9LA 5C0TA 5IYTA 2R9PA 2QF3A 1DS2E 4FUEA 3KL6A 2BY5X 5A09A 8GCHF 1GHBF 4YXWD 3PLPA 1UW7A 1ZZZA 2XRCA 2ZG0H 4B2BA 2CF9H 2UUJB 1MTNB 2A7JA 5FPSA 3UREA 1JBUH 1SGRE 5EXLA 2CXVA 2JKHA 1UTKA 3SJOA 2QCYA 2HNTF 2YMSD 3M3TA 2Y5HA 1XXFA 4AGKA 5GPIB 1PPCE 3N7EA 2WSSD 1ZTJA 4ISOA 1AWHB 1IQHA 2VINA 4P02A 1HJAB 4NCYA 2I6SA 1SFIA 1K9OE 2ZGCA 3KQEA 1FJSA 2GCTC 1WXRA 1EOJA 1VZQH 2AHME 4AYVB 1GHZA 3SV2H 1TOMH 4D7FA 2HPPH 1P05A 5A8ZA 4WY3A 1DLKB 1L1NA 1MTUA 1YGCH 3EA9A 3SU3A 1C9PA 4ABDA 1AFEH 4ASUD 3BTHE 3F9EA 1ZPZA 2ZFRH 1LMWB 4FETA 2OLGA 3LOXA 1GDQA 2OP9A 2VGCC 3TK6A 4AN7A 1GPZA 5EPYA 1C1PA 1TE0A 1BHXB 1GMHG 3E6PH 2Y82A 1IQFA 1LQEA 1AD8H 3FKSD 2ALPA 1GG6C 4D76A 1LVBA 4DT4A 2BZ6H 1EFRD 1GI3A 3A7ZA 2Y6TA 1ELTA 1XM1A 5T6FA 1NS3A 5EIYA 1SMFE 1ELDE 1A3EH 4KP0A 1F0RA 2AIQA 2OC8A 4I8GA 1W10U 1GBLA 3MU4A 1KLIH 1GHWH 4INLA 2EA3A 1IQMA 2ZDAH 4ISNA 2FXRA 3M7TA 3R0FA 2BLWA 2BD4A 1P2QA 2ILNA 2A7HA 2ZHWH 2VGCB 3O8DA 3V12A 2TGAA 3ZVFA 2NU1E 4IW4E 1QURH 1TMTH 4NA7A 2K0QA 1W13U 1SBWA 1ZHPA 5EPNA 4AYYB 1KXFA 5FCRA 2GVFA 5E0JA 5EOKA 1B5GH 4IBLH 4Q7YA 1AVWA 1WBGB 2BVRH 1E1QD 4YM9A 3SBKA 3F9GA 1DDJA 3SV9A 1P10A 3SOSA 1ETRH 2OINA 1C5MD 1UVTH 2H1UA 4WH6A 6CHAC 1YCPK 1GMCG 4B71A 1S81A 5HKKD 4NZQA 5TCAA 1ELGA 3P8NA 3SJIA 1BT7A 2W7UA 3I29A 1SGTA 3U69H 4Z6AH 1MAXA 1IQLA 1JMOH 3KYFA 4LOYH 4RT1A 5GCHF 2ALVA 1O2GH 3LC5A 5HGGA 2Y7ZA 3ATMA 4AFSA 1SKYE 4ISHH 1HAPH 1C2GA 3NWUA 3MH7A 1UK2A 1BCUH 1UMAH 2BMGB 2P93A 4KTCA 3TK5A 5DPAA 2Y5FA 3TK9A 3SYJA 5JYIA 1JXPA 3N7OA 5A8XA 1O3HA 3M35A 1V2ST 1AWFH 3U1IB 3MU8A 3MHWU 2LELA 1NESE 5C3NA 1EZSC 3F0PA 2P59A 1UCYH 5GDSH 3UAIC 4KGAA 1QCPA 1L1GA 2NU2E 5HXFA 4MTBA 2BY7X 1W0JD 1A5IA 1BMFD 6ESTA 3U9AH 1K2I1 2THFB 1GBDA 2G81E 3OTPA 3C27B 1GBMA 1F5KU 3DHKH 1AB9B 1ELEE 1ZSLA 4TY6A 4TPIZ 3TGKE 5EU8A 3RM2H 1MU8B 1L0ZA 4ISIH 1FAKH 4Q63A 1UVOA 2FZZA 3DUXH 2ZDKA 1JIRA 3SU1A 4WWYA 1JRSA 4BXSA 2ZU1A 4I33A 3BIUH 5C17A 1DPOA 3ZVAA 1NO9H 1O3KA 1BRAA 3RUOA 2F9UA 1WOFA 3OY5U 2WPHS 3E91A 2O8MA 4O9VA 3SGAE 3ZZ3A 2UWPA 3PM3A 1Z6EA 2D8WA 3T27A 4JYTA 1A0HB 4OM9A 4ZHAA 4AG2A 2XC0A 4DG4A 1RXPA 1W7GH 4MPVA 2PTNA 4JZDH 2FOEA 3KQCA 4Y10E 1D3TB 2G5NA 2GZ9A 4ASHA 1GCTC 1H9LB 2QXJA 1Y3WA 1D3PB 1YPGH 3KEEA 3PTNA 1QRZA 2J2UA 5L2YH 1GI1A 3PV2A 2BTCE 2GCHF 3RU4D 3TJUA 1GBEA 1CT2E 1EX3A 2AH4X 2OC1A 4GCHG 1Z8IB 1F5LA 3W1EA 3RC6A 1V2PT 3FVFB 4NWLA 1DWCH 3D65E 1RTKA 1GMCF 2OK5A 3VXEH 5C94A 1PQAA 4MG3A 1P2MA 3T26A 1RGQA 1L2EA 2RA3A 2CGAA 2BQWB 2XCNA 3KHVA 2SFAA 4CRAA 3U98H 2ZEBA 1NBMD 1WTHD 4DOQA 4X8VH 3M7UA 1OS8A 5TCCA 2A32A 4HZHA 1EATA 2P16A 3T2NA 1SGPE 3P8FA 4TY7A 1C2KA 3Q00A 1O34A 2BD9A 1A1RA 2P8OC 4NSVA 1O35A 1GHXH 1O2LA 2G4TA 3GY5A 1Z71A 1ZYOA 1AUTC 1EZQA 3PLBA 3KF2A 2ESTE 1F0UA 1W14U 3A81A 5K0HA 5LH8A 1FNIA 5A2MH 1O2YA 4IMQA 1E1RD 3MTYA 5HIZA 4LK4A 2VVVA 2FI4E 4THNH 2RDEA 2QIQA 2ZTYA 3F1SB 4CH8B 3RC5A 5E0HA 2PKAA 3BTEE 1OHHD 4NA8A 1RTLA 4NG9H 1SOZA 1Z8JB 1DM4B 5C0UA 1BBRH 4CHAB 2FYRA 1Y8TA 1AI8H 2VH6A 3IWMA 1DXPA 3M7QA 5DP7A 1BA8B 1O32A 4VGCB 4UE7H 1QL7A 1F5RA 3LGIA 1RTFB 2C3SA 2CF8H 3ENSB 3PMJA 1TNKA 1FLEE 2F91A 1AFQC 2AIPA 2A4QA 4I8LA 1HAXB 2A4RA 2M2AA 3PMHB 3TITA 1GI9B 5LPFA 1GJ6A 3MH4A 1KXDA 1O30A 2AMDA 1O0DH 3ZVBA 4AC9A 1O2UA 3PRDA 5DG6A 5AF9H 2DE8A 2FOFA 5CHAB 1SQTA 1L4ZA 1TX7A 2QYIA 2V3OH 3P6ZB 1KTTB 2BZAA 3V7TA 3K65B 3P17H 1BMNH 3SZNA 1GHBG 2ZCHP 3GY3A 5DSFA 2F9BH 4IC6A 1K1OA 2BOHB 4X1RU 2B7DH 1C5NH 1EPTB 3ZV9A 3SORA 1PPZA 3TU7H 7ESTE 2PLXA 4TWWA 2K1QA 4SGBE 1ARCA 4JZEH 4X8UH 3LIWA 1NT1A 2KR7A 3GCNA 3VGCC 1EZXC 1HAZB 4X0WU 2AYWA 5EQRA 1PQ8A 1P12E 1GBBA 1MTNC 1YPJH 1O2WA 1C1UH 1Q31A 5FPTA 2BD5A 2SGAA 1TBZH 2IN2A 2A7CA 2ZKSA 4KTUA 1C1NA 2V35A 4FUJA 2C8XB 1DVAH 1P2JA 1HAIH 3E3TA 5A8YA 3A7TA 5EJZA 3RXPA 3SV8A 1EPTA 2ZGHA 1D9IA 1KDQA 1O36A 2ZFSA 1SQRA 3SZEA 1MBMA 2VJ1A 1A61H 3UFAA 1O2OA 2ZP0H 4ISLA 3OYPA 4WMDA 3TH2H 2GCTB 4BTUB 2V0BA 4RKOB 3FZDA 3L6PA 3QN7A 4AFQA 2JETC 1GI5A 4AORA 2PHBA 1O3NA 1P8VC 1P0SH 4LXBH 4OGYA 2H5CA 2HVYB 2FOMB 1G32B 3A88A 4ABHA 1O2IA 1H9IE 4Z0KA 4KELA 1WCZA 2EI7A 1ANCA 4AB8A 3UR6A 3E8LA 1ZLRA 1P2NA 1SFQB 1D4PB 4F49A 2KM0A 1E79D 1TGBA 2BDGA 1GBAA 3EAJA 4BXWA 4FU9A 5IK2D 2VIPA 4O3UA 1AUJA 3UQVA 3T25A 1GBTA 3AAVA 1TGCA 2XOKD 3UNQA 3RMMH 1O2SA 4Y7AA 2ZTXA 2NU3E 5EXNA 2QY0B 1H1BA 2VIOA 5F8XA 1KTSB 1EB1H 3OFND 1O31A 1V2UT 1S6FA 4X2YA 1ANBA 2KCPA 3A84A 1FY1A 2G5VA 2WPJS 1CA8B 4CBOA 1GHAF 1WSSH 3SHCH 2ZHFH 5DP5A 1LKAA 5AFZH 5KECA 3NZIA 3K9XB 3MFJA 4MNYA 1MH0A 1C5LH 2Z9GA 3UQOA 3GDSA 2BB4A 4K2YA 3TH4H 1XMNB 2C93B 2FOGA 3N99A 1O5DH 4CRDA 1WUNH 3FP7E 1QB6A 1VITF 3SNEA 4NA9H 2O8UA 1GWAA 1NRNH 4PROA 2QXHA 1SLXB 4E7NA 2FX6A 3BTKE 1TQ7B 4K8BA 3FO8D 5LGOA 3A85A 1N1LA 1TAWA 3P70B 4NIXA 2ZQ2A 1BOQA 1O2VA 1TMUH 1ELCA 1BIOA 2ZU4A 3FANA 2Y81A 4Z1MD 5KGOA 1B7XB 4DGJA 3AVZA 2KCAA 1OWDA 3DCLA 3F3BA 1O2HA 2GV6A 1NTPA 2C8YB 2GGVB 5T6DA 1TWXB 4F48B 2CV3A 2FM2A 2O8TA 3FFGA 3QWCH 2ZFPH 1NY22 1HDTH 1K22H 4U01A 3U1JB 4UFDH 2V7QD 2OXSA 1CHOF 1FMGA 2HWLB 1FV9A 2ULLA 2BLVA 1YLDA 3K2UA 1MKWK 1SG8B 3S7HB 1NM6A 2OQ5A 2YNAA 4ZHLU 2ZDVH 1S0QA 4FVBA 2YMSC 1ELVA 2H5DA 4INHA 3UOUA 5JBTA 1XVMA 2ODPA 3QTVH 3GCHB 4NFFA 4LZ4B 3ODFA 5EQSA 4QT8C 2QV1A 1AKSA 1HAVA 5EJ1A 1JIMA 1KXAA 1L1JA 1G9IE 1MD7A 4AB9A 2FMJA 3BG8A 3RXBA 2HRVA 3SNBA 4XDEA 2SGEE 1GBIA 3VB3A 1CHOG 5SGAE 8KME2 1QQUA 1OWHA 1GJ8B 3LONA 2V3MA 4HGCA 2QA9E 2WUBA 1C5UA 1TMBH 3PLKA 2PKSB 3M36A 3QGNB 1VGCC 3PMBB 4Y8ZA 5DKMA 3A8BA 5GNDA 3A7YA 4NIWA 4J2YB 1D6WA 2FESH 2PV9B 1FPHH 3RM0H 2J38A 2ANMH 1CU1A 3QZRA 1C9TA 5DN6D 1AO5A 3WWBA 3BV9B 3F68H 5DGJA 1MKWH 1W2KH 2BDIA 1LKBA 4CRCA 3SV6A 4ZUHA 1C2EA 2W5EA 4A1TA 4H42U 1GMHF 3EE7A 4B2CA 1VCPA 3H5CB 3D62A 4TT3D 3T29A 3ZYDA 2W3KA 3ZZCA 1GHAG 1A46H 1GCDA 1HYLA 2A5KA 3GCOA 1YP9A 3LJJA 1TB6H 1HB0B 1OOKB 1O2JA 3PV5A 3N7DA 4YTAA 3PMAB 1V2MT 2QAAA 2PR3A 1YF4A 1BQYA 1HXEH 1ESBA 3EA8A 3BSQA 1S6HA 2FOHA 3EYDA 1X7AC 5FX6A 4GHQA 3SJ8A 4F55A 1D6RA 1Y3YA 1OKXA 1WDIA 2BVSH 2A4GA 1TYNA 2QE7D 4AG1A 1SLUB 2BQ7B 1BUIA 1CVWH 1FY8E 1ZJKA 1DANH 1MZAA 2QXIA 5GCHG 1FN8A 3ODDA 5HM2A 3VFEA 4Y71A 1CA0B 1N6XA 2SNWA 3VB4A 2JH5D 2ZCKP 3RXLA 4WH8A 1QA7A 1AE5A 1UK4A 2F9VA 3LU9B 1G3DA 1V2VT 1BITA 2LP6A 3RXFA 2XCFA 4X1NU 2FTLE 3I78A 1NBME 4JYUH 1CBWB 3PO1C 2ANWA 4E06H 4YLUA 4BAMB 3JZ2B 1FY3A 4HG6A 3GOVB 1CHGA 3ITIA 1WQSA 2H9HA 4CR5A 2ZA5A 3SGQE 5B6OA 1W11U 2AGEX 2R3YA 2Z94A 4K69A 2AGIX 1ARBA 4ABEA 2C8WB 4I8JA 3MNCA 4BANB 1CA0C 1NZQH 5EXMA 1ZRBA 4CRBA 5JPMH 1V2RT 3A82A 3OSYA 2J5UA 4AOQA 4X8SH 1V2NT 1P3CA 3GY4A 1IQIA 3MU1A 3FP8E 4YOIA 2VWLA 1CBWC 1SGCA 3PO1B 3F2HA 1A5GH 2WV4A 3SGBE 1INCA 1P9UA 3EA7A 1SQAA 1O5AB 2C4FH 3DT0H 1ZHRA 3KNXA 4M9FA 1ZSJA 5A0AE 1J16A 3IITA 4IS5A 4BNRA 3DSOA 3P95A 3GDUA 4K60A 1GJBB 1V2QT 2YNBA 4FUGA 4WXVA 1C5OH 3F0OA 3KQDA 5CHAC 1O3CA 2WV9A 2G00A 2EQNA 4B6EA 4Y0YE 1AVXA 1B0FA 4HI3A 4WMFA 1W3CA 1YPLH 1CGJE 1MABB 3A86A 5L6NH 1F2SE 1NRSH 1NFUA 4IGDA 1QB9A 2IPQX 4IMZA 4CRFA 1TBRH 1HGTH 1LHCH 2ZU5A 5PTPA 4WJG2 2FWWA 3O8BA 1THRH 1UTNA 3LKWA 1D3DB 2W26A 1HXFH 5T3HA 4K1SA 1C2LA 4DURA 1ZGIA 1ZJDA
chains in the Genus database with same CATH topology
1O2PA 4MNXA 1TRYA 3BTFE 4UDWH 2ZDNA 2ZCLP 4ABBA 4ZKRU 4UEHH 2Z3CA 1T32A 3A89A 4E7RG 1HFDA 1O5GH 8LPRA 3SNDA 2VIWA 4M7GA 1VJ9U 2OC0A 1DOJA 4WVPE 1EB2A 2R0LA 3NUMA 1NRRH 2ZHEH 2WINI 1EJMA 1VJAU 2WYGA 4D7GA 1UHBA 3H7TA 1MAYA 1K1JA 2WPLS 1ZMLA 3M5LA 5C20A 3BN9A 1C1OA 4A1VA 1Q2WA 1SGFA 1GG6B 5K7RA 1DWBH 5FX5A 1TQ0B 1SHYA 3IG6B 1NRQH 1MQ5A 2LNCA 1CT4E 2GMTC 3AAUA 4NZLA 4I32A 2AMPA 3PYHA 2IJOB 2XTTB 2R3UA 1QGFA 3BEFB 3STIA 4ESTE 1QHRB 1Z1JA 1ZPCA 5E0GA 3S9BA 2P3UB 1ZR0A 7GCHG 1HUTH 5GJ4B 1QIXB 1AGJA 1EAXA 4MNVA 1J17T 4ZROA 1ZRKA 2GP9B 2GZ7A 4FU8A 1J15A 3O8RA 1K1MA 4CREA 3VPKA 2ANYA 1IOEA 2J34A 1EP6A 2OBQA 4NFEA 1F92A 5FPYA 2QC2A 1K28D 4DVAU 5C1UA 1E37B 1S83A 1FAXA 2BYAX 3Q3KA 1NRPH 1AN1E 1QRXA 1AHTH 1MUEB 1BMAA 3GYLB 1EAIA 3AW0A 3UNRA 2VB0A 1GVZA 3TLOA 3MI4A 2EEKA 4ZKSU 4HTCH 1PJPA 3SJ9A 1O5CB 2QXGA 2F9OA 1HPGA 1G30B 3HK3B 2XNIA 2Z9IA 3BTGE 2LPRA 1FN6A 1IHSH 1QL9A 2J95A 3UTUH 3RXDA 1BHXF 1CGHA 3CS0A 1FONA 4D8NA 3ZYEA 2G55A 1O3FA 1HJ8A 2F9PA 3A87A 2HLCA 1H9HE 4FUIA 2GKVE 2KAIA 3RLYH 2BVXH 5AVDA 4MDSA 5I25A 1H8DH 1BTZA 1TGNA 1TBQH 4Q7XA 1C5WB 1ZMJA 1VITH 1YPEH 4BTIB 2QF0A 4DT7B 2ZZUH 4X2WA 4K5ZA 1ZPBA 1UCYE 1BBRK 2OUAA 1KSNA 2GZ8A 4A5TS 2PSYA 4MNWA 4RN6A 1HJ9A 3S69A 5C1XA 3MYWA 1F7ZA 1P2OA 1ZTLA 2GV7A 2VIVA 2W3IA 1SGEE 1MKXH 1UVUH 4GVUA 1IAUA 1YCPH 1EUFA 3V0XA 3K6ZA 2WV5A 4X1SU 1GBJA 2ZF0H 4IC5A 1KY9A 1OWJA 1G3CA 2XC4A 4WF8A 1RIWC 2RA0A 4CRGA 8GCHG 1XUKA 4B1TA 5E8EH 1H8IH 3HGPA 5I46H 2Q1JA 2TRMA 1NN6A 4FVDA 2VNTA 2HGTH 3BF6H 4I8HA 1QQ4A 1V2OT 1HAHH 1SVPA 3NKKA 4YLQH 1PPGE 3RXRA 2EI8A 2FO9A 2FS8A 1SGFG 3D23A 1TPOA 2HNTC 1MD8A 4CBNA 4ABIA 2XBYA 4ABFA 1E35B 1SGDE 4BOHA 4GSOA 1OPHB 3CP7A 1TA6A 2UUYA 3QGJA 1GHYH 2XBXA 2F83A 1NPMA 5ETXA 1LQDB 2FS9A 1O2KA 1VGCB 4X8TH 1EJAA 3A8CA 1TGTA 4U32A 1TFXA 1Y3UA 5E2PA 1C1TA 1EJNA 1C2DA 1J14A 1G2MA 1OWKA 1TPSA 1YPMH 2FYQA 1W0YH 1HNEE 1P2IA 4E05H 3LGUA 2ZGJA 4YOGA 1O3OA 3SV7A 1KIGH 1DLEA 2STAE 3BG4C 4A92A 3C1KA 2ZDLA 3NK8A 3P8OA 1QJ1B 1T7CA 2A2QH 3EGKH 1UCYK 4JCNA 2BXTH 1MTWA 4FUCA 5CMXH 4ZAEA 2Q6DA 1ANEA 1W7XH 2F9NA 4VGCC 5DP6A 1WQVH 3UUZA 1P3EA 3E16B 1YC0A 1BBRE 2IPHA 1HV7A 3BTQE 1YBWA 3SUEA 4Q2KA 1LPZB 2B8OH 4B2AA 1S84A 1AFQB 2BLQA 1GJCB 1W12U 2Y80A 1TA2A 1CO7E 4XOJA 1GHVH 2FOBA 2P94A 3U8RH 3PB1E 1CE5A 1TNGA 4K3JA 3SU6A 1THSH 1YLCA 6GCHF 1GVKB 1P02A 1P03A 1ZMNA 1N8OB 3UWIA 5F03A 2NU4E 3QTOH 3V3MA 1GBFA 1C1VH 2P3FH 3U8TH 3VEQB 4O3TA 1FUJA 5E2OA 1GGDB 3BIVH 2FOAA 4CR9A 1LO6A 1MU6B 2A0QB 2J94A 3RDZA 1GI7B 4B74A 4CHAC 4B75A 2PSXA 5TJXA 1RS0A 1QY6A 4XSKU 3LJOA 3L3TA 4YT6H 1G3EA 2ZI2H 1BTUA 1JWTA 2CHAB 3RMNH 4JMYA 3FAOA 1T4UH 5ESTE 1TLDA 3AASA 2V6NA 4I8KA 2BD8A 1O3IA 3ZZ8A 3RC4A 2A5AA 4X6PA 2ZFTA 1DY8A 1GJ5H 3I77A 1TPPA 5H4IB 2FEQH 1O38A 2Q6GA 3VB7A 1UTLM 2B0FA 3ATLA 3W95A 3FP6E 1LVMA 2VWNA 1C1WH 3TPIZ 2XC5A 4JZIA 3ZZ9A 3MO6A 4ZH8A 3TGIE 1EASA 1HJAC 1TRMA 4BAOB 1GJ9B 1C4U2 1E38B 1O2RA 3SNCA 2UWOA 2ZO3H 1JRTA 1EAUA 4IN1A 3PROA 3HKJB 1Z7KA 3BEIB 1DFPA 1BTWA 1GJAB 3ZZAA 5L2ZH 1LDTT 2GT8A 1K1LA 4ABJA 1PFXC 1UK3A 2EC9H 5HMAA 2PWXA 1P09A 1UTQA 2FLRH 2OQUA 1HRTH 1K1PA 5EODA 3RXHA 1AZZA 4NWKA 3K6YA 1ZTKA 3MH6A 1FI8A 1V2KT 3ATWA 1KXEA 1OWIA 1VCWA 1AKSB 1HAVB 1AE8H 1AMHA 1C4V2 3A7WA 1ACBE 1ETSH 2NU0E 2ODQA 2TIOA 1OP0A 1E0FD 3EE0B 2ZGXH 1FDPA 1Y59T 1FXYA 3ZVDA 3EDXB 2QGRA 4MPWA 2HALA 3MOCA 1O2QA 2WUCA 1PQ7A 3RU4T 4AX9H 1MCTA 3GCTG 2BDCA 5JBBS 1T4VH 4NSYA 1V2TT 2JH6D 4ZMAH 2TBSA 1TX6A 3RXOA 3SU5A 2PUQH 2A31A 3GY2A 1O2NA 4ZKNU 2GCHG 1T8LA 1C5SA 2A4OA 1UJ1A 3SHAH 1PPFE 1C1SA 1GI2A 3NXPA 5HYOA 2BDYA 1DT2A 1A0LA 3B9FH 2EI6A 1ID5H 2GMTB 2R2MB 2O9QA 3AW1A 1T8MA 1NFYA 1OYQA 2FI5E 2R0KA 1AZ8A 2OD3B 3BTDE 1EKBB 1SLWB 3QK1A 2BD2A 2ZWLH 3RMLH 1ETTH 1UTOA 3TH3H 2O8LA 1C2IA 3WY8A 3SU2A 3OX7U 2Z6BD 1MMJN 3LGTA 1C5PA 3HPTB 1O3AA 1A2CH 1XUFA 2PFEA 4OS7A 1S0RA 1VCQA 1V2JT 1A4WH 1QA0A 2PGQB 1OSSA 1O37A 1C5TA 1SPJA 4GLYA 4CH2B 2UUKB 3QUMP 2CN0H 4K1EA 4TWYA 1ZOMA 1BJVA 4JZ1A 2AGGX 2ZPSA 1RJXB 1DITH 1SB1H 4XE4A 3E90B 2XWAA 2Z9JA 3KIDU 3GY8A 5LPRA 5ESBA 1YKTA 4MQAA 2HOBA 2HVXA 2BY6X 5C5NA 1GBHA 1LCYA 4X6MA 3GISB 4A6LA 3RXVA 2YOLA 2Y7XA 2BD7A 5DP3A 1AB9C 3A7VA 6CHAB 1P01A 4HFPB 1GI8B 1GDUA 1J9CH 2J4IA 3URDA 4Y11E 3UNSA 3URCA 2GD4B 5GXPA 1TONA 5F6MA 1W8BH 3ZV8A 3M3VA 3QO6A 4JK6A 4A1XA 1KLJH 5A0BA 2OTVA 3S9AA 3QLPH 1KDQB 1H4WA 4INKA 3SW2B 4K1TA 3RXUA 3SJKA 3UOPA 4J1YA 1JOUB 1QRWA 1A0JA 1O3MA 1Y5BT 1LTOA 4X6NA 2H6MA 1KXBA 3LGVA 5C2ZA 4AGJA 3ZZ5A 2A2XH 1DXWA 2WPKS 4H4FA 3RXKA 3NPSA 2Z7FE 1O2XA 3M5NA 1FZZA 5A0CA 3A8DA 4O97A 3F9HA 1TNHA 4OS2A 3SNAA 2AFQB 1UVPA 2RG3A 4Y7BA 4ZXYH 1HBTH 1IQEA 1FIWA 1S82A 1ABIH 3E0PB 4FUHA 2D26C 1TNIA 3MNXA 2GTBA 3HGNA 3VB5A 1TABE 3SU4A 1GBCA 2O8WA 3LH3A 3DFLA 4GCHF 4D9QA 2VIQA 3UR9A 1BTYA 2ODYB 2XYAA 1BRBE 4A7IB 1LHEH 1TGSZ 5DK1A 1ZGVA 2D1JA 1AU8A 1DUAA 5EQQA 4XFQA 5JDUB 2H9EH 1Z8GA 3SU0A 3RXMA 1Z8RA 2WYJA 4SGAE 4OS1A 3ATKA 4BAKB 3Q76A 3PV4A 4ABAA 1FIZA 2FDAA 1U6QA 2DUCA 4UONA 1AVGH 3T62A 1QJ6B 1NU9A 4X1PU 3RXJA 2OBOA 1O5BB 3RXCA 5DP4A 3MO3A 1C1QA 1GCTB 1MCVA 1CGIE 1Y5UT 1UTMA 4OS4A 3NCLA 1E34B 1BDAA 3ZZ7A 1SL3A 2AMQA 3UWJH 3M3SA 2TGDA 5FXLA 1WU1A 3UY9A 2RDLA 4R0IA 5GIBA 3SI4H 1P11E 5IDKA 1C5ZB 2PKAB 4OS5A 1BTPA 3TJNA 2BY8X 3SUDA 3F6UH 1QBNA 1P9SA 1Y5AT 3RXTA 1QTFA 1P57B 2ZHDA 2CMYA 2BM2A 2XXLA 1UHBB 1LHFH 1LPKB 1O2ZA 3ZZDA 1E36B 1SR5C 1A7SA 1BJUA 1PPEE 4B76A 1NFXA 1UO6A 4UFGH 4TYDA 1HAOH 1SLVB 3MNBA 2TGPZ 2TPIZ 1W0ZU 2ZPRA 3P92A 1N8OC 1C1MA 3GICB 4XBBA 3HK6B 1DSTA 4DW2U 6GCHG 1GI6A 3Q3YA 2GX4A 1DY9A 2D2DA 2FPZA 1TPAE 1MTVA 4Y8YA 1P2KA 2OC7A 2IOTA 1C5QA 2VWOA 1YPKH 1C5XB 1O3BA 2XW9A 2BQ6B 1EQ9A 1EAWA 2XBVA 2OCVB 1EP5A 2BXUH 4DY7B 1HCGA 1WAYB 2BLOA 2HNTE 1UTJA 4U30A 1NFWA 1O3LA 3A8AA 2VVCA 1LHDH 2BDAA 1EPTC 3MU0A 1BMLA 2VU8E 3RLWH 3B8JA 1C5VA 1DUEA 3S9CA 1WYKA 5JBCS 4DCDA 3MH5A 1F0SA 2GDDA 4X2VA 2PUXB 3VGCB 5ABWA 1C5YB 3P8GA 1XKBC 2DE9A 1T8NA 3MWIU 1G36A 2F3CE 1SQOA 4I31A 1CT0E 3M5MA 3SQEE 3BTTE 1GL1A 2SNVA 5FCKA 1Y3XA 4DIIH 2ZNKH 2G52A 2ZDMA 4B73A 1AQ7A 3STJA 4GPGA 1C2JA 1TRNA 5J4QA 1IQNA 1C2FA 1OXGA 2BOKA 2WPMS 3DFJA 1Y3VA 1FY4A 1HIAB 4H6TA 4YESB 1G3BA 1T31A 2FTMA 3ZZ4A 2J9NA 1F0TA 3M37A 4D9RA 1BTHH 2BDHA 1TNJA 2Z9LA 1VR1H 3RU4E 3RXSA 2BHGA 3TVJB 3RXQA 2FIRH 3PWCA 1BRUP 3KN2A 3MO9A 3TNSA 4Y76A 2BX3A 1ZSKA 1IQGA 3KCGH 1V2WT 1ESAA 1N6YA 4MLFB 3H7OA 4KKDA 1O33A 3LDXH 3M5OA 4KTSA 1YPHC 1ZHMA 3LGWA 5EW1H 4RSPA 1GMDF 3LT3A 5FBEA 1LVOA 1PPHE 3E1XB 2ASUB 1TX8A 1GJDB 1MTSA 2ZTZA 1KXCA 5FHTA 2FLBH 4FUBA 1O3GA 2ZIQH 2Z9KA 3G01A 5DP9A 1O5EH 7KMEH 3B23B 3T28A 1THPB 5C5OA 3D49H 3ZZBA 5AHGH 1XUGA 1IQKA 1DWEH 4X6OA 4I7YH 3HKIB 2SGDE 4Q7ZA 2P95A 2G4UA 3PWBA 1FPCH 6LPRA 5C1YA 3ATIA 8ESTE 1NC6A 1RFNA 1RD3B 4AFUA 2GT7A 4BAHB 3OTJE 2KAIB 5EW2H 1GI0A 2ZECA 1QR3E 2Z3DA 1C2MA 4Y0ZE 1QFKH 2SGFE 4FU7A 3SQHE 3GDVA 3ESTA 4FUFA 2J92A 4JZFH 1ORFA 1XX9A 3V13A 2FOCA 3S0NA 2JETB 1YPHE 1P04A 5JBAS 3QX5H 1GVLA 1OX1A 1QBOA 1XKAC 2Z3EA 1HLTH 1SC8U 1SGIB 1OYTH 2STBE 3KQBA 1EXFA 1DX5M 3M61U 1K1NA 2G8TA 1NU7B 1A3BH 2XBWA 5DP8A 1O5FH 2ZU3A 1PYTC 2Q6FA 2BD3A 1TOCB 4YO9A 4X2XA 5F8ZA 3T5FH 4LZ1H 1Z1IA 3JZ1B 2ZC9H 3PTBA 1RIWB 2I6QA 4U2WA 3TNTA 1BB0B 1AY6H 4OS6A 1WV7H 2CJIA 3HATH 1O39A 4IN2A 5DJ7A 2QN5T 2R2WU 3GY6A 4DJZB 1WTGH 1GJ7B 1KLTA 1SGNE 2BY9X 1SI5H 2A1DB 5FAHA 1P06A 1GBKA 1LHGH 3Q77A 2Y5GA 2C90B 4JYVH 3LH1A 5BPEA 2WPIS 2AS9A 1HAGE 4UFFH 4Y79A 4YOJA 2SGPE 4BAQB 4WXIA 1GDNA 1J8AA 1DSUA 3OU0A 2FODA 1BZXE 9ESTA 3MU5A 1ELAA 2B5TB 3BTWE 1B0EA 1FY5A 3LC3A 3ZVEA 1XUHA 5JB9S 1SOTA 4X1QU 3A83A 1MZDA 1BTXA 2ZFFH 5EGMA 5C67A 3ZZ6A 1O2MA 1XUIA 5DO4H 2W7SA 2P3TB 3VXFH 3BG4B 1SGYE 2A5IA 2FX4A 2PTCE 1L4DA 2UWLA 3GY7A 3ZVGA 4MPUA 1CSOE 3DA9B 4AZ2B 1QBVH 2H9TH 2PGBB 4GAWA 2AEIH 1XXDA 3LGYA 3UIRA 5BRRE 1DE7H 3BTME 4JK5A 4OGXA 3RXAA 1EOLA 2G51A 3KGPA 4FUDA 1C2HA 3SUFA 1V2LT 1SSXA 5JB8S 5F8TA 3ELAH 3F9FA 1SHHB 5T6GA 4YT7H 1TIOA 3VB6A 2ZQ1A 3ZVCA 1ABJH 3RXEA 3CENA 4O03A 1YYY1 3BEUA 1GI4A 3TGJE 2VIDA 3A7XA 1GL0E 4UFEH