3RXFA

Crystal structure of trypsin complexed with 4-aminopyridine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxfA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxfA02
2THFB 2Z9KA 2A31A 2GV7A 2AEIH 2JH0D 1LCYA 2PWXA 2FESH 5DP5A 2Q6DA 1HPGA 1VITG 1J15A 1C2IA 2AIPA 3U98H 1GI8B 1SLWB 1BTZA 8GCHF 2OC0A 5EODA 2GZ9A 2AYWA 1H8IH 4Q7XA 1LPZB 1E37B 2Q6FA 3LKWA 1AZZA 4ABBA 4WXVA 1BTUA 4J1YA 2C8XB 2YNAA 2ZA5A 4ABHA 2FEQH 1BTHH 3UNRA 3P8OA 3TITA 5LPFA 3LIWA 5T6DA 1XUIA 2PW8H 1SQTA 4HTCH 1K1PA 2QXGA 4MDSA 2GX4A 4CH2B 2ZGBH 3GY4A 1KXDA 3EAJA 3SNEA 2F9PA 3MNBA 1T7CA 3GYLB 3PWCA 3AVZA 5E0HA 1QB9A 1GI0A 1TAWA 2TGAA 1XM1A 2SNWA 4BXSA 5PTPA 1LO6A 1LVBA 3R3GB 1OP8A 3FP8E 2W3IA 5J4SA 1GMHF 4H6TA 1DX5M 2BLWA 1QY6A 1AFQB 1BIOA 3KF2A 3LT3A 3ZZ3A 1F5LA 1UTMA 1H8DH 4HZHA 2KAIA 4WH8A 3D23A 1DUEA 3DA9B 2OC8A 2ZWLH 1PQ7A 1JRTA 1V2OT 3L33A 1HDTH 2GZ8A 2W26A 3UIRA 2BVRH 3PMAB 1DICA 2VWNA 3BTQE 5F8XA 2BD4A 2ZKSA 1IQFA 1KXFA 2GCTC 3UR9A 2FDAA 1TMBH 1C1MA 1TONA 2ODYB 3RXFA 2Z3CA 1VGCC 1ELDE 4VGCC 1O2YA 2FOEA 4O03A 3SUDA 4DJZB 1S5SA 3T29A 1S83A 3ATKA 1B0FA 3DUXH 3ZYDA 1MKWK 2P8OC 3SUGA 1V2LT 1EB2A 2BXTH 4ZKSU 1EZQA 4HI3A 3F1SB 2WPHS 4B76A 1E0FD 4K1TA 3E0NB 3VB4A 3RMNH 3GY5A 1KDQB 2BM2A 2FS9A 2ZGXH 3FANA 5DKMA 5HMAA 3TH3H 1HAVB 4DURA 5HM9A 1YCPM 3QZRA 3C1KA 3UUZA 1OP2A 1TQ0B 1ZPZA 2ZO3H 2Q1JA 1SGPE 1BMMH 1AB9C 2O8UA 3QUMP 1TBZH 1W0YH 1HXFH 2F9BH 4ISNA 1A5IA 3ZZCA 3RXHA 3UPEA 2F9UA 4NG9H 1QA7A 2OD3B 3A7TA 4E7NA 5E2PA 1K1LA 1BRAA 1P09A 4ZHLU 4X1QU 2OP9A 1C1QA 2QC2A 1O3HA 1C5OH 5LH8A 1ZJKA 1O3IA 2EI7A 5G4BA 2H5DA 1CBWC 4QT8C 4CH8B 1VJAU 3T5FH 4YO9A 2V3HH 3TIUA 3LC3A 1PPCE 2BLQA 1K1MA 1F5RA 1O2UA 3E0PB 5JBCS 3SGAE 5DO4H 1GG6C 1OSSA 2Z9LA 3K2UA 2G8TA 4I31A 1GBIA 5EPYA 1K21H 2Z3EA 2XWBI 2ZPRA 4MVNA 1BJVA 3GDSA 1VR1H 3ZVGA 1GBKA 2PLXA 2UWPA 1WQVH 4FVBA 3RXAA 1FPCH 1W13U 1QBOA 1TOCB 3QGJA 4I8LA 1O34A 1TX6A 1HCGA 1TPPA 1C5WB 1HGTH 3LGTA 3RU4T 4O97A 2ODPA 2CXVA 4WMDA 1MCVA 1DLEA 1W7XH 1P04A 2Z3DA 4FUJA 1FY4A 4A92A 1K28D 1GBJA 1O5AB 4BTUB 5C5OA 1E35B 1D6WA 3GY6A 1GHWH 3U8RH 1RXPA 3TJUA 1MBQA 5A8ZA 1C9PA 3SNDA 3ZVFA 2XC0A 1ESBA 1DWBH 3I29A 1SGNE 1SPJA 4D8NA 4YESB 4F4OC 5FBIA 1CGJE 1GHXH 4BAOB 1MMJN 1Y3YA 3OTJE 1WYKA 1Y5UT 3MTYA 1QA0A 1GVKB 5EQRA 2CN0H 2B7DH 1FI8A 1GVZA 3FP6E 1DSUA 4CRDA 2BOHB 3SU5A 1TA2A 2ZFSA 3A8AA 2UUKB 3BTFE 7ESTE 2NU1E 3VB7A 2ZHWH 3NXPA 1ZHPA 2F3CE 1BHXF 3JZ2B 2ZECA 3U1JB 1C1WH 1V2MT 3GY8A 2PGBB 2FS8A 2Y6TA 1LPKB 4B1TA 3EDXB 2ZFQH 3RU4E 5T6FA 1UVPA 2I6SA 1OOKB 2CV3A 4NIVA 1V2KT 5DP6A 1S0QA 1YC0A 3NCLA 1QCPA 1XVOA 3LONA 5EG4A 3LH1A 3FP7E 1YGCH 3MH5A 1O3PB 2GD4B 2G55A 1DUAA 1KXEA 1O2KA 1SI5H 3ZVBA 2BD9A 3RXUA 5GPIB 2ZDNA 3SV7A 1O3FA 1HIAA 3S0NA 1ZYOA 4AG2A 1G3EA 2ZI2H 2Y82A 1O33A 2QXHA 3BG8A 3DFLA 1TX8A 5AVDA 2VGCB 2FP7B 1C5QA 1C5VA 1EB1H 1O3EA 3GY3A 5DP4A 3UOPA 2Y80A 1F0RA 3A8CA 1O3JA 4JYTA 4I33A 4Q7ZA 3PO1C 5ABWA 1TGNA 4ZXXH 4K69A 1O3OA 2ZIQH 3M5OA 3L6PA 3RC5A 5JBAS 3MOCA 1BDAA 3RXGA 2C8YB 4A5TS 4WMEA 3TNSA 3KQCA 1A5HA 1LQEA 4DOQA 3RM2H 4SGAE 4NIXA 5FCRA 1IHSH 3SU3A 4OS1A 4I8JA 1O30A 1RJXB 1JBUH 4GLYA 1P8VC 5ESTE 1G30B 4ABIA 2VWOA 2F9OA 1TNKA 1DY8A 1EP5A 1Z6EA 1NU7B 3DFJA 2QAAA 1P10A 1BBRH 2QY0B 2A4RA 3P8NA 1MTNC 1NN6A 2FOAA 1A46H 3ELAH 3VXEH 3TVJB 2JH5D 3M5NA 4X1PU 1C1TA 1XVMA 1TFXA 5BRRE 4PROA 1V2QT 1XXDA 3HGNA 4YZUA 1GI7B 3TGKE 1A1RA 1SHYA 1C1RA 1IQJA 1PQAA 2SNVA 1YCPH 1OKXA 2A32A 1YF4A 1B0EA 1SGQE 2R3YA 3HPTB 1F2SE 1J9CH 1AI8H 1C1NA 1ZJDA 4AFQA 3S7HB 5GCHF 1AN1E 1HYLA 4GUXA 4FUHA 3TJOA 2BZ6H 2VWLA 3FZZA 1NFXA 2WPLS 1B7XB 1KYNA 2O9QA 3F9FA 3TH2H 5HXFA 1DM4B 1MTSA 4FU9A 4IMZA 5A8YA 1PFXC 1RIWB 5EQQA 1HJAC 2ZEBA 1C2FA 1Y5BT 1FY8E 1E34B 3KL6A 1S6HA 1C5RA 1YPJH 3M36A 1H4WA 3PMHB 3M3SA 3SN8A 2DE8A 1ZHRA 4AOQA 1GGDB 1P2NA 1GBLA 1YPGH 4CRAA 5DP9A 1SGEE 4U32A 1P2MA 2ANMH 2SGEE 3SORA 1LPGB 1C1VH 4OS4A 1P05A 1RTFB 4ABEA 3ZZ5A 3BF6H 2SGAA 1QB1A 2A5IA 1GBTA 1ZMNA 2WV5A 1F0SA 1K1OA 2W5EA 2QGRA 1TGBA 4OS2A 4JCNA 3W94A 6LPRA 4E7RG 2ZDMA 4I7YH 3NPSA 1H9HE 1C4Y2 1QNJA 1O3KA 1GBHA 1S84A 2ULLA 3A7VA 5DP8A 3PB1E 4U2WA 2PHBA 1UK3A 3RXMA 3LJJA 5FPSA 2ZHDA 1C5PA 3TJVA 2ILNA 1VITF 1TNIA 5DP7A 2FOBA 3GOVB 4B2AA 1Z8RA 3RLWH 1YPMH 2XXLA 2BDBA 1ETTH 4ABDA 1UTQA 3DT0H 4LXBH 4FUFA 5A09A 3V0XA 3CP7A 1CHGA 3NK8A 2XBYA 2FO9A 3SU4A 1GI5A 3RMLH 1VITH 1C5LH 1J14A 1IQMA 2ZTZA 1U6QA 3SGBE 4CRFA 4NWKA 3ZZ9A 1JRSA 1SLXB 2ZPSA 2CF9H 2IOTA 2F83A 1BTWA 3TU7H 2B9LA 4UD9H 1O2TA 3K6YA 3VGCC 1MUEB 3S9BA 2HALA 2Y5GA 3LGVA 3T28A 1GCTB 2I6QA 1SG8B 1THSH 2FI3E 4XE4A 1IQLA 2G81E 1UK4A 4K8BA 5L30H 2STBE 4AORA 5C5NA 3BTWE 1W3CA 1GPZA 5HGGA 1NESE 1TRNA 2Z9JA 3T27A 1DE7H 2SGQE 1RS0A 3URDA 2GMTB 1L1GA 2FX4A 3Q3XA 1O2RA 4X6OA 3E16B 1O5EH 2XRCA 4K2YA 1GJCB 1FIWA 2GT7A 4LZ1H 3UTUH 3A8DA 1YLCA 1EZSC 1UTPA 1O2NA 3MH4A 4BNRA 1YBWA 1AD8H 4INLA 1SFIA 1L4DA 3PMJA 1G3CA 5TJXA 2D8WA 1DWCH 3LPRA 1GMDF 4MNYA 1GI1A 1O5BB 9ESTA 1QIXB 3S69A 4KKDA 5C20A 4IGDA 1H9LB 2FM2A 3LC5A 2W3KA 2ASUB 4NA9H 2FI4E 1CA0B 4O3UA 1KTSB 5E8EH 3LDXH 4A7IB 1CVWH 3RXEA 1P2QA 1K1NA 2F9NA 1W12U 1O2WA 1S82A 1C2MA 1SGYE 1KXCA 4BAHB 3HATH 1FN8A 2GT8A 2JETC 1FAXA 4FU8A 5FCKA 2P3FH 4DW2U 1O3MA 1ZSJA 2D1JA 4MPVA 1EPTB 1ID5H 5HYOA 1P3EA 2FX6A 4Y8YA 3QTOH 3FVFB 1KLIH 1P9SA 1P2OA 2BDIA 2GZ7A 1TLDA 3LGYA 3OX7U 2A5AA 3MO9A 1BUIA 3ZZ6A 1AFEH 4TPIZ 3QGNB 4I8KA 2M5TA 4GSOA 3U69H 1G37A 3O8DA 3RXSA 1DLKB 1HXEH 1ESTA 1K9OE 3A89A 1PYTD 3AAVA 4AGKA 2AMQA 2AGIX 1UVSH 4CHAB 1YPKH 2AMPA 2O8TA 3QX5H 1MKXK 1O2GH 4X6MA 4GAWA 1YPHC 1GJ7B 2H1UA 2A2XH 5EXLA 1MQ6A 2C8WB 1D4PB 2FYQA 1O0DH 5A0CA 3QN7A 5LGOA 2FOFA 1P0SH 3IWMA 4ZXYH 1O3AA 1O32A 1ELBA 1DOJA 2D26C 5B6OA 2XCFA 2QF3A 2BD3A 4RKOB 1OPHB 3E6PH 1SBWA 2B8OH 1CQQA 3SU1A 4NGAH 2FYRA 2QF0A 2OQUA 1W14U 2QXIA 1BCUH 5SGAE 5DPAA 4B71A 5JBBS 3HKJB 4A1TA 3HKIB 1GBMA 2BHGA 1F92A 2ANYA 2A7CA 3Q76A 4IBLH 4OGYA 1T4UH 3Q3KA 1C1SA 4GCHG 4MLFB 4WH6A 1AVXA 2HLCA 5EPNA 3BG4B 1O3LA 4X6PA 1EAXA 1AUTC 2LNCA 1EAWA 1HAXB 3U8TH 1XUFA 3VFEA 1O38A 1DWDH 1UVOA 1V2TT 5H4IB 6CHAC 1OWEA 4NA7A 5DK1A 2BVSH 1WTHD 2ZQ2A 4ZUHA 3A7YA 1Y59T 4WJG2 1QBVH 3A85A 3QDZB 1GMDG 3PMBB 4IS5A 5FX6A 3ZZ7A 3VB6A 1ELVA 1T8NA 2PUXB 1C5UA 1AZ8A 2ZTXA 2CHAC 1LHGH 2ZU4A 1A4WH 3SQHE 1WU1A 1HAZB 5JPMH 1SGCA 2OQ5A 2WYJA 4I8GA 1T31A 2G4TA 1MD7A 1YYY1 1GJ4H 1HV7A 1TRMA 2UWLA 5I25A 3D49H 4TWYA 4UFFH 1AU8A 3BTEE 2R9PA 1ZPBA 3TK6A 1QJ6B 2GVFA 3S9AA 3UQVA 4A1VA 3LGIA 1QURH 2VIWA 3BSQA 1FPHH 1TALA 1Z8GA 4TPYA 4ZKRU 1SGRE 1MAXA 4NWLA 2AGGX 1C2KA 5EXMA 1RTLA 1GDQA 4Y76A 2FXRA 2PKAA 3Q00A 1NT1A 3ATWA 3SHCH 3BIVH 1IQHA 3V7TA 5JYIA 3SNCA 3KCGH 1T8MA 2A0QB 4KGAA 1NS3A 2GMTC 4TYDA 1GBCA 1CO7E 1G32B 1NO9H 2BDGA 3BIUH 1C5TA 1TPOA 2YOLA 4Z0KA 3TK5A 4CBNA 4ZHMU 1VCQA 1CT4E 2VNTA 1Q2WA 4KTUA 3BTHE 4FVDA 1OX1A 3NUMA 4X2WA 2J95A 1CA8B 4NIWA 1O2OA 1BHXB 3RDZA 3RMMH 1O2HA 2ZC9H 1YKTA 5T3HA 4XSKU 2P3UB 4YTAA 1ABIH 3RM0H 2J94A 3P8FA 3VB5A 2OBOA 1LKBA 1O3BA 3MYWA 2IPHA 4NSYA 5JB9S 1LVYA 3V3MA 2CGAA 1HJ9A 4JZIA 3PLBA 1BOQA 3RMOH 1CA0C 2FPZA 1HB0B 5GIBA 1T8LA 1QGFA 4X2YA 1LQDB 1NU9A 2FLBH 1PQ8A 3BTDE 3SJIA 1P11E 1A61H 4B74A 1AHTH 2BOKA 4H42U 2STAE 1TRYA 1TA6A 1LKAA 5FXLA 3GCHC 1WBGB 1EJAA 1UCYH 4LOYH 2V3OH 2ZF0H 1C5ZB 1UJ1A 4I8HA 3QWCH 2BD7A 3ESTA 4LZ4B 2XTTB 1EPTC 4X8VH 4BAMB 1HUTH 1BTXA 3PTBA 3SHAH 1GJ9B 1NROH 1W10U 1VCPA 1K1IA 1Z1IA 5K7RA 4NZLA 3ENSB 5TCAA 1P2JA 2H9TH 4IN1A 1IQKA 2TGTA 1G3DA 2G51A 2FOGA 2BQ6B 1QB6A 2AMDA 2AERH 2BY8X 4UEHH 2BD5A 5ETXA 1SR5C 1SGDE 4AZ2B 1NPMA 2ZNKH 1OWDA 2OBQA 3UQOA 3ZVEA 1F7ZA 4YLQH 3GCOA 4UONA 1OWHA 1AWHB 1GI4A 4FUEA 1NFUA 3RXLA 2PKSB 4WXIA 1QR3E 2QIQA 2TGPZ 2EC9H 4CRCA 4XBBA 5L2ZH 3KQEA 4K1EA 1ZSLA 1PYTC 4R8TB 2FZZA 3VXFH 4NA8A 1MTWA 4K1SA 1O2ZA 1Y3WA 3ZZDA 4BOHA 3M5MA 1GWAA 1AE5A 4YOGA 5AF9H 1ZR0A 2A1DB 3L3TA 2ESTE 1YLDA 2PR3A 4AYYB 1AFQC 3GY2A 2P16A 3SI3H 2ZPQA 3BG4C 4IMQA 1WV7H 2O8LA 3E91A 1KLTA 5EXNA 3RC6A 1SGIB 4UDWH 4NZQA 4AG1A 3C27B 3MU0A 3OYPA 2PSXA 3SOSA 1UK2A 3HK6B 3O8BA 7GCHG 4FU7A 1TQ7B 3B9FH 1EAUA 1GCDA 1QBNA 3H7TA 1VJ9U 1LVOA 1P02A 2GV6A 3AAUA 1DPOA 4A1XA 3GICB 2Z7FE 1QL7A 2AGEX 1AUJA 2IJOB 2DE9A 4XBDA 1V2NT 1XKBC 1BITA 1G9IE 1KDQA 2BY9X 1MKWH 2BY5X 4KP0A 2AS9A 4JK6A 5AFYH 1XUGA 3U8OH 1IHTH 2EEKA 2ALVA 2C4FH 1FAKH 3SJ9A 1V2ST 2NU4E 4X2VA 2G00A 3SO3A 1IQGA 1G2LA 1NFYA 1W11U 1W7GH 3S9CA 1CE5A 5C1XA 2ZTYA 2AFQB 1O2VA 1FY5A 3MO3A 1FDPA 2QYIA 3U1IB 4CBOA 3LJOA 1UMAH 4MNVA 2VU8E 2ZHQH 1V6DA 4HGCA 1GHZA 1HAOH 1PQ5A 4YOIA 5C2ZA 3BN9A 2Q6GA 1JOUB 5BPEA 2IN2A 1N8OB 3P6ZB 4RSPA 5FBEA 1AIXH 5CMXH 1OYTH 1KSNA 4UFGH 1FNIA 3SV8A 3DD2H 2BXUH 4INHA 1JIMA 1AVGH 1WOFA 1C2JA 1EJNA 1EATA 3PWBA 3NZIA 3V12A 1GDNA 9LPRA 5AHGH 1K2I1 3KIDU 2FLRH 1MH0A 3RXVA 1T4VH 3BEIB 4AFUA 2ZGCA 3MH6A 1C9TA 1TPSA 4OS7A 3O8CA 1HAIH 1UTJA 1Q3XA 1G3BA 3I78A 1AY6H 1TMTH 1NRNH 1SGTA 3ZVDA 2UWOA 5HM2A 2NU3E 1BMLA 1UVUH 2J34A 2TBSA 2XNIA 2HGTH 5FPYA 3STIA 1DY9A 1DFPA 1P9UA 1MBMA 1LDTT 1C2HA 1ZZZA 3TNTA 1HLTH 1KLJH 1KXBA 4X8UH 2VVCA 1WUNH 2UUYA 1ANEA 3T2NA 3RXQA 2VINA 5JDUB 4IW4E 1RGQA 3GCNA 2ANKH 4MPWA 1C5SA 1SQAA 3A80A 3N7OA 1GBBA 2Z6BD 2WV4A 2FMJA 1AMHA 1GI9B 3RXRA 5DJ7A 1BT7A 1MU8B 2HPPH 2ZFTA 2ZHEH 4LK4A 2PUQH 3QZQA 4I32A 5IYTA 4OS5A 4D7FA 1K22H 2RG3A 3STJA 5ESBA 4NIYA 1O2IA 4D7GA 2SGPE 2ZZUH 8ESTE 1TGCA 3RC4A 5LPEA 1ZTKA 2BDHA 1GJDB 2TIOA 4SGBE 3GCTG 4MPXA 3E1XB 2VB0A 1IQEA 3CS7A 2Z9IA 1BB0B 4ABFA 4FUIA 1TYNA 1A0JA 2OCVB 1FUJA 1Z8IB 2HNTC 1W8BH 5EW2H 4U30A 3E90B 4DVAU 2KAIB 1TBRH 4B2BA 2GCTB 3G01A 1KTTB 4XDEA 1ABJH 1ETRH 1FY3A 1JWTA 1Z1JA 1H9IE 1TNJA 1ANCA 1VGCB 3AASA 1C2GA 2VIVA 3SV6A 4WF8A 1QRZA 3RP2A 4DIIH 3M7TA 3IG6B 2PV9B 1ANDA 4YOJA 2A5KA 1HAHH 2J4IA 3PROA 4Y10E 1A3EH 4AGJA 2Y7XA 1UTKA 1GJ6A 2G4UA 2P8OB 1GHYH 2VGCC 4UFDH 1C2LA 3SBKA 2ZU1A 1Y3UA 3CENA 5L6NH 1O2PA 1E36B 1C2DA 3JZ1B 1LVMA 3AW0A 2BDYA 4BTIB 4GCHF 1PPGE 3LGUA 1TPAE 3A86A 3KQDA 8LPRA 4MPUA 1OWIA 2WPMS 1BMNH 1L4ZA 3SJKA 2ANWA 1ORFA 4JMYA 5EOKA 2ZFFH 3ZZ4A 1HBTH 3LGWA 2R0KA 4ABGA 1Y3VA 1O5GH 1XUHA 3AW1A 4OGXA 3OU0A 2H5CA 2PKAB 2BX3A 1O5DH 2VVVA 4AX9H 3P8GA 5CHAB 3U9AH 3NKKA 1AKSA 4YT6H 3A83A 4Y8ZA 4BANB 3K65B 1EP6A 2BDAA 4WY3A 4RKJB 2A45B 4NSVA 4KTSA 5C1UA 4MQAA 6ESTA 1GJBB 1O39A 1C5XB 1CBWB 1D3QB 3KEEA 1SHHB 2P59A 3MU8A 1HAYB 1O36A 3EA9A 3A84A 1Z71A 3MNSA 1N8OC 7KMEH 1D9IA 1C2EA 2WUCA 1VZQH 1D3TB 1IQNA 2BDCA 2BLOA 3RXOA 3RUOA 1SQOA 4Q7YA 3UNQA 1DWEH 3PV4A 2ZCHP 1TB6H 4Y7AA 2VIDA 1GG6B 1CHOG 1V2RT 4X1RU 1XMNB 2H6MA 3RXJA 1O3DA 2BYAX 3BV9B 3KGPA 3MU4A 1TWXB 2SGDE 2K1QA 1GDUA 3M3VA 2BTCE 4FUCA 3RXDA 4INKA 3SU6A 1QRWA 1SB1H 4X1SU 3ATLA 3NWUA 3PTNA 1QQUA 3EGKH 1O31A 2B5TB 4WWYA 1LHDH 2BB4A 2PTCE 3GDUA 4KELA 3BEFB 1O2XA 2HPQH 1GBAA 1A3BH 4Y71A 4WVPE 1GL1A 1RIWC 1C1UH 2VJ1A 3KNXA 5F6MA 1OXGA 2O8WA 1O5CB 1O2MA 1ESAA 1WTGH 4M7GA 5GWZA 1C5MD 1GJAB 3SZNA 4O9VA 1EOJA 1PPEE 2RDLA 1UO6A 5C3NA 4IC6A 5K0HA 1GGDC 2XBVA 2FTLE 3WY8A 1V2UT 3F9GA 3O8RA 3PYHA 1EJMA 1KXAA 1NM6A 1S6FA 2VIOA 4X2XA 1A5GH 1UTOA 1MTUA 2HRVA 3D62A 3OSYA 3TGJE 2OXSA 2WUBA 4NFEA 2CF8H 1FQ3A 1GBEA 3UOUA 3GISB 2W7UA 2Y5HA 1MZDA 3IITA 1DVAH 2C8ZB 3MWIU 1P57B 4AFSA 2ZDKA 4NCYA 3RXIA 4UE7H 1V2JT 4HFPB 5FX5A 5J4QA 4GHQA 1MTVA 4DT7B 1KIGH 2R0LA 1LHEH 2VIPA 1L1JA 4XFQA 2PGQB 4GPGA 3ODFA 2A7HA 1CGIE 1P06A 4CR5A 3MNXA 2UUFB 4H6SB 2XC5A 1ZPCA 3SQEE 1EZXC 2DUCA 4MTBA 1Y5AT 3MMGA 5AFZH 1HJ8A 5EW1H 2XBXA 1NRRH 4JZFH 4BAKB 4B2CA 3SNBA 1M9UA 4U01A 5A0BA 4X6NA 5FAHA 1DT2A 2EA3A 1KY9A 3EA8A 1H1BA 2G5NA 2F9VA 1UHBA 5A0AE 1NZQH 2OINA 3R0FA 3B8JA 3A7WA 2A4OA 1TNHA 3B23B 3GDVA 2GCHF 1GCTC 4H4FA 2OC7A 1DSTA 1HIAB 1RRKA 1D3PB 3PO1B 2ODQA 1NFWA 3F9EA 1L0ZA 1B5GH 2BQWB 3ODDA 3K6ZA 5C1YA 3QLPH 1BBRE 3TH4H 1TGSZ 2GGVB 2EI8A 1HRTH 1XXFA 1LTOA 3A7XA 3FZDA 4CRGA 4CREA 3LH3A 3RXCA 3SU0A 3ZV8A 1BQYA 2LPRA 3QTVH 3MO6A 3VEQB 3T26A 1G2MA 2XC4A 3CS0A 3SV9A 1V2WT 1O5FH 4AN7A 2ZG0H 3SU2A 2AH4X 3M7UA 2XW9A 3PM3A 4IC5A 3ZZ8A 1BBRK 4BXWA 4AB9A 1F0TA 3F68H 1FY1A 8GCHG 1MTNB 5DGJA 2FOMB 7GCHF 4ZH8A 1TNLA 5CHAC 1QJ1B 4OS6A 3TK9A 1OWKA 2FWWA 4Y6DA 1F0UA 8KME2 3SNAA 3TLOA 1FV9A 1NY22 1ELCA 5FHTA 4DGJA 2R3UA 1L1NA 4ZKNU 2HVXA 1BMAA 1MZAA 2NWNA 7LPRA 2P3TB 3A88A 2ZFPH 1NRQH 2Z94A 5F8ZA 1EPTA 3P17H 2FOCA 4YLUA 2XYAA 3HGPA 1BRUP 2HNTE 1YCPK 2FTMA 4Y0ZE 3E8LA 3SUEA 1ELAA 4X1NU 1EZUC 3M35A 3ZZAA 2BD2A 4ISHH 4ISOA 1PPHE 1QJ7B 1TNGA 2FIRH 4TWWA 1IAUA 1ZHMA 2GTBA 2WPKS 5GJ4B 1T8OA 2A4QA 3TJNA 4ESTE 5C67A 3MHWU 1J17T 2OUAA 2RA3A 2WPIS 4JK5A 1GMHG 2XCNA 4DIHH 1SC8U 2PSYA 2RCEA 1GHBF 2EI6A 1ZSKA 1HNEE 1C5NH 3DHKH 1LHCH 1TGTA 4CR9A 1HJAB 2J2UA 2ZGJA 3P95A 5E2OA 3RXBA 4CHAC 4RN6A 3MU5A 1GHAF 2OC1A 1EXFA 1MKXH 2FOHA 4ZAEA 3P70B 3F6UH 3SJ8A 1SFQB 2ZDAH 3PLPA 1MAYA 3LU9B 1S85A 1O3CA 2SGFE 1O37A 2WYGA 1W0ZU 1Z6JH 1EUFA 3EYDA 2GCHG 2P95A 1WAYB 1XUKA 1S0RA 5CE1A 1DANH 3UWJH 1GVLA 2VWMA 3KHVA 1SLUB 1EX3A 1BA8B 3VB3A 1EKBB 3M7QA 2H9HA 5TCCA 4A6LA 3ATIA 3W95A 1QL9A 4DCDA 1CT0E 2PTNA 3OY5U 4J2YB 4ABAA 1Y3XA 1NTPA 1GBDA 1CU1A 4O3TA 3ZV9A 1ETSH 1ZRKA 4TY7A 4GVUA 1Z8JB 2WINI 2GDDA 3F9HA 2VIQA 1EASA 1WQSA 4ABJA 3BTME 2G52A 3RXKA 1GJ8B 1TMUH 3K9XB 2ALPA 2VH0A 4BAQB 1YPEH 3PLKA 1BZXE 1RTKA 5JBTA 2QV1A 2BZAA 3BEUA 3M5LA 1N6YA 1EAIA 1FZZA 1GI3A 1ZTJA 4AFZA 1THRH 4FXGH 5F8TA 3RXTA 1GL0E 2YNBA 3QO6A 4Y8XA 2XBWA 1ZMJA 4JZEH 4DG4A 1DITH 2GP9B 1Q31A 2C93B 4ZROA 2ZHFH 1ELGA 1A7SA 4JZ1A 1SOZA 1QTFA 3QK1A 3T25A 1P2IA 3S7KB 3UWIA 1SSXA 2SFAA 1GI2A 4K8YA 2TPIZ 2H2ZA 2OLGA 4X8TH 2BQ7B 3VGCB 1J16A 1EQ9A 4Z6AH 4B73A 1QHRB 1T32A 2D2DA 1RD3B 1O3GA 4ZKOU 1HAVA 1YPHE 1ZOMA 2HOBA 1GMCF 1WCZA 2QA9E 2P94A 1O2JA 2GKVE 5A8XA 1O35A 4YT7H 2FI5E 4X8SH 1RFNA 1MU6B 3A87A 1FXYA 1X7AC 2WPJS 3GCTF 5IDKA 1P2KA 1CT2E 1GJ5H 3UNSA 3RU4D 2BD8A 3ATMA 2V6NA 1F5KU 1PPFE 3V13A 1GHBG 1FONA 1THPB 2ZDVH 2ZCKP 1PPBH 1C1OA 1QFKH 1NRSH 1NRPH 2RA0A 5DP3A 1GHAG 2TGDA 1ELFA 1A0LA 1LHFH 1ZGVA 4WMFA 2VH6A 2ZU3A 1CSOE 1TE0A 4X0WU 3UFAA 2ZCLP 5F03A 4B75A 2ZU5A 2NU0E 4XBCA 1C4U2 1DDJA 3ZYEA 1CGHA 4F49A 2ZGHA 3BTKE 1D3DB 1S81A 6GCHF 2JH6D 5EGMA 1GHVH 1OS8A 1IQIA 1AKSB 1V2VT 2BMGB 4Y11E 3MI4A 1AGJA 1QL8A 2JETB 1P03A 2J9NA 4THNH 1GI6A 3MNCA 1ANBA 4KTCA 1P3CA 1BRBE 1TOMH 2C3SA 3UR6A 4AYVB 4ISIH 2BY7X 4JYVH 1UVTH 3M61U 5I46H 1ZTLA 1MCTA 2BLVA 2Y5FA 2BX4A 2HNTF 2ZU2A 3OY6U 2VVUA 1YM0A 1YPLH 2BY6X 4ISLA 1FLEE 1ZMLA 4AB8A 1WSSH 2OTVA 1C5YB 3SW2B 3EA7A 4Y0YE 2ZFRH 4IN2A 3EE0B 4K5ZA 2W7SA 4TY6A 2ZP0H 3Q3YA 1TABE 1ZLRA 1ELEE 1PJPA 1EOLA 2A7JA 1AO5A 1BJUA 1P12E 1V2PT 4UFEH 4ZHAA 5FPTA 1ACBE 1BRCE 3EQ0H 2UUJB 2PKSC 4MG3A 4FUDA 4MNWA 1GMCG 1PPZA 1ARCA 2V35A 2R2WU 1CHOF 1SL3A 3P92A 3A8BA 2F91A 2R2MB 5EU8A 4JYUH 1O2QA 3D65E 3SV2H 1C4V2 1N6XA 3RXPA 1INCA 1V3XA 3A7ZA 1BTYA 2BVXH 4D76A 5DG6A 1UTNA 1HFDA 3MFJA 1K1JA 3SI4H 3KQBA 2JKHA 2A4GA 1ZGIA 1FJSA 1MD8A 1O2SA 1YP9A 2ZQ1A 6CHAB 2CJIA 3UREA 1VCWA 1ARBA 2HWLB 2Z9GA 1ZRBA 4GHTA 4D9RA 2H9EH 1NC6A 1SLVB 3FAOA 5E0GA 2CHAB 2PFEA 1SGFA 4XOJA 3BTGE 1ELTA 3SJOA 3UY9A 3BTTE 3SGQE 3A82A 1O3NA 2P93A 1JXPA 1P01A 1HAGE 4MNXA 1L2EA 4VGCB 2J38A 1IOEA 1FIZA 4YM9A 3Q77A 1W2KH 1DXWA 4ASHA 2NU2E 1JIRA 3ITIA 1SMFE 4FUGA 6GCHG 3SUFA 4JZDH 1LMWB 3KN2A 1TIOA 3ZVAA 4ZMAH 5EQSA 3I77A 4NFFA 3M37A 4Y7BA 3TGIE 2CMYA 3A81A 2A2QH 3ZZBA 2G5VA 1OWJA 2QN5T 1DS2E 2C90B 1TX7A 1XX9A 4Q2KA 1QQ4A 1FN6A 3HK3B 1Z7KA 1OYQA 1SOTA 3E3TA 4Q80A 4K60A 1TBQH 5JB8S 5LPRA 1UHBB 2V0BA 3LOXA 2ZDLA 1AB9B 3M3TA 3TPIZ 1A2CH 1E38B 3RLYH 2Y81A 1QRXA 1FMGA 5GCHG 3MH7A 3FFGA 1HAPH 1C1PA 2O8MA 2AIQA 2J92A 3URCA 2GDEH 3GY7A 2TRMA 3T62A 1XKAC 5GXPA 1XUJA 4CRBA 5T6GA 1O2LA 4D9QA 1SGFG 5E0JA 1AVWA 5L2YH 3H5CB 1AQ7A 1J8AA 1UCYE 1UTLM 5GDSH 4DY7B 1D6RA 1GBFA 3MU1A 4Y79A 2FODA 2QCYA 1N1LA 4K3JA 3ZVCA 1AE8H 2Y7ZA 4FUBA 1DXPA 1BTPA 3VPKA 1JMOH 3H7OA 1Y8TA 1SVPA 4E05H 5A2MH 1A0HB 3GYMA 1UCYK 2B0FA 4E06H 3GCHB 2XWAA 1OP0A 2QXJA 4BTTB 4R0IA 1MQ5A 1G36A 1AWFH
chains in the Genus database with same CATH superfamily
2THFB 2Z9KA 2A31A 2GV7A 2AEIH 2JH0D 1LCYA 2PWXA 2FESH 5DP5A 2Q6DA 4TSFD 1HPGA 1VITG 1J15A 1C2IA 2AIPA 3U98H 1GI8B 1SLWB 4RT1A 1BTZA 8GCHF 2OC0A 5EODA 2GZ9A 2AYWA 1H8IH 3KQ5A 4Q7XA 1LPZB 1E37B 2Q6FA 3LKWA 1AZZA 4ABBA 4WXVA 1BTUA 4J1YA 2C8XB 1E1QD 2YNAA 2ZA5A 4ABHA 3UB0A 2FEQH 1BTHH 3UNRA 3P8OA 3TITA 5LPFA 1EFRD 3LIWA 5T6DA 1XUIA 2PW8H 1SQTA 1K0HA 4HTCH 3DSGA 1K1PA 2QXGA 4MDSA 2GX4A 3DSOA 4CH2B 2ZGBH 3DSPA 3GY4A 1KXDA 3EAJA 3SNEA 2F9PA 3MNBA 1T7CA 3F0PA 3GYLB 3PWCA 3AVZA 5E0HA 1QB9A 1GI0A 1TAWA 2TGAA 1XM1A 2SNWA 4M9FA 4BXSA 5PTPA 3U28C 1LO6A 1LVBA 3R3GB 4TT3D 1OP8A 3FP8E 2W3IA 5J4SA 1GMHF 4H6TA 5IK2D 1DX5M 2BLWA 1QY6A 1AFQB 1BIOA 3KF2A 3LT3A 3ZZ3A 1F5LA 1UTMA 1H8DH 4HZHA 2KAIA 4WH8A 3D23A 1DUEA 3DA9B 2OC8A 2ZWLH 1PQ7A 1JRTA 1V2OT 3L33A 1HDTH 3W1EA 2GZ8A 2W26A 3UIRA 2BVRH 3PMAB 1DICA 2VWNA 3BTQE 5F8XA 2BD4A 2ZKSA 1IQFA 1KXFA 2GCTC 3UR9A 2FDAA 1TMBH 1C1MA 1TONA 2ODYB 3RXFA 2Z3CA 1VGCC 1ELDE 4VGCC 1O2YA 2FOEA 4O03A 3SUDA 4DJZB 1S5SA 3T29A 1BMFD 1S83A 1B0FA 3ATKA 3DUXH 3ZYDA 1MKWK 2P8OC 3SUGA 1V2LT 1EB2A 2BXTH 4ZKSU 3FKSD 1EZQA 4HI3A 3F1SB 2WPHS 4B76A 1E0FD 4K1TA 3E0NB 3VB4A 3RMNH 3GY5A 1KDQB 2BM2A 2FS9A 2ZGXH 3FANA 5DKMA 5HMAA 3TH3H 1HAVB 4DURA 5HM9A 1YCPM 3QZRA 3C1KA 3UUZA 1OP2A 1TQ0B 1ZPZA 2ZO3H 2Q1JA 1SGPE 1BMMH 1AB9C 2O8UA 3QUMP 1TBZH 1W0YH 1HXFH 2F9BH 4ISNA 1A5IA 3ZZCA 3RXHA 3UPEA 2F9UA 4NG9H 1QA7A 2OD3B 2YMSD 3A7TA 4E7NA 5E2PA 1K1LA 1W0JD 1BRAA 1P09A 4ZHLU 4X1QU 2OP9A 1C1QA 2QC2A 1O3HA 1C5OH 5LH8A 1ZJKA 1O3IA 2EI7A 5G4BA 2H5DA 1CBWC 4QT8C 4CH8B 1VJAU 3T5FH 4YO9A 2RFKC 2V3HH 3TIUA 3LC3A 1PPCE 2BLQA 1K1MA 3F3BA 1F5RA 1O2UA 3E0PB 5JBCS 3SGAE 5DO4H 1GG6C 1OSSA 2Z9LA 3K2UA 2G8TA 4I31A 1GBIA 5EPYA 1K21H 2Z3EA 2XWBI 2ZPRA 4MVNA 1BJVA 3GDSA 1VR1H 3ZVGA 1GBKA 2PLXA 2UWPA 1WQVH 3PRBA 4FVBA 3RXAA 1FPCH 1W13U 1QBOA 1TOCB 3QGJA 4I8LA 1O34A 1TX6A 1HCGA 5KEDA 1TPPA 1C5WB 1HGTH 3LGTA 3RU4T 4O97A 2ODPA 2CXVA 2JJ2D 4WMDA 1MCVA 1DLEA 5HIYA 1W7XH 1P04A 2Z3DA 4FUJA 1FY4A 4A92A 3DCLA 1K28D 1GBJA 1O5AB 4BTUB 5C5OA 1E35B 1D6WA 3GY6A 1GHWH 3U8RH 1RXPA 3TJUA 1MBQA 5A8ZA 1C9PA 3SNDA 3ZVFA 2XC0A 1ESBA 1DWBH 3I29A 2M2AA 1SGNE 1SPJA 4D8NA 4YESB 4F4OC 5C0TA 5FBIA 1CGJE 1GHXH 4BAOB 1MMJN 1Y3YA 3OTJE 1WYKA 1Y5UT 5KGOA 3MTYA 5GNDA 1QA0A 1GVKB 5EQRA 2CN0H 2B7DH 1FI8A 1GVZA 3FP6E 1DSUA 4CRDA 2BOHB 3SU5A 1TA2A 2ZFSA 3A8AA 2UUKB 3BTFE 7ESTE 2NU1E 3VB7A 2ZHWH 3NXPA 1E79D 1ZHPA 2F3CE 1BHXF 3JZ2B 2ZECA 3U1JB 1C1WH 1V2MT 3GY8A 2PGBB 2FS8A 2Y6TA 1LPKB 4B1TA 3EDXB 2ZFQH 2LELA 3RU4E 5T6FA 1UVPA 2I6SA 1OOKB 2KR7A 2CV3A 4NIVA 1V2KT 5DP6A 1S0QA 1YC0A 3NCLA 1QCPA 1XVOA 3LONA 5EG4A 3LH1A 3FP7E 1YGCH 3MH5A 1O3PB 3GS9A 1S6LA 2GD4B 2G55A 1DUAA 1KXEA 1O2KA 1SI5H 3ZVBA 2BD9A 3RXUA 5GPIB 2ZDNA 3SV7A 1O3FA 1HIAA 3S0NA 2W6JD 1ZYOA 3KYGA 4AG2A 1G3EA 2ZI2H 2Y82A 5C0UA 1O33A 2QXHA 3BG8A 3DFLA 1TX8A 5AVDA 2VGCB 2FP7B 1C5QA 1C5VA 1EB1H 1O3EA 3GY3A 5DP4A 3UOPA 2Y80A 1F0RA 3A8CA 1O3JA 4JYTA 4I33A 4Q7ZA 1W0KD 3PO1C 5ABWA 1TGNA 4ZXXH 4K69A 1O3OA 2ZIQH 3M5OA 2XNDD 3L6PA 3RC5A 5JBAS 3MOCA 1BDAA 3RXGA 2C8YB 4A5TS 4WMEA 3TNSA 2K8IA 3KQCA 3VG8A 1A5HA 1LQEA 4DOQA 3RM2H 4SGAE 4NIXA 5FCRA 1IHSH 3SU3A 4OS1A 4I8JA 1O30A 1RJXB 1JBUH 4GLYA 1P8VC 5ESTE 1G30B 2K0QA 4ABIA 2VWOA 2EY4C 2F9OA 1TNKA 1DY8A 1EP5A 1Z6EA 1NU7B 3DFJA 2QAAA 2QE7D 1P10A 1BBRH 2QY0B 2A4RA 3P8NA 1MTNC 1NN6A 2FOAA 1A46H 3ELAH 3VXEH 3TVJB 2JH5D 3M5NA 4X1PU 1C1TA 1XVMA 3KYFA 1TFXA 5BRRE 4PROA 1V2QT 1XXDA 3HGNA 4YZUA 1GI7B 3TGKE 1A1RA 1SHYA 1C1RA 1IQJA 1PQAA 2SNVA 1YCPH 3H09A 1OKXA 2A32A 2KFWA 1YF4A 3EE7A 1B0EA 1SGQE 2R3YA 3HPTB 1F2SE 1J9CH 1AI8H 1C1NA 1ZJDA 4AFQA 5EJZA 3S7HB 5GCHF 1AN1E 2WV9A 1HYLA 4GUXA 4FUHA 3TJOA 3PV2A 2BZ6H 2VWLA 3FZZA 1NFXA 2L74A 2WPLS 1B7XB 1KYNA 2O9QA 3F9FA 3TH2H 5HXFA 1DM4B 1MTSA 4FU9A 4IMZA 5A8YA 1PFXC 1RIWB 5EQQA 1HJAC 2ZEBA 1C2FA 1Y5BT 1FY8E 1E34B 3KL6A 1S6HA 1C5RA 1YPJH 3M36A 1H4WA 3PMHB 3M3SA 3SN8A 2DE8A 1ZHRA 4AOQA 1GGDB 1P2NA 2L6OA 1GBLA 1YPGH 4CRAA 5DP9A 1SGEE 4U32A 1P2MA 2ANMH 2SGEE 3SORA 1LPGB 1C1VH 4OS4A 1P05A 1RTFB 4ABEA 3ZZ5A 3BF6H 2SGAA 1QB1A 2A5IA 1GBTA 1ZMNA 2WV5A 1F0SA 1K1OA 2W5EA 2QGRA 1TGBA 4OS2A 4JCNA 3W94A 6LPRA 5DN6D 4E7RG 2ZDMA 4I7YH 3NPSA 1H9HE 1C4Y2 1QNJA 3SYJA 1O3KA 1GBHA 1S84A 2ULLA 3A7VA 5DP8A 2WHXA 3PB1E 4RI0A 4U2WA 2PHBA 1UK3A 3RXMA 3LJJA 5FPSA 2ZHDA 1C5PA 3TJVA 2ILNA 1VITF 1TNIA 5DP7A 2FOBA 3GOVB 4B2AA 1Z8RA 3RLWH 1YPMH 2XXLA 2BDBA 1ETTH 4ABDA 1UTQA 3DT0H 4LXBH 3SZEA 4FUFA 5A09A 3V0XA 3CP7A 1CHGA 3NK8A 2XBYA 2FO9A 3SU4A 1GI5A 3N7EA 3RMLH 1VITH 1C5LH 1J14A 1IQMA 2ZTZA 1U6QA 3SGBE 4CRFA 4NWKA 5FL7D 3ZZ9A 1JRSA 1SLXB 2ZPSA 2CF9H 2IOTA 2F83A 1BTWA 3TU7H 2B9LA 4UD9H 1O2TA 3K6YA 3VGCC 1MUEB 3S9BA 2HALA 2Y5GA 3LGVA 3T28A 1GCTB 2I6QA 1SG8B 1THSH 2FI3E 4XE4A 1IQLA 2G81E 1UK4A 4K8BA 5L30H 2STBE 4AORA 5C5NA 3BTWE 1W3CA 1GPZA 5HGGA 1NESE 1TRNA 2Z9JA 3T27A 1DE7H 2KCPA 2SGQE 1RS0A 3URDA 2GMTB 1L1GA 2FX4A 3Q3XA 1O2RA 4X6OA 3E16B 1O5EH 2XRCA 4K2YA 1GJCB 1FIWA 2GT7A 4LZ1H 3UTUH 3A8DA 1YLCA 1EZSC 1UTPA 1O2NA 3MH4A 4BNRA 1YBWA 1AD8H 4INLA 1SFIA 1L4DA 3PMJA 1G3CA 5TJXA 2D8WA 1DWCH 3LPRA 1GMDF 2W6ID 4MNYA 1GI1A 1O5BB 9ESTA 1QIXB 3S69A 4KKDA 5C20A 4IGDA 1H9LB 2FM2A 3LC5A 2W3KA 2ASUB 4NA9H 2FI4E 1CA0B 1MABB 4O3UA 1KTSB 5E8EH 3LDXH 3F2GA 4A7IB 1CVWH 3RXEA 1P2QA 1K1NA 2F9NA 1W12U 1O2WA 1S82A 1C2MA 1SGYE 1KXCA 4BAHB 3HATH 1FN8A 2GT8A 2JETC 1FAXA 4FU8A 5FCKA 2P3FH 4DW2U 1O3MA 1ZSJA 2D1JA 4MPVA 1EPTB 1ID5H 5HYOA 1P3EA 2FX6A 4Y8YA 3QTOH 3FVFB 1KLIH 1P9SA 4FOUC 1P2OA 2BDIA 2GZ7A 1TLDA 3LGYA 3OX7U 2A5AA 3MO9A 1BUIA 3ZZ6A 1AFEH 2IJD1 4TPIZ 3QGNB 4I8KA 2M5TA 4GSOA 3U69H 1G37A 3O8DA 3RXSA 1DLKB 1HXEH 1ESTA 5EIYA 1K9OE 3A89A 1PYTD 3AAVA 4AGKA 2AMQA 2AGIX 1UVSH 4CHAB 1YPKH 2CK3D 2AMPA 2O8TA 3QX5H 1MKXK 1O2GH 4X6MA 4GAWA 1YPHC 1GJ7B 2H1UA 2A2XH 5EXLA 1MQ6A 2C8WB 1D4PB 2FYQA 4I86A 1O0DH 2WZQA 5A0CA 3QN7A 5LGOA 2FOFA 1P0SH 3IWMA 4ZXYH 1O3AA 1O32A 1ELBA 1DOJA 2D26C 5B6OA 2XCFA 2QF3A 2BD3A 4RKOB 1OPHB 3E6PH 1SBWA 2B8OH 1CQQA 3SU1A 4NGAH 2FYRA 2QF0A 2OQUA 1W14U 2QXIA 1BCUH 5SGAE 5DPAA 4B71A 5JBBS 3HKJB 4A1TA 3HKIB 1GBMA 2BHGA 1F92A 2ANYA 2A7CA 3Q76A 4IBLH 4OGYA 1T4UH 3Q3KA 1C1SA 4GCHG 4MLFB 4WH6A 1AVXA 2HLCA 5EPNA 3BG4B 1O3LA 4X6PA 3N99A 1EAXA 1WDIA 1AUTC 2LNCA 3F2FA 1EAWA 1HAXB 3U8TH 1XUFA 3VFEA 1O38A 1DWDH 1UVOA 1V2TT 5H4IB 6CHAC 1OWEA 4NA7A 5DK1A 2BVSH 1WTHD 2ZQ2A 4ZUHA 3A7YA 1Y59T 4WJG2 1QBVH 3A85A 3QDZB 1GMDG 3PMBB 4IS5A 5FX6A 3ZZ7A 3VB6A 1ELVA 1T8NA 2PUXB 1C5UA 1AZ8A 2ZTXA 2CHAC 1LHGH 2ZU4A 1A4WH 3SQHE 5HKKD 1WU1A 1HAZB 5JPMH 1SGCA 2OQ5A 4F55A 2WYJA 4I8GA 1T31A 2G4TA 1MD7A 4XD7D 1YYY1 1GJ4H 1HV7A 1TRMA 2UWLA 5I25A 3D49H 4TWYA 4UFFH 1AU8A 3BTEE 2R9PA 1ZPBA 3TK6A 1QJ6B 2GVFA 3S9AA 3UQVA 4A1VA 3LGIA 1QURH 2VIWA 3BSQA 1FPHH 1TALA 1Z8GA 4TPYA 4ZKRU 1SGRE 1MAXA 4NWLA 2AGGX 1C2KA 5EXMA 1RTLA 1GDQA 4Y76A 2FXRA 2PKAA 3Q00A 1NT1A 3ATWA 3SHCH 3BIVH 1IQHA 3V7TA 5JYIA 3SNCA 3KCGH 1T8MA 2A0QB 4KGAA 1NS3A 2GMTC 4TYDA 1GBCA 1CO7E 1G32B 1NO9H 2BDGA 3BIUH 1C5TA 1TPOA 2YOLA 4Z0KA 3TK5A 2KCYA 4CBNA 4ZHMU 1NBMD 1VCQA 1CT4E 2VNTA 1Q2WA 4KTUA 3BTHE 4FVDA 1OX1A 2JDID 2RDEA 3NUMA 4X2WA 2J95A 1CA8B 4NIWA 1O2OA 1BHXB 3RDZA 3RMMH 1O2HA 2ZC9H 3WWBA 1YKTA 5T3HA 4XSKU 2P3UB 4YTAA 1ABIH 3RM0H 2J94A 3P8FA 3VB5A 2OBOA 1LKBA 1O3BA 3MYWA 2IPHA 4NSYA 5JB9S 4ZCNA 1LVYA 3V3MA 2CGAA 1HJ9A 4JZIA 3PLBA 1BOQA 3RMOH 1CA0C 2FPZA 1HB0B 5GIBA 1T8LA 1QGFA 4X2YA 1LQDB 1NU9A 2FLBH 1PQ8A 3BTDE 3SJIA 1P11E 1A61H 4B74A 1AHTH 2BOKA 4H42U 2STAE 1TRYA 1TA6A 1LKAA 5FXLA 3GCHC 2HVYB 1WBGB 1EJAA 1UCYH 4LOYH 2V3OH 2ZF0H 1C5ZB 1UJ1A 4I8HA 3QWCH 2BD7A 3ESTA 4LZ4B 2XTTB 1EPTC 4X8VH 4BAMB 1HUTH 1BTXA 3PTBA 3SHAH 1GJ9B 3OE7D 1NROH 1W10U 1VCPA 1K1IA 1Z1IA 2YMSB 5K7RA 3FN8A 4NZLA 1UW7A 3ENSB 5TCAA 1P2JA 2H9TH 3FO8D 2V7QD 4IN1A 1IQKA 2TGTA 1G3DA 2G51A 1KMHB 2FOGA 2BQ6B 1QB6A 2AMDA 2AERH 2BY8X 4UEHH 2BD5A 5ETXA 1SR5C 1SGDE 4AZ2B 1NPMA 2ZNKH 1OWDA 2OBQA 3UQOA 3ZVEA 1F7ZA 2KCAA 4YLQH 3GCOA 4UONA 1OWHA 1AWHB 1GI4A 4FUEA 1NFUA 3RXLA 2PKSB 4WXIA 1QR3E 2QIQA 2TGPZ 2EC9H 2WSSD 4CRCA 4XBBA 5L2ZH 3KQEA 4K1EA 1ZSLA 1PYTC 4R8TB 2FZZA 3VXFH 4NA8A 1MTWA 2IPQX 4K1SA 1O2ZA 1Y3WA 3ZZDA 4BOHA 3M5MA 1GWAA 1AE5A 4YOGA 5AF9H 1ZR0A 2A1DB 3L3TA 2ESTE 1YLDA 2PR3A 4AYYB 1AFQC 4B6EA 3GY2A 1YY3A 2P16A 3SI3H 2ZPQA 3BG4C 4IMQA 1WV7H 2O8LA 3E91A 1KLTA 5EXNA 2F43B 3RC6A 1SGIB 4UDWH 4NZQA 4AG1A 3C27B 2XOKD 3MU0A 3OYPA 2PSXA 2EQNA 3SOSA 1UK2A 3HK6B 3O8BA 7GCHG 4FU7A 1TQ7B 3B9FH 4YXWD 1EAUA 1GCDA 1QBNA 3H7TA 1VJ9U 1LVOA 1P02A 2GV6A 3AAUA 1DPOA 2QF5A 4A1XA 3GICB 2Z7FE 1QL7A 2AGEX 1AUJA 2IJOB 2DE9A 4XBDA 1V2NT 1XKBC 1BITA 1G9IE 1KDQA 2BY9X 1MKWH 2BY5X 4AC9A 2KM0A 4KP0A 2AS9A 4JK6A 5AFYH 1XUGA 3U8OH 1IHTH 2EEKA 2ALVA 2C4FH 1FAKH 3SJ9A 1V2ST 2NU4E 4X2VA 2G00A 3SO3A 1IQGA 1G2LA 1NFYA 1W11U 1W7GH 3S9CA 1CE5A 5C1XA 2ZTYA 2AFQB 3PRDA 1O2VA 1FY5A 3MO3A 1FDPA 2QYIA 3U1IB 4CBOA 3LJOA 1UMAH 4MNVA 2VU8E 2ZHQH 1V6DA 4HGCA 1GHZA 1HAOH 1PQ5A 4YOIA 5C2ZA 3BN9A 2Q6GA 1JOUB 2V3MA 5BPEA 2IN2A 1N8OB 3P6ZB 4RSPA 5FBEA 1AIXH 5CMXH 1OYTH 1KSNA 4UFGH 1FNIA 3SV8A 3DD2H 2BXUH 4INHA 1JIMA 1AVGH 1WOFA 1C2JA 1EJNA 1EATA 3OAAD 3NZIA 3PWBA 4OM9A 3V12A 1GDNA 2KZ4A 9LPRA 5AHGH 1K2I1 3KIDU 2FLRH 1MH0A 3RXVA 1T4VH 3BEIB 2GJGA 4AFUA 2ZGCA 3MH6A 1C9TA 1TPSA 4OS7A 3O8CA 1HAIH 1UTJA 1Q3XA 2OK5A 1G3BA 3I78A 1AY6H 1TMTH 1NRNH 1SGTA 5KECA 3ZVDA 2UWOA 5HM2A 2NU3E 1BMLA 1UVUH 2J34A 2TBSA 2XNIA 2HGTH 5FPYA 3STIA 1DY9A 1DFPA 1P9UA 1MBMA 1LDTT 1C2HA 1ZZZA 3TNTA 1HLTH 1KLJH 1KXBA 4X8UH 2VVCA 1WUNH 2UUYA 1ANEA 3T2NA 3RXQA 2VINA 5JDUB 4IW4E 1RGQA 3GCNA 2ANKH 4MPWA 1C5SA 1SQAA 3A80A 3N7OA 1GBBA 2Z6BD 4XRNA 2WV4A 2FMJA 1AMHA 1GI9B 3RXRA 5DJ7A 1BT7A 1MU8B 2HPPH 2ZFTA 2ZHEH 4LK4A 2PUQH 3QZQA 4I32A 5IYTA 4OS5A 4D7FA 1K22H 2RG3A 3STJA 5ESBA 4NIYA 1O2IA 4D7GA 2SGPE 2ZZUH 8ESTE 1TGCA 3RC4A 3ZIAD 5LPEA 1ZTKA 2BDHA 1GJDB 2TIOA 4SGBE 3GCTG 4MPXA 3E1XB 2VB0A 1IQEA 3CS7A 2Z9IA 1BB0B 4ABFA 4FUIA 1TYNA 1A0JA 2OCVB 1SKYE 1FUJA 1Z8IB 2HNTC 1W8BH 5EW2H 4U30A 3E90B 4DVAU 2KAIB 1TBRH 4B2BA 2GCTB 3G01A 1KTTB 4XDEA 1ABJH 1Z1JA 1ETRH 1FY3A 1JWTA 1H9IE 1TNJA 1ANCA 1VGCB 3AASA 1C2GA 2VIVA 3SV6A 4WF8A 1QRZA 3RP2A 4DIIH 3M7TA 3IG6B 2PV9B 1ANDA 4YOJA 2A5KA 1HAHH 2J4IA 3PROA 4Y10E 1A3EH 4AGJA 2Y7XA 1UTKA 1GJ6A 2G4UA 3OFND 2P8OB 1GHYH 2VGCC 4UFDH 1C2LA 3SBKA 2ZU1A 1Y3UA 3CENA 5L6NH 1O2PA 1E36B 1C2DA 3JZ1B 1LVMA 3AW0A 2BDYA 4BTIB 4GCHF 1PPGE 3LGUA 1TPAE 3A86A 3KQDA 8LPRA 3FOAA 4MPUA 1OWIA 2AHME 2WPMS 1BMNH 1L4ZA 3SJKA 2ANWA 1ORFA 4JMYA 5EOKA 2ZFFH 3ZZ4A 1HBTH 3LGWA 2R0KA 4ABGA 5CDFE 1Y3VA 1O5GH 1XUHA 3AW1A 4OGXA 3OU0A 2H5CA 2PKAB 1WXRA 2BX3A 1O5DH 2VVVA 4AX9H 3P8GA 5CHAB 3U9AH 3NKKA 1AKSA 4YT6H 3A83A 4Y8ZA 4BANB 3K65B 1EP6A 2BDAA 4WY3A 4RKJB 2A45B 4NSVA 4KTSA 5C1UA 4MQAA 4RT0A 6ESTA 1GJBB 1O39A 1C5XB 1CBWB 1D3QB 3KEEA 1SHHB 2P59A 3MU8A 1HAYB 1O36A 3EA9A 3A84A 1Z71A 3MNSA 1N8OC 7KMEH 1D9IA 1C2EA 2WUCA 1VZQH 1D3TB 1IQNA 2BDCA 2BLOA 3RXOA 3RUOA 1SQOA 4Q7YA 3UNQA 1DWEH 3PV4A 2ZCHP 1TB6H 4Y7AA 2VIDA 1COWD 1GG6B 1CHOG 1V2RT 4X1RU 1XMNB 2H6MA 3RXJA 1O3DA 2BYAX 3BV9B 3OEHD 3KGPA 3MU4A 1TWXB 3PV5A 2SGDE 2K1QA 1GDUA 3M3VA 2BTCE 4FUCA 3RXDA 2LP6A 4INKA 3SU6A 1QRWA 1SB1H 4X1SU 3ATLA 3NWUA 3PTNA 1QQUA 3EGKH 1O31A 2B5TB 4WWYA 1LHDH 2BB4A 2PTCE 3GDUA 4KELA 3BEFB 1O2XA 2HPQH 1GBAA 1A3BH 4Y71A 4WVPE 1GL1A 1RIWC 1C1UH 2VJ1A 3KNXA 5F6MA 1OXGA 2O8WA 1O5CB 1O2MA 1ESAA 1WTGH 4M7GA 5GWZA 1C5MD 1GJAB 3SZNA 4O9VA 1EOJA 1PPEE 2RDLA 1UO6A 5C3NA 4IC6A 5K0HA 1GGDC 2XBVA 2FTLE 3WY8A 4Q4LA 1V2UT 2F4LA 3F9GA 3O8RA 3PYHA 1EJMA 1KXAA 1NM6A 1S6FA 2VIOA 4X2XA 1A5GH 1UTOA 1MTUA 2HRVA 3D62A 3OSYA 3TGJE 2OXSA 2WUBA 4NFEA 2CF8H 1FQ3A 1GBEA 2KX4A 3GISB 3UOUA 2W7UA 5CHBA 2Y5HA 1MZDA 3IITA 1DVAH 2C8ZB 3MWIU 1P57B 4AFSA 2ZDKA 4NCYA 3RXIA 2JJ1D 4UE7H 1V2JT 4HFPB 5FX5A 5J4QA 4GHQA 1MTVA 4DT7B 1KIGH 2R0LA 1LHEH 2VIPA 4B6FA 1L1JA 4XFQA 2PGQB 4GPGA 3ODFA 2J98A 2A7HA 1CGIE 1P06A 4CR5A 3MNXA 2UUFB 4H6SB 2XC5A 1ZPCA 3SQEE 1EZXC 2DUCA 4MTBA 3AK5A 1Y5AT 3MMGA 1NBME 5AFZH 1HJ8A 5EW1H 2XBXA 1NRRH 4JZFH 4BAKB 4B2CA 3SNBA 1M9UA 4U01A 5A0BA 4X6NA 5FAHA 1DT2A 2EA3A 1KY9A 3EA8A 1H1BA 2G5NA 2F9VA 1UHBA 5A0AE 1NZQH 2OINA 3R0FA 3B8JA 3A7WA 2A4OA 1TNHA 3B23B 3GDVA 2GCHF 1GCTC 4H4FA 2OC7A 1DSTA 1HIAB 1RRKA 1D3PB 3PO1B 3NRLA 2ODQA 1NFWA 3F9EA 4F48B 1L0ZA 1B5GH 2BQWB 3ODDA 1VKYA 3K6ZA 5C1YA 3QLPH 1BBRE 3TH4H 1TGSZ 2GGVB 2EI8A 1HRTH 1XXFA 1LTOA 3A7XA 3FZDA 4CRGA 4CREA 3LH3A 3RXCA 3SU0A 3ZV8A 1BQYA 2LPRA 3QTVH 3MO6A 3VEQB 3T26A 1G2MA 2XC4A 3CS0A 3SV9A 1V2WT 1O5FH 4AN7A 2ZG0H 3SU2A 2AH4X 3M7UA 2XW9A 3PM3A 4IC5A 3ZZ8A 1BBRK 4BXWA 4AB9A 1F0TA 3F68H 1FY1A 8GCHG 1MTNB 5DGJA 2FOMB 5EJ1A 7GCHF 4ZH8A 1TNLA 5CHAC 1QJ1B 4OS6A 3TK9A 1OWKA 2FWWA 4Y6DA 1F0UA 8KME2 3SNAA 3TLOA 1FV9A 1NY22 1ELCA 5FHTA 4DGJA 2R3UA 1L1NA 1E1RD 4ZKNU 2HVXA 1BMAA 1MZAA 2NWNA 7LPRA 2P3TB 3A88A 2ZFPH 1NRQH 2Z94A 5F8ZA 1EPTA 3P17H 2FOCA 4YLUA 2XYAA 3HGPA 1BRUP 2HNTE 1YCPK 2J97A 2FTMA 4Y0ZE 2PP6A 3E8LA 2WPDD 3SUEA 1ELAA 4X1NU 1EZUC 3M35A 3ZZAA 2BD2A 4ISHH 4ISOA 1PPHE 1QJ7B 1TNGA 2FIRH 4TWWA 1IAUA 5EJLA 1ZHMA 2GTBA 2WPKS 5GJ4B 1T8OA 4ACBA 2A4QA 3TJNA 4ESTE 5C67A 3MHWU 1J17T 2OUAA 2RA3A 2WPIS 4JK5A 1GMHG 2XCNA 4DIHH 1SC8U 2PSYA 2RCEA 1GHBF 2EI6A 1ZSKA 1HNEE 1C5NH 3DHKH 1LHCH 1TGTA 4CR9A 1HJAB 2J2UA 2ZGJA 3P95A 5E2OA 3RXBA 4CHAC 4RN6A 3MU5A 1GHAF 2OC1A 1EXFA 4ACAA 1QZ8A 1MKXH 2FOHA 4ZAEA 3P70B 3F6UH 2VBCA 3SJ8A 1SFQB 2ZDAH 3PLPA 1MAYA 3LU9B 1S85A 1O3CA 2SGFE 1O37A 2WYGA 1W0ZU 1Z6JH 1EUFA 3EYDA 2GCHG 2P95A 1WAYB 1XUKA 1S0RA 5CE1A 1DANH 1SQRA 3UWJH 1GVLA 2VWMA 3KHVA 1SLUB 1EX3A 3UAIC 1BA8B 3MQKC 3VB3A 1EKBB 3M7QA 2H9HA 5TCCA 4A6LA 3ATIA 3W95A 1QL9A 4DCDA 1CT0E 2PTNA 3OY5U 4J2YB 4ABAA 1Y3XA 1NTPA 1GBDA 1CU1A 4O3TA 3ZV9A 1ETSH 1ZRKA 4TY7A 4GVUA 1Z8JB 2WINI 2GDDA 3F9HA 2VIQA 1EASA 4P00A 1WQSA 4ABJA 3BTME 2G52A 3RXKA 1GJ8B 1TMUH 3K9XB 2ALPA 2VH0A 4BAQB 3F0OA 1YPEH 3PLKA 1BZXE 1RTKA 5JBTA 2QV1A 2BZAA 3BEUA 3M5LA 1N6YA 1EAIA 5HIZA 1FZZA 1GI3A 1ZTJA 4AFZA 1THRH 4FXGH 5F8TA 3RXTA 1GL0E 2YNBA 3QO6A 4Y8XA 2XBWA 1ZMJA 4JZEH 4DG4A 1DITH 2GP9B 1Q31A 2C93B 4ZROA 2ZHFH 1ELGA 1A7SA 4JZ1A 1SOZA 1QTFA 3QK1A 3T25A 1P2IA 3S7KB 3UWIA 1SSXA 2SFAA 1GI2A 4K8YA 2TPIZ 2H2ZA 2OLGA 4X8TH 2BQ7B 3VGCB 1J16A 1EQ9A 4P02A 4B73A 4Z6AH 1QHRB 1T32A 2D2DA 1RD3B 1O3GA 4ZKOU 1HAVA 1YPHE 1ZOMA 2HOBA 1GMCF 1WCZA 2QA9E 2P94A 1O2JA 2GKVE 5A8XA 1O35A 4YT7H 2FI5E 4X8SH 1RFNA 1H8ED 1MU6B 3A87A 1FXYA 1X7AC 2WPJS 3GCTF 3N7DA 5IDKA 1P2KA 1CT2E 1GJ5H 3UNSA 3RU4D 2BD8A 3ATMA 2V6NA 1OHHD 1F5KU 1PPFE 4Q63A 3V13A 1GHBG 1FONA 1THPB 2ZDVH 2ZCKP 1H8HD 1PPBH 1C1OA 1QFKH 1NRSH 1NRPH 1FX0B 2RA0A 5DP3A 1GHAG 2TGDA 1ELFA 1A0LA 1LHFH 1ZGVA 4WMFA 2VH6A 2ZU3A 4Z1MD 1CSOE 1TE0A 4X0WU 5DSFA 3UFAA 2ZCLP 5F03A 4B75A 2ZU5A 2NU0E 4XBCA 1C4U2 1DDJA 3ZYEA 1CGHA 4F49A 4DT4A 2ZGHA 3BTKE 1D3DB 1S81A 6GCHF 2JH6D 4ASUD 5EGMA 1GHVH 1OS8A 1IQIA 1AKSB 1V2VT 2BMGB 4Y11E 3MI4A 1AGJA 1QL8A 2JETB 1P03A 2J9NA 4THNH 1GI6A 3MNCA 1ANBA 4KTCA 1P3CA 1BRBE 1TOMH 2C3SA 3UR6A 4AYVB 4ISIH 2HLDD 2BY7X 4JYVH 1UVTH 3M61U 5I46H 1ZTLA 1MCTA 2BLVA 2Y5FA 5C94A 2BX4A 2HNTF 2ZU2A 3OY6U 2VVUA 2YMSC 1YM0A 1YPLH 2BY6X 4ISLA 1FLEE 1ZMLA 4AB8A 1WSSH 2OTVA 1C5YB 3SW2B 3EA7A 4Y0YE 2ZFRH 4IN2A 3EE0B 4K5ZA 2W7SA 4TY6A 2ZP0H 3Q3YA 1TABE 1ZLRA 1ELEE 1PJPA 1EOLA 2A7JA 1AO5A 1BJUA 1P12E 1V2PT 4UFEH 4ZHAA 5FPTA 1ACBE 1BRCE 3EQ0H 2UUJB 2PKSC 4MG3A 4FUDA 4MNWA 1GMCG 1PPZA 1ARCA 2V35A 2R2WU 1CHOF 1SL3A 3P92A 5F53A 3A8BA 2F91A 2R2MB 5EU8A 4JYUH 1O2QA 3D65E 3SV2H 1C4V2 1N6XA 3RXPA 1INCA 1V3XA 4FETA 3A7ZA 1BTYA 2BVXH 4D76A 5DG6A 1UTNA 2QF4A 1HFDA 3MFJA 1K1JA 3SI4H 3KQBA 2JKHA 2A4GA 1ZGIA 1FJSA 1MD8A 1O2SA 1YP9A 2ZQ1A 6CHAB 2CJIA 3F2HA 3UREA 1VCWA 1ARBA 2HWLB 2Z9GA 1ZRBA 4GHTA 4D9RA 2H9EH 1NC6A 1SLVB 3FAOA 5E0GA 5T1VA 2CHAB 2PFEA 1SGFA 4XOJA 3BTGE 1ELTA 3SJOA 3UY9A 5B6LA 3BTTE 3SGQE 3A82A 1O3NA 2P93A 1JXPA 1P01A 1HAGE 4MNXA 1L2EA 4VGCB 2J38A 2J5UA 1IOEA 1FIZA 4YM9A 3Q77A 1W2KH 1DXWA 4ASHA 2NU2E 1JIRA 3ITIA 1SMFE 4FUGA 6GCHG 2J98B 3SUFA 4JZDH 1LMWB 3KN2A 3OEED 1TIOA 3ZVAA 4ZMAH 5EQSA 3I77A 4NFFA 3M37A 4Y7BA 3TGIE 2CMYA 3A81A 2A2QH 3ZZBA 4HG6A 2G5VA 1OWJA 2QN5T 1DS2E 2C90B 1TX7A 1XX9A 4Q2KA 1QQ4A 1FN6A 5C17A 3OTPA 3HK3B 1Z7KA 1OYQA 1SOTA 3E3TA 4Q80A 4K60A 1TBQH 5JB8S 5LPRA 1YWUA 1UHBB 2V0BA 3LOXA 2ZDLA 1AB9B 3M3TA 3TPIZ 1A2CH 1E38B 3RLYH 3WWFA 2Y81A 1QRXA 1YLNA 1FMGA 5GCHG 3MH7A 3FFGA 1HAPH 1C1PA 2O8MA 2AIQA 2JIZD 2J92A 3URCA 2GDEH 3WW7A 3GY7A 2TRMA 3T62A 1XKAC 5GXPA 1XUJA 4CRBA 5T6GA 1O2LA 4D9QA 1SGFG 5E0JA 1AVWA 5L2YH 3H5CB 1AQ7A 1J8AA 1UCYE 1UTLM 5GDSH 4DY7B 1D6RA 1GBFA 3MU1A 4Y79A 2FODA 3CNRA 2QCYA 1N1LA 4K3JA 3ZVCA 1AE8H 2Y7ZA 4FUBA 1DXPA 1BTPA 3VPKA 1JMOH 3H7OA 1Y8TA 2KCOA 1SVPA 4E05H 5A2MH 1A0HB 3GYMA 1UCYK 2B0FA 4E06H 3GCHB 2XWAA 1OP0A 2QXJA 4BTTB 4R0IA 1MQ5A 1G36A 1AWFH
chains in the Genus database with same CATH topology
2THFB 2Z9KA 2A31A 2GV7A 2AEIH 2JH0D 1LCYA 2PWXA 2FESH 5DP5A 2Q6DA 1HPGA 1VITG 1J15A 1C2IA 2AIPA 3U98H 1GI8B 1SLWB 1BTZA 8GCHF 2OC0A 5EODA 2GZ9A 2AYWA 1H8IH 4Q7XA 1LPZB 1E37B 2Q6FA 3LKWA 1AZZA 4ABBA 4WXVA 1BTUA 4J1YA 2C8XB 2YNAA 2ZA5A 4ABHA 2FEQH 1BTHH 3UNRA 3P8OA 3TITA 5LPFA 3LIWA 5T6DA 1XUIA 2PW8H 1SQTA 4HTCH 1K1PA 2QXGA 4MDSA 2GX4A 4CH2B 2ZGBH 3GY4A 1KXDA 3EAJA 3SNEA 2F9PA 3MNBA 1T7CA 3GYLB 3PWCA 3AVZA 5E0HA 1QB9A 1GI0A 1TAWA 2TGAA 1XM1A 2SNWA 4BXSA 5PTPA 1LO6A 1LVBA 3R3GB 1OP8A 3FP8E 2W3IA 5J4SA 1GMHF 4H6TA 1DX5M 2BLWA 1QY6A 1AFQB 1BIOA 3KF2A 3LT3A 3ZZ3A 1F5LA 1UTMA 1H8DH 4HZHA 2KAIA 4WH8A 3D23A 1DUEA 3DA9B 2OC8A 2ZWLH 1PQ7A 1JRTA 1V2OT 3L33A 1HDTH 2GZ8A 2W26A 3UIRA 2BVRH 3PMAB 1DICA 2VWNA 3BTQE 5F8XA 2BD4A 2ZKSA 1IQFA 1KXFA 2GCTC 3UR9A 2FDAA 1TMBH 1C1MA 1TONA 2ODYB 3RXFA 2Z3CA 1VGCC 1ELDE 4VGCC 1O2YA 2FOEA 4O03A 3SUDA 4DJZB 1S5SA 3T29A 1S83A 3ATKA 1B0FA 3DUXH 3ZYDA 1MKWK 2P8OC 3SUGA 1V2LT 1EB2A 2BXTH 4ZKSU 1EZQA 4HI3A 3F1SB 2WPHS 4B76A 1E0FD 4K1TA 3E0NB 3VB4A 3RMNH 3GY5A 1KDQB 2BM2A 2FS9A 2ZGXH 3FANA 5DKMA 5HMAA 3TH3H 1HAVB 4DURA 5HM9A 1YCPM 3QZRA 3C1KA 3UUZA 1OP2A 1TQ0B 1ZPZA 2ZO3H 2Q1JA 1SGPE 1BMMH 1AB9C 2O8UA 3QUMP 1TBZH 1W0YH 1HXFH 2F9BH 4ISNA 1A5IA 3ZZCA 3RXHA 3UPEA 2F9UA 4NG9H 1QA7A 2OD3B 3A7TA 4E7NA 5E2PA 1K1LA 1BRAA 1P09A 4ZHLU 4X1QU 2OP9A 1C1QA 2QC2A 1O3HA 1C5OH 5LH8A 1ZJKA 1O3IA 2EI7A 5G4BA 2H5DA 1CBWC 4QT8C 4CH8B 1VJAU 3T5FH 4YO9A 2V3HH 3TIUA 3LC3A 1PPCE 2BLQA 1K1MA 1F5RA 1O2UA 3E0PB 5JBCS 3SGAE 5DO4H 1GG6C 1OSSA 2Z9LA 3K2UA 2G8TA 4I31A 1GBIA 5EPYA 1K21H 2Z3EA 2XWBI 2ZPRA 4MVNA 1BJVA 3GDSA 1VR1H 3ZVGA 1GBKA 2PLXA 2UWPA 1WQVH 4FVBA 3RXAA 1FPCH 1W13U 1QBOA 1TOCB 3QGJA 4I8LA 1O34A 1TX6A 1HCGA 1TPPA 1C5WB 1HGTH 3LGTA 3RU4T 4O97A 2ODPA 2CXVA 4WMDA 1MCVA 1DLEA 1W7XH 1P04A 2Z3DA 4FUJA 1FY4A 4A92A 1K28D 1GBJA 1O5AB 4BTUB 5C5OA 1E35B 1D6WA 3GY6A 1GHWH 3U8RH 1RXPA 3TJUA 1MBQA 5A8ZA 1C9PA 3SNDA 3ZVFA 2XC0A 1ESBA 1DWBH 3I29A 1SGNE 1SPJA 4D8NA 4YESB 4F4OC 5FBIA 1CGJE 1GHXH 4BAOB 1MMJN 1Y3YA 3OTJE 1WYKA 1Y5UT 3MTYA 1QA0A 1GVKB 5EQRA 2CN0H 2B7DH 1FI8A 1GVZA 3FP6E 1DSUA 4CRDA 2BOHB 3SU5A 1TA2A 2ZFSA 3A8AA 2UUKB 3BTFE 7ESTE 2NU1E 3VB7A 2ZHWH 3NXPA 1ZHPA 2F3CE 1BHXF 3JZ2B 2ZECA 3U1JB 1C1WH 1V2MT 3GY8A 2PGBB 2FS8A 2Y6TA 1LPKB 4B1TA 3EDXB 2ZFQH 3RU4E 5T6FA 1UVPA 2I6SA 1OOKB 2CV3A 4NIVA 1V2KT 5DP6A 1S0QA 1YC0A 3NCLA 1QCPA 1XVOA 3LONA 5EG4A 3LH1A 3FP7E 1YGCH 3MH5A 1O3PB 2GD4B 2G55A 1DUAA 1KXEA 1O2KA 1SI5H 3ZVBA 2BD9A 3RXUA 5GPIB 2ZDNA 3SV7A 1O3FA 1HIAA 3S0NA 1ZYOA 4AG2A 1G3EA 2ZI2H 2Y82A 1O33A 2QXHA 3BG8A 3DFLA 1TX8A 5AVDA 2VGCB 2FP7B 1C5QA 1C5VA 1EB1H 1O3EA 3GY3A 5DP4A 3UOPA 2Y80A 1F0RA 3A8CA 1O3JA 4JYTA 4I33A 4Q7ZA 3PO1C 5ABWA 1TGNA 4ZXXH 4K69A 1O3OA 2ZIQH 3M5OA 3L6PA 3RC5A 5JBAS 3MOCA 1BDAA 3RXGA 2C8YB 4A5TS 4WMEA 3TNSA 3KQCA 1A5HA 1LQEA 4DOQA 3RM2H 4SGAE 4NIXA 5FCRA 1IHSH 3SU3A 4OS1A 4I8JA 1O30A 1RJXB 1JBUH 4GLYA 1P8VC 5ESTE 1G30B 4ABIA 2VWOA 2F9OA 1TNKA 1DY8A 1EP5A 1Z6EA 1NU7B 3DFJA 2QAAA 1P10A 1BBRH 2QY0B 2A4RA 3P8NA 1MTNC 1NN6A 2FOAA 1A46H 3ELAH 3VXEH 3TVJB 2JH5D 3M5NA 4X1PU 1C1TA 1XVMA 1TFXA 5BRRE 4PROA 1V2QT 1XXDA 3HGNA 4YZUA 1GI7B 3TGKE 1A1RA 1SHYA 1C1RA 1IQJA 1PQAA 2SNVA 1YCPH 1OKXA 2A32A 1YF4A 1B0EA 1SGQE 2R3YA 3HPTB 1F2SE 1J9CH 1AI8H 1C1NA 1ZJDA 4AFQA 3S7HB 5GCHF 1AN1E 1HYLA 4GUXA 4FUHA 3TJOA 2BZ6H 2VWLA 3FZZA 1NFXA 2WPLS 1B7XB 1KYNA 2O9QA 3F9FA 3TH2H 5HXFA 1DM4B 1MTSA 4FU9A 4IMZA 5A8YA 1PFXC 1RIWB 5EQQA 1HJAC 2ZEBA 1C2FA 1Y5BT 1FY8E 1E34B 3KL6A 1S6HA 1C5RA 1YPJH 3M36A 1H4WA 3PMHB 3M3SA 3SN8A 2DE8A 1ZHRA 4AOQA 1GGDB 1P2NA 1GBLA 1YPGH 4CRAA 5DP9A 1SGEE 4U32A 1P2MA 2ANMH 2SGEE 3SORA 1LPGB 1C1VH 4OS4A 1P05A 1RTFB 4ABEA 3ZZ5A 3BF6H 2SGAA 1QB1A 2A5IA 1GBTA 1ZMNA 2WV5A 1F0SA 1K1OA 2W5EA 2QGRA 1TGBA 4OS2A 4JCNA 3W94A 6LPRA 4E7RG 2ZDMA 4I7YH 3NPSA 1H9HE 1C4Y2 1QNJA 1O3KA 1GBHA 1S84A 2ULLA 3A7VA 5DP8A 3PB1E 4U2WA 2PHBA 1UK3A 3RXMA 3LJJA 5FPSA 2ZHDA 1C5PA 3TJVA 2ILNA 1VITF 1TNIA 5DP7A 2FOBA 3GOVB 4B2AA 1Z8RA 3RLWH 1YPMH 2XXLA 2BDBA 1ETTH 4ABDA 1UTQA 3DT0H 4LXBH 4FUFA 5A09A 3V0XA 3CP7A 1CHGA 3NK8A 2XBYA 2FO9A 3SU4A 1GI5A 3RMLH 1VITH 1C5LH 1J14A 1IQMA 2ZTZA 1U6QA 3SGBE 4CRFA 4NWKA 3ZZ9A 1JRSA 1SLXB 2ZPSA 2CF9H 2IOTA 2F83A 1BTWA 3TU7H 2B9LA 4UD9H 1O2TA 3K6YA 3VGCC 1MUEB 3S9BA 2HALA 2Y5GA 3LGVA 3T28A 1GCTB 2I6QA 1SG8B 1THSH 2FI3E 4XE4A 1IQLA 2G81E 1UK4A 4K8BA 5L30H 2STBE 4AORA 5C5NA 3BTWE 1W3CA 1GPZA 5HGGA 1NESE 1TRNA 2Z9JA 3T27A 1DE7H 2SGQE 1RS0A 3URDA 2GMTB 1L1GA 2FX4A 3Q3XA 1O2RA 4X6OA 3E16B 1O5EH 2XRCA 4K2YA 1GJCB 1FIWA 2GT7A 4LZ1H 3UTUH 3A8DA 1YLCA 1EZSC 1UTPA 1O2NA 3MH4A 4BNRA 1YBWA 1AD8H 4INLA 1SFIA 1L4DA 3PMJA 1G3CA 5TJXA 2D8WA 1DWCH 3LPRA 1GMDF 4MNYA 1GI1A 1O5BB 9ESTA 1QIXB 3S69A 4KKDA 5C20A 4IGDA 1H9LB 2FM2A 3LC5A 2W3KA 2ASUB 4NA9H 2FI4E 1CA0B 4O3UA 1KTSB 5E8EH 3LDXH 4A7IB 1CVWH 3RXEA 1P2QA 1K1NA 2F9NA 1W12U 1O2WA 1S82A 1C2MA 1SGYE 1KXCA 4BAHB 3HATH 1FN8A 2GT8A 2JETC 1FAXA 4FU8A 5FCKA 2P3FH 4DW2U 1O3MA 1ZSJA 2D1JA 4MPVA 1EPTB 1ID5H 5HYOA 1P3EA 2FX6A 4Y8YA 3QTOH 3FVFB 1KLIH 1P9SA 1P2OA 2BDIA 2GZ7A 1TLDA 3LGYA 3OX7U 2A5AA 3MO9A 1BUIA 3ZZ6A 1AFEH 4TPIZ 3QGNB 4I8KA 2M5TA 4GSOA 3U69H 1G37A 3O8DA 3RXSA 1DLKB 1HXEH 1ESTA 1K9OE 3A89A 1PYTD 3AAVA 4AGKA 2AMQA 2AGIX 1UVSH 4CHAB 1YPKH 2AMPA 2O8TA 3QX5H 1MKXK 1O2GH 4X6MA 4GAWA 1YPHC 1GJ7B 2H1UA 2A2XH 5EXLA 1MQ6A 2C8WB 1D4PB 2FYQA 1O0DH 5A0CA 3QN7A 5LGOA 2FOFA 1P0SH 3IWMA 4ZXYH 1O3AA 1O32A 1ELBA 1DOJA 2D26C 5B6OA 2XCFA 2QF3A 2BD3A 4RKOB 1OPHB 3E6PH 1SBWA 2B8OH 1CQQA 3SU1A 4NGAH 2FYRA 2QF0A 2OQUA 1W14U 2QXIA 1BCUH 5SGAE 5DPAA 4B71A 5JBBS 3HKJB 4A1TA 3HKIB 1GBMA 2BHGA 1F92A 2ANYA 2A7CA 3Q76A 4IBLH 4OGYA 1T4UH 3Q3KA 1C1SA 4GCHG 4MLFB 4WH6A 1AVXA 2HLCA 5EPNA 3BG4B 1O3LA 4X6PA 1EAXA 1AUTC 2LNCA 1EAWA 1HAXB 3U8TH 1XUFA 3VFEA 1O38A 1DWDH 1UVOA 1V2TT 5H4IB 6CHAC 1OWEA 4NA7A 5DK1A 2BVSH 1WTHD 2ZQ2A 4ZUHA 3A7YA 1Y59T 4WJG2 1QBVH 3A85A 3QDZB 1GMDG 3PMBB 4IS5A 5FX6A 3ZZ7A 3VB6A 1ELVA 1T8NA 2PUXB 1C5UA 1AZ8A 2ZTXA 2CHAC 1LHGH 2ZU4A 1A4WH 3SQHE 1WU1A 1HAZB 5JPMH 1SGCA 2OQ5A 2WYJA 4I8GA 1T31A 2G4TA 1MD7A 1YYY1 1GJ4H 1HV7A 1TRMA 2UWLA 5I25A 3D49H 4TWYA 4UFFH 1AU8A 3BTEE 2R9PA 1ZPBA 3TK6A 1QJ6B 2GVFA 3S9AA 3UQVA 4A1VA 3LGIA 1QURH 2VIWA 3BSQA 1FPHH 1TALA 1Z8GA 4TPYA 4ZKRU 1SGRE 1MAXA 4NWLA 2AGGX 1C2KA 5EXMA 1RTLA 1GDQA 4Y76A 2FXRA 2PKAA 3Q00A 1NT1A 3ATWA 3SHCH 3BIVH 1IQHA 3V7TA 5JYIA 3SNCA 3KCGH 1T8MA 2A0QB 4KGAA 1NS3A 2GMTC 4TYDA 1GBCA 1CO7E 1G32B 1NO9H 2BDGA 3BIUH 1C5TA 1TPOA 2YOLA 4Z0KA 3TK5A 4CBNA 4ZHMU 1VCQA 1CT4E 2VNTA 1Q2WA 4KTUA 3BTHE 4FVDA 1OX1A 3NUMA 4X2WA 2J95A 1CA8B 4NIWA 1O2OA 1BHXB 3RDZA 3RMMH 1O2HA 2ZC9H 1YKTA 5T3HA 4XSKU 2P3UB 4YTAA 1ABIH 3RM0H 2J94A 3P8FA 3VB5A 2OBOA 1LKBA 1O3BA 3MYWA 2IPHA 4NSYA 5JB9S 1LVYA 3V3MA 2CGAA 1HJ9A 4JZIA 3PLBA 1BOQA 3RMOH 1CA0C 2FPZA 1HB0B 5GIBA 1T8LA 1QGFA 4X2YA 1LQDB 1NU9A 2FLBH 1PQ8A 3BTDE 3SJIA 1P11E 1A61H 4B74A 1AHTH 2BOKA 4H42U 2STAE 1TRYA 1TA6A 1LKAA 5FXLA 3GCHC 1WBGB 1EJAA 1UCYH 4LOYH 2V3OH 2ZF0H 1C5ZB 1UJ1A 4I8HA 3QWCH 2BD7A 3ESTA 4LZ4B 2XTTB 1EPTC 4X8VH 4BAMB 1HUTH 1BTXA 3PTBA 3SHAH 1GJ9B 1NROH 1W10U 1VCPA 1K1IA 1Z1IA 5K7RA 4NZLA 3ENSB 5TCAA 1P2JA 2H9TH 4IN1A 1IQKA 2TGTA 1G3DA 2G51A 2FOGA 2BQ6B 1QB6A 2AMDA 2AERH 2BY8X 4UEHH 2BD5A 5ETXA 1SR5C 1SGDE 4AZ2B 1NPMA 2ZNKH 1OWDA 2OBQA 3UQOA 3ZVEA 1F7ZA 4YLQH 3GCOA 4UONA 1OWHA 1AWHB 1GI4A 4FUEA 1NFUA 3RXLA 2PKSB 4WXIA 1QR3E 2QIQA 2TGPZ 2EC9H 4CRCA 4XBBA 5L2ZH 3KQEA 4K1EA 1ZSLA 1PYTC 4R8TB 2FZZA 3VXFH 4NA8A 1MTWA 4K1SA 1O2ZA 1Y3WA 3ZZDA 4BOHA 3M5MA 1GWAA 1AE5A 4YOGA 5AF9H 1ZR0A 2A1DB 3L3TA 2ESTE 1YLDA 2PR3A 4AYYB 1AFQC 3GY2A 2P16A 3SI3H 2ZPQA 3BG4C 4IMQA 1WV7H 2O8LA 3E91A 1KLTA 5EXNA 3RC6A 1SGIB 4UDWH 4NZQA 4AG1A 3C27B 3MU0A 3OYPA 2PSXA 3SOSA 1UK2A 3HK6B 3O8BA 7GCHG 4FU7A 1TQ7B 3B9FH 1EAUA 1GCDA 1QBNA 3H7TA 1VJ9U 1LVOA 1P02A 2GV6A 3AAUA 1DPOA 4A1XA 3GICB 2Z7FE 1QL7A 2AGEX 1AUJA 2IJOB 2DE9A 4XBDA 1V2NT 1XKBC 1BITA 1G9IE 1KDQA 2BY9X 1MKWH 2BY5X 4KP0A 2AS9A