3RXFA

Crystal structure of trypsin complexed with 4-aminopyridine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxfA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxfA02
3N7OA 1LKAA 8GCHG 1UTMA 2GT8A 4GSOA 4AORA 1BTHH 1HJ8A 4INKA 1T31A 4M7GA 1AFEH 1QJ6B 1Q31A 1ZPBA 1IOEA 4Y76A 1XUFA 1T8NA 3P8GA 1SGTA 4YLQH 5EG4A 1O3KA 1YPKH 1MAYA 1YC0A 2P3FH 1OYQA 1BBRK 1H9IE 1ELCA 3RXHA 1V2NT 1TABE 1XKBC 1BITA 1GBHA 2ZTZA 3A7VA 3BTQE 1K1NA 3BEUA 2ODPA 1QBVH 1E37B 1HB0B 2VIOA 3ATIA 1SFIA 2FS9A 1WUNH 4ABJA 1EZSC 2FOHA 1QA0A 1TAWA 1EJAA 1ZPZA 1VCWA 2BY7X 2BLQA 3V12A 1DLEA 1A5HA 4WWYA 4AB9A 5GWZA 3B23B 4ABHA 1Z8GA 1O2NA 2RDLA 3VB6A 1MAXA 3MNXA 3E3TA 3M7TA 1Z71A 2ZGCA 1A2CH 3BEIB 1LQDB 3E1XB 2EI6A 1CHOF 2Q6FA 1O2IA 5FCKA 3U9AH 1QTFA 1MKWH 2WINI 1QB1A 1TB6H 3LGIA 1J9CH 2P8OB 2BXTH 1GMDG 1C1QA 4E06H 3UY9A 1SFQB 1TALA 2D2DA 3AASA 1AUTC 4UFGH 2A31A 1LHDH 1KLIH 2QV1A 3RLWH 3SNCA 4ESTE 3F68H 1GCTC 3HGNA 5EU8A 5A0BA 1FPCH 2FYRA 3K9XB 1SLUB 2R3YA 2YNAA 4IGDA 3ATMA 3ZYEA 3PLBA 3UPEA 3FP6E 4YTAA 4NFFA 3E8LA 1DXPA 1DUEA 2FMJA 1WV7H 1HUTH 3K6ZA 3MH4A 3BTTE 1K22H 1A0HB 1HPGA 2OXSA 3U8OH 2O8UA 2ZTXA 3ZZ7A 2ZDKA 4K1SA 3RXCA 1GI3A 3GY6A 4DJZB 4NA8A 1Y3YA 3M35A 4ZHAA 1P2QA 5C3NA 1N8OC 2A4OA 1T8OA 2JH5D 1HNEE 1S81A 5A2MH 2Z3EA 2ZFTA 4E05H 1YBWA 3GCTF 2FEQH 3FANA 1LQEA 1SR5C 1T4UH 4ZAEA 2VVVA 3ZZDA 2OLGA 4IW4E 3S7KB 2A4QA 2BOHB 1Z1JA 2H6MA 2XBWA 4A7IB 4UFDH 3U1IB 2V3OH 3S9BA 1OWDA 1TWXB 4GCHF 3VB3A 1L1GA 4AFUA 4X8VH 2Y7XA 1YPGH 4Q2KA 1ZLRA 3RU4E 1DOJA 1GI1A 2PV9B 2W26A 1XUKA 2F9PA 1PYTD 3P92A 4ISIH 3U8TH 5A8ZA 3DFJA 3IG6B 3TJVA 2Q6GA 6CHAC 1EQ9A 5A0AE 5JYIA 1YPLH 3RXBA 2XTTB 2EC9H 5GPIB 1BMMH 1KXDA 1ZSKA 2LPRA 1P3CA 4RSPA 4BAOB 3LC5A 4XE4A 1BHXF 4BAMB 3UR6A 3QX5H 1ANDA 2ZU3A 1HBTH 1GGDC 1MUEB 1HJAC 3EA8A 3MNBA 4K69A 1JXPA 1GBJA 1RTFB 1Z6EA 2BX3A 2ZGJA 1F92A 1IQKA 3RC6A 1ZGVA 2C93B 1HJ9A 1DS2E 2XBYA 4FU7A 1SVPA 3PO1B 1AE5A 1K9OE 3PMHB 3SJIA 4AYYB 1GL1A 1K1OA 1YGCH 3DD2H 1NY22 1W14U 1BBRE 1MD8A 1QY6A 1INCA 3R3GB 1ZR0A 1BUIA 4NSYA 2PUXB 2XYAA 3Q76A 2FOAA 5LGOA 4ZUHA 4Y0YE 1TYNA 4AG1A 4KGAA 1V2TT 1HAYB 1MZAA 3HGPA 3LH1A 1ELTA 1GHBG 1FIWA 3ATLA 3LH3A 5I46H 3TH2H 2AEIH 2BD3A 3E0NB 3B9FH 2AERH 3GY5A 3O8BA 1QRZA 4K5ZA 5EXLA 8ESTE 1XUIA 1O35A 2GDDA 2BQ6B 2IPHA 5DO4H 1AO5A 1XVOA 1D3QB 4INHA 1GJCB 1P2OA 5AHGH 3GISB 3NWUA 2Y6TA 2G5NA 1SI5H 2FI3E 5J4QA 2VJ1A 1MCTA 4WXIA 4WJG2 5DPAA 2FX4A 2C8ZB 1NU7B 2P95A 1ZHMA 1O2KA 2OC8A 3RXRA 5EQQA 2A5AA 1J14A 4B2BA 2GZ9A 1VR1H 4ZHLU 1XUJA 3RXPA 1GMHG 5AF9H 4CRCA 1W12U 1W11U 1FY5A 2ZHFH 2SGQE 3ZZ4A 1O2LA 1CT2E 1G3BA 1XXDA 1OXGA 1MKWK 1SLXB 3RDZA 3TH4H 1RIWB 2AGGX 3UREA 1JRTA 1P03A 1TGBA 5CHAB 3K6YA 3OY5U 3FZDA 1UK2A 1Y5AT 1OP2A 2PTNA 2ZTYA 3F9GA 1YPHE 1PPCE 2HOBA 1YPJH 2ZG0H 3GY8A 1EX3A 3SU0A 2TIOA 4B2CA 2C8XB 3NCLA 2ALPA 2BDHA 4NA9H 1D3PB 1TOMH 2I6SA 4Q80A 1C2EA 5DGJA 3I29A 4UFFH 4YT7H 1ELVA 2GX4A 1ZYOA 4Y7AA 3TGIE 2FOCA 1P3EA 2ANMH 3BTFE 2W7UA 5AFYH 3SUFA 3M5MA 2ZO3H 1NFWA 3DT0H 3UR9A 2GGVB 3A86A 1EP5A 2GP9B 2OBQA 1W0ZU 4OS2A 1FAKH 3SV7A 1TONA 1O3FA 3GOVB 3RXSA 1F5LA 4NIYA 1C1TA 1C5WB 1XM1A 2F3CE 3M5LA 4MPWA 3RMMH 3VEQB 4D9QA 4JMYA 1OP0A 2GCHF 4Y11E 1QRXA 3GYLB 4O3UA 1TPAE 4IN2A 5DP4A 1G30B 2ANWA 2DE9A 1AVXA 1DANH 1PPZA 1EASA 1G2LA 1HAHH 3V13A 1GBTA 5C2ZA 2H9TH 2JETC 1C4V2 1LTOA 4DIHH 2G55A 2ZFQH 1TE0A 1C5MD 2Y5HA 3SNBA 4AYVB 2FOBA 4FVDA 5FAHA 4ZXXH 4Y0ZE 1PFXC 4FUHA 2BVRH 2VGCC 4WH8A 5PTPA 1GI9B 1UTJA 1EJMA 2AYWA 4A1VA 1TOCB 2G52A 4ISLA 1A0JA 3BF6H 3ZYDA 1ZGIA 1BB0B 2Z9JA 3E91A 1S0RA 4CH2B 3URDA 1ESBA 1WTHD 1CO7E 3VB4A 1QB6A 2A2QH 3KQBA 3QTVH 1AQ7A 2ZKSA 1QIXB 1EAIA 3FZZA 1AMHA 1ETTH 1EOJA 3SZNA 1DVAH 4NWKA 1C5NH 3SU1A 1SGQE 4AZ2B 4I8KA 4GHQA 9LPRA 3IWMA 1FPHH 3LGUA 3QLPH 1NC6A 1YPHC 2SGFE 1HFDA 2FODA 4IN1A 1O2PA 1WOFA 1O2WA 3SOSA 1FDPA 5C1XA 3QN7A 1IQJA 1RRKA 3RMOH 1WU1A 2TGAA 1S6FA 3W95A 1EAWA 2R2WU 1CU1A 1BBRH 1V2LT 3Q3XA 2BB4A 4U2WA 3GY3A 4UDWH 2PKAB 1DWCH 1PPHE 2XCNA 2CF8H 1E35B 1TPPA 1WTGH 1C1NA 1LVOA 2VIQA 4BOHA 1Z7KA 5EODA 4BTIB 2VIWA 4TY6A 3KHVA 3MNCA 3SHCH 5I25A 3A7ZA 3V3MA 1NRRH 2VNTA 1Y5BT 3VGCB 1KY9A 3M3SA 2PUQH 1EZUC 1TIOA 9ESTA 1THRH 1VJ9U 1K28D 4FUIA 3VFEA 1GJBB 1UK4A 2FPZA 4YOJA 2Y5FA 2ZCKP 3LJOA 1X7AC 2OQ5A 3UOPA 3PTNA 4HI3A 1O5FH 2BD7A 2V0BA 1S83A 2XRCA 1ZSJA 1HXEH 1TNGA 1BRUP 3P8FA 3MU4A 1HGTH 1TA2A 1EJNA 8KME2 1C5OH 1V2JT 1L0ZA 3FVFB 1VITG 1NN6A 1Q2WA 1O2HA 4TYDA 3EE0B 3PB1E 1CVWH 2HWLB 1O3PB 3KQEA 2IN2A 4ASHA 3RXKA 1IQNA 4IMQA 4YOIA 3U98H 3UNRA 3A83A 2ANYA 3A7YA 3GDUA 3TJUA 3SN8A 1P09A 2XC0A 4X0WU 4Y8ZA 2OC0A 2C90B 4Y79A 2FESH 1BTWA 2ZDNA 2C8YB 5JPMH 1CGJE 1SG8B 3MYWA 1C1UH 2B9LA 3F9EA 4K2YA 3TH3H 5C1UA 3A81A 1IHTH 3SV9A 3BTWE 2FI4E 2FLRH 3U1JB 1WAYB 1ZHRA 3S7HB 1UHBA 4FXGH 4A92A 1JBUH 1ARBA 1S82A 4JZIA 3TIUA 1XUHA 2FZZA 1HDTH 5AFZH 3T28A 2ZU4A 1G3EA 7GCHF 1ACBE 2BDAA 2VINA 2UWOA 1QJ1B 2QCYA 2FYQA 2BY9X 2WV5A 1O5DH 1VGCB 1C1MA 3P17H 1MBMA 5BRRE 4OS4A 3S69A 2B0FA 1A5IA 3LC3A 2GMTB 3O8CA 3SV8A 1P0SH 2WPIS 3Q77A 2AIPA 1YYY1 4ABIA 1TFXA 2SGDE 1QL7A 1VZQH 4X8TH 3A85A 4Y8YA 2F9UA 1A3EH 2FXRA 3RXEA 5EW1H 3DHKH 2PKSB 2RCEA 2G5VA 3P6ZB 1OSSA 1LDTT 1QQUA 2PGBB 3E6PH 1O39A 1EB2A 2ZF0H 3RXMA 1SPJA 1HRTH 1TQ7B 3P70B 1TRNA 1T8MA 3TK6A 3LGVA 2VIPA 5JBTA 3DUXH 1ABJH 1SGEE 4U32A 3SJ9A 2J2UA 3PWBA 3KGPA 2Z94A 3KF2A 1UTLM 3ODFA 3PWCA 1AFQB 1C5SA 2J9NA 1SLVB 4FUFA 1KXFA 4VGCB 1DY9A 1F5RA 1SGCA 2WYGA 5C5NA 1GJ4H 4B2AA 1T7CA 1O3GA 1PQ7A 1VJAU 3SW2B 1OX1A 2AMPA 3ZVCA 5FBIA 1KXEA 3A82A 3LGWA 1Y3WA 1JMOH 2HNTE 4I7YH 1XUGA 2WV4A 4NGAH 3RLYH 3I77A 4BANB 2WPHS 4PROA 1Y3XA 4WH6A 1SOTA 2WPKS 2BDCA 1C4Y2 1GJ9B 2BY5X 3GDVA 2Z9LA 1GMCF 5CHAC 4X8UH 2XC4A 1AD8H 1CT4E 2P3UB 2WPJS 1UMAH 3M36A 1BMLA 1C5QA 1FY3A 2G51A 4ZXYH 5HM9A 1LHGH 1V2UT 2O8LA 3O8DA 3PV4A 1AB9C 1CHOG 1K1IA 1P2MA 3MOCA 1G3CA 1E0FD 5AVDA 1BHXB 4ABDA 4XBBA 3RC4A 4X6OA 2GCTB 1C5TA 4DOQA 1SSXA 4AGJA 1GHVH 1UVPA 1ZMJA 4X6MA 3EGKH 2ZFPH 2XCFA 3QK1A 3SU6A 5JB9S 1TNHA 4X8SH 2GD4B 1W2KH 4GPGA 4UEHH 4K1EA 3E0PB 2SNVA 3SQHE 4D8NA 2TRMA 4NIWA 1MTNB 2J95A 1UVUH 3MI4A 1TGNA 1C5LH 1AVWA 1HAVA 1OYTH 3LIWA 3ZVFA 1DWBH 1L4DA 2QGRA 1F5KU 2R9PA 2PLXA 4DVAU 2AMDA 1O2SA 1OS8A 3ZVDA 1B0EA 1SGRE 1P2IA 3AAVA 3ZZBA 1O3OA 2BDBA 2FI5E 1HAOH 4IMZA 1P2NA 3MU0A 1GBFA 1NO9H 3AW0A 3T29A 1XKAC 3R0FA 1O2QA 2PHBA 4MNVA 1MTVA 3FP8E 4ZROA 1B0FA 5C20A 2ZQ1A 1GJ6A 1CBWB 1EPTC 1YLCA 1DWDH 1S84A 1OWHA 3K2UA 2G8TA 4GCHG 3F9FA 1D4PB 5JDUB 4I31A 4IS5A 4OS5A 1NROH 4UFEH 1QBNA 5FX6A 1G2MA 2PW8H 2HNTC 1ANCA 3PLPA 1BA8B 1FMGA 1GVKB 3BTKE 1C5PA 3PMJA 3I78A 5DP5A 1BTXA 3RU4D 2FIRH 2H1UA 2C3SA 3QGJA 5E2PA 3KEEA 1CGHA 2HLCA 1GHYH 5GCHF 1XMNB 2RA0A 2IOTA 2ALVA 4JZFH 3SORA 5FBEA 3JZ2B 3WY8A 1GJ7B 1ZRKA 2UUYA 3JZ1B 3LJJA 2OCVB 3UTUH 3ESTA 1O2JA 7KMEH 1TNIA 3RM2H 4MTBA 1D3DB 1DFPA 2THFB 5H4IB 1O2TA 1DSUA 1GI4A 4JZDH 1AY6H 1MD7A 4BXWA 4CBOA 2FDAA 2QAAA 4IC5A 1NRPH 3SJ8A 1O3DA 3K65B 4B75A 4BNRA 5C67A 1O3HA 1ELGA 1LVBA 1VCQA 2OC1A 4XFQA 4CR5A 2J34A 1QFKH 1GG6C 1F7ZA 2GT7A 2CHAB 2H5DA 2STAE 2VB0A 4TWWA 5JBAS 3QGNB 3A8BA 1DDJA 2RA3A 1Y5UT 3GCHC 2M5TA 1PQ5A 1E34B 5LPRA 3T25A 1MKXK 4FUJA 3ATKA 2ZNKH 2KAIA 1EB1H 2ZFFH 4I8HA 4X1SU 2BDYA 5CMXH 4A1TA 1YP9A 3LGYA 1K21H 1Y59T 1ID5H 2K1QA 4H6SB 1RXPA 5ESBA 3GDSA 1PPBH 2A2XH 2Z3CA 4WXVA 1JRSA 1AZZA 2BVSH 1C2LA 2GKVE 5L2YH 3O8RA 3MHWU 2QY0B 2WPMS 1OWKA 2D1JA 1FJSA 4YT6H 1XX9A 1GBKA 1SGFA 1Z6JH 3EA7A 4MNXA 3A8CA 3BIUH 1GI5A 1TA6A 4WF8A 3SGQE 4AGKA 4U01A 3HKIB 1MTUA 5HM2A 2G00A 2AIQA 2GV7A 5L2ZH 1U6QA 1S85A 3BG4C 4B76A 1AWHB 1SLWB 3A7WA 2G4UA 2VIVA 4CHAC 3RP2A 2P59A 3MH5A 1NFXA 5GIBA 5JB8S 4I33A 1DPOA 3PTBA 3D23A 1W8BH 2UUJB 3LU9B 1O31A 1OWEA 4FU8A 2HGTH 2C8WB 3A7XA 1JOUB 4F49A 4R0IA 3NPSA 2ZDLA 1ZSLA 3DFLA 3SGAE 1CA0C 4GAWA 4BAKB 1W7GH 5C1YA 5SGAE 4Q7YA 5HGGA 1ELDE 2YNBA 4B1TA 1PYTC 1WQVH 2ASUB 2ZECA 3ZZ8A 3B8JA 2QXHA 4AG2A 1EZQA 5DP7A 1LPZB 1O32A 3LGTA 1MTWA 4K60A 1P12E 4LZ4B 1TX8A 2QN5T 5E0GA 1H9HE 2PKSC 3SUDA 4ABBA 2GCHG 2XWAA 1AKSB 4XBCA 1BOQA 1VCPA 1O2VA 2QXJA 2QF3A 2PSYA 3SGBE 1OOKB 4TWYA 4JYUH 2J94A 2Z3DA 4LZ1H 2W3IA 1S5SA 2FO9A 2FP7B 3STJA 3MO3A 1PPGE 4ZKRU 1GI7B 5A09A 2ZP0H 2ILNA 1IQGA 3CS7A 4FUGA 1PJPA 1TRMA 3PROA 1GBEA 2O9QA 2OP9A 3MO6A 4O97A 2QA9E 1AU8A 1J16A 6LPRA 2OUAA 3Q00A 4U30A 2UUFB 1GJDB 4D7GA 1GVZA 1BMNH 1BJUA 1V2PT 4VGCC 1P9SA 1TPSA 1L2EA 4DIIH 1W0YH 1FY8E 3GY2A 1GBCA 1GCTB 1PQ8A 5EW2H 1O3JA 1XXFA 4DG4A 4ZHMU 2FLBH 3SU2A 1BTPA 3MMGA 3C27B 2UWLA 1GI8B 1P2KA 2ZA5A 3SU5A 1UCYK 4ZKNU 3NKKA 2F9NA 5JBCS 4DW2U 4YESB 1HAZB 5EPNA 4I8LA 1AKSA 4NZLA 3BSQA 2FWWA 3NZIA 2GZ8A 4JK5A 2Z9IA 6GCHF 3M5NA 2A7JA 1J8AA 4Y8XA 1N8OB 1BT7A 1D6RA 4THNH 5ABWA 1UTPA 4ABAA 4TY7A 1C2IA 2CV3A 1DWEH 1SGDE 2SFAA 1O3IA 1TLDA 3EYDA 1RTKA 4WMFA 2STBE 3NUMA 3RXJA 1TGSZ 2BVXH 3SNAA 1C2MA 4OS7A 1O2UA 1FUJA 3SV2H 4YOGA 1GDNA 1QRWA 1TBQH 1PPFE 1NRSH 1ELFA 2ZDAH 2IJOB 2O8MA 1BJVA 1BZXE 6CHAB 3CS0A 2P8OC 3QWCH 1A5GH 1Z8JB 5HYOA 2ZQ2A 2EA3A 1GBBA 1MTNC 3D49H 2HALA 5GXPA 1C4U2 1W13U 1SL3A 1C1VH 2P94A 1FV9A 1O2YA 1GHAF 2ZHDA 1GBMA 2ZPSA 2QYIA 1HIAA 3HPTB 1EPTA 2Z9GA 1GGDB 2FOGA 4F4OC 1HJAB 3P95A 5FXLA 1LKBA 1NZQH 1BCUH 1D6WA 1PPEE 5TJXA 1A0LA 1V2ST 5B6OA 1F0TA 1UHBB 1KXCA 1QQ4A 1GDQA 4JYVH 2A32A 3MU8A 5EGMA 1C5UA 5EOKA 3OTJE 4X2VA 4CH8B 1ZZZA 4MPUA 5E2OA 2WUBA 1V3XA 3GCNA 3TU7H 1KTTB 3TITA 1Q3XA 3HATH 2HPPH 1KLJH 1O3AA 3RXFA 4ISNA 1LVYA 1EUFA 2BZ6H 2O8WA 1DUAA 2ODQA 3GY7A 1BRCE 4JCNA 4A6LA 1H4WA 2GVFA 3W94A 4K8YA 4OS1A 2UUKB 1P11E 1SHYA 2BXUH 4GHTA 1A46H 1QNJA 1M9UA 1O2MA 1S0QA 4IBLH 1P02A 3BV9B 3L6PA 3UWIA 7GCHG 3OX7U 4X6NA 4ZMAH 4INLA 4RKJB 1EZXC 1O5AB 1H8DH 4UE7H 3V0XA 3RXQA 3S9AA 1GBDA 2LNCA 1CGIE 4X2WA 1V2VT 3RUOA 2XC5A 1GJ5H 2HNTF 1MH0A 1BDAA 1NRNH 1DT2A 5EXMA 1OP8A 1NS3A 1O5GH 1TBZH 2VIDA 3A80A 3TK9A 4DURA 3S0NA 2H9EH 2P16A 1LPKB 1ARCA 1LHCH 1T8LA 2A5KA 3GCOA 3FFGA 3EAJA 3BTHE 4A5TS 2AS9A 1HV7A 1OWIA 1UTQA 5L6NH 1AN1E 2ZWLH 4XBDA 3PO1C 2BYAX 6ESTA 7LPRA 2RG3A 2Q1JA 1E36B 3S9CA 1TMBH 3M3TA 4FU9A 2F9BH 3H5CB 2VWNA 2WUCA 1QGFA 2NU2E 2ZEBA 4CBNA 1HAPH 2J4IA 3STIA 1SGYE 3D65E 2Z9KA 4AFSA 3ZZ9A 3MFJA 1KDQA 2H9HA 1LVMA 2ZPQA 3LKWA 3RM0H 2ULLA 1UTOA 4OGXA 2ZGXH 2ZPRA 3V7TA 2VWLA 2BD9A 2BD8A 3UQVA 1YKTA 2QC2A 3RXTA 1ESAA 2FOFA 1EAUA 4NIVA 2F83A 1SGPE 3AAUA 2NU1E 3TNSA 2SGPE 2XW9A 1E38B 3AVZA 4TPYA 1SMFE 2R0LA 1HAIH 1TX6A 1UK3A 2BD2A 2Y82A 2BD5A 3ODDA 5F03A 3KN2A 5E0HA 3SBKA 2UWPA 1GMCG 2ZGHA 1Y8TA 1MKXH 4MPVA 2BQ7B 2JETB 1O2ZA 3LONA 3SQEE 3BIVH 1P04A 1P8VC 4YO9A 1ORFA 4AOQA 4I32A 1C5XB 3LDXH 3OU0A 1RIWC 5DKMA 4D9RA 5F8XA 4DT7B 3VXEH 1GBLA 1RS0A 1SC8U 4O3TA 1GJAB 3QDZB 1UVOA 5K0HA 4MLFB 2VGCB 1HAVB 3A7TA 8GCHF 1EAXA 2OQUA 4B71A 2ZDVH 3M37A 2ZHEH 3ITIA 5TCCA 4KKDA 1AHTH 1AUJA 1C9TA 1P01A 2ZU1A 4OS6A 3BG8A 3RXUA 1L4ZA 1YLDA 4QT8C 3UNQA 1SHHB 1C2KA 1NFUA 4K1TA 4ISHH 3TJOA 3QZRA 2XBXA 3UNSA 3ZVEA 2VU8E 3M61U 3P8OA 2XNIA 2QXGA 2VH0A 2B5TB 1GL0E 2BLVA 4RN6A 1FAXA 1C1PA 2ESTE 1QBOA 1HXFH 1O30A 1O2OA 1TNKA 4H6TA 3UFAA 2G81E 3ZVAA 1O33A 4UONA 4TPIZ 3G01A 2FOEA 2BM2A 4CRGA 4J2YB 1WCZA 2EI8A 2F9OA 5FHTA 5FX5A 1LPGB 3CP7A 1YPEH 5T6GA 1GI2A 1BRBE 1GDUA 2FOMB 3ZV8A 2PR3A 5FCRA 2CMYA 1YF4A 2BDGA 2Y80A 5C5OA 3RXAA 3ZVGA 3A84A 4Y7BA 4AN7A 1O3LA 2NWNA 2CGAA 1TRYA 1K1MA 1YPMH 3GCTG 8LPRA 1DLKB 3RXGA 1EATA 1AWFH 1O3EA 3A89A 2ZHWH 2BDIA 1DX5M 3URCA 1BRAA 2Z6BD 1FQ3A 3PMBB 1QCPA 3ZZAA 2O8TA 1GMDF 2TPIZ 3IITA 2Z7FE 4YZUA 1KIGH 5E0JA 4I8JA 1Z8RA 1P05A 1TQ0B 3KNXA 3VB5A 4H42U 1MQ5A 3RU4T 1GWAA 1THSH 3NK8A 3UOUA 3KQCA 1HYLA 5FPYA 5HMAA 3U8RH 1RTLA 3MU1A 3L33A 3KCGH 5GCHG 5CE1A 1NRQH 5T6FA 1RGQA 1AIXH 1ELBA 3KL6A 4HTCH 3TGKE 1DSTA 1TX7A 1ESTA 2ZC9H 3NXPA 1IQIA 3L3TA 5DP3A 2DUCA 1QJ7B 1BMAA 1GHWH 2FTLE 3SO3A 1IQFA 4FVBA 5T6DA 5BPEA 3QO6A 2KAIB 4LOYH 1ZJDA 1IQLA 3T62A 2ZU2A 3GICB 5F8TA 2B8OH 1JIRA 1MU6B 1FY1A 3T5FH 1UCYH 1QL8A 1IHSH 2I6QA 3A88A 1O2XA 2V3HH 2NU0E 4DGJA 1Y3UA 1CSOE 4X6PA 2JH6D 5GJ4B 4FUCA 1YCPK 1V2QT 1ZOMA 4NZQA 4YM9A 2BY6X 1TNLA 4CRDA 2WPLS 4X1NU 3RXDA 4DY7B 1QR3E 5LPFA 1QL9A 1DITH 5J4SA 5EPYA 2J92A 1W7XH 3BEFB 1UVTH 2H2ZA 4MDSA 2A4RA 2TGDA 3VGCC 2GDEH 4BAHB 1NFYA 1SGNE 2D8WA 3F1SB 3ZVBA 2A1DB 5EQRA 4AB8A 1OPHB 1H1BA 1ANEA 1EP6A 3LT3A 4MQAA 1XVMA 2A0QB 1G37A 2VH6A 2Y7ZA 2ZCLP 3UQOA 3ZZ5A 3ELAH 4MVNA 3T26A 1IQEA 3A8AA 2ZGBH 1FI8A 4HGCA 3RXOA 3SUGA 2VVCA 2HVXA 5F8ZA 1VITH 2NU4E 4Q7XA 1JWTA 5G4BA 4ABFA 5TCAA 3KQDA 2CJIA 2D26C 2JKHA 2W5EA 2GTBA 2BOKA 1GI6A 1GPZA 2B7DH 1N6YA 1ZPCA 1TGTA 2GZ7A 4NFEA 3TGJE 3EDXB 2ODYB 5ESTE 3T2NA 1TMUH 1L1NA 3RC5A 4ZKOU 3BTME 1O5EH 3E90B 4JZ1A 2OINA 5FPSA 3UUZA 1QHRB 5T3HA 1IQMA 2YOLA 5DJ7A 4ZH8A 1WBGB 3RMLH 2P3TB 1V2OT 1B5GH 2BLOA 1SQTA 2BTCE 1GHBF 1O2GH 2OD3B 4JK6A 4X1RU 1V6DA 2PTCE 1C2DA 3Q3YA 1GCDA 1CA8B 1J17T 5JBBS 1MMJN 1C5YB 3PMAB 3E16B 3BTEE 2Q6DA 1C1WH 1GI0A 4X2XA 1IAUA 1DICA 2A4GA 3AW1A 1V2MT 1A1RA 1SGFG 3HK6B 1JIMA 1ETSH 2XWBI 2Y81A 2AFQB 2JH0D 3TPIZ 1VGCC 2BX4A 1A7SA 4ABGA 4YLUA 1QA7A 1K1JA 1GMHF 2R0KA 1O38A 1OKXA 2GMTC 1GJ8B 2QF0A 4Y6DA 4AFZA 3QUMP 1FN8A 3Q3KA 4RKOB 1BTYA 2W3KA 1NU9A 2J38A 2FTMA 1NESE 2CN0H 4KTCA 3SI4H 4X2YA 3BTDE 1SQOA 1Y3VA 2SNWA 1B7XB 3RMNH 1NT1A 1AB9B 3M3VA 2CXVA 2G4TA 4J1YA 2GV6A 3TNTA 1S6HA 4E7RG 2NU3E 1RFNA 2R2MB 1KYNA 1YCPM 1WQSA 2EEKA 2BQWB 4BXSA 2F9VA 5DK1A 1RD3B 1O37A 1Z8IB 3TK5A 2AMQA 1H9LB 4BTTB 2ZCHP 1FXYA 1LHEH 1ANBA 1W3CA 3RXLA 2AGEX 2ANKH 1FONA 1AFQC 3GY4A 4X1PU 4CREA 3PYHA 1SOZA 1F2SE 1ABIH 5IDKA 4FUEA 1O5BB 4B73A 3VXFH 5A0CA 4HFPB 1CQQA 4OGYA 1K2I1 4CRAA 1C5VA 4R8TB 6GCHG 1PQAA 2ZU5A 2PSXA 2PFEA 3TLOA 4AX9H 1V2RT 3MNSA 2CF9H 3U69H 1C2FA 3PLKA 1ZTKA 1W10U 2AGIX 1G36A 1ELAA 2OTVA 2OC7A 1EOLA 1SQAA 1WSSH 1K1LA 4WMDA 1FLEE 4LK4A 4MNWA 4K8BA 4E7NA 2F91A 2ZFSA 3SJOA 1OWJA 1CE5A 2FM2A 1CHGA 1HIAB 5EQSA 1EPTB 1UTKA 4A1XA 1ETRH 3OY6U 2QIQA 4ISOA 2TBSA 1KLTA 4MNYA 4FUDA 4Y71A 1O3BA 3SI3H 4H4FA 4WMEA 1HAGE 1SB1H 1UJ1A 1ZRBA 3MTYA 5DG6A 4NA7A 3ZZCA 5DP8A 2GCTC 2ZIQH 1MCVA 3KIDU 2SGEE 1GBIA 1F0RA 2FS8A 4JYTA 1O3MA 3PM3A 1F0SA 4NG9H 1GHAG 2PWXA 4D7FA 1P06A 1MU8B 3LPRA 1C1SA 3SNEA 1V2WT 3ZV9A 4DCDA 4NCYA 1DY8A 2QXIA 1DXWA 5GDSH 4Q7ZA 1V2KT 1AVGH 1C2JA 3TJNA 4CRBA 4NSVA 1G32B 3FP7E 1ZJKA 3SU4A 3A8DA 1FNIA 3LOXA 4K3JA 1TMTH 1EXFA 2HPQH 4Y10E 1ZTLA 2A7HA 3T27A 4BAQB 4GUXA 2ZI2H 1BIOA 1CT0E 1K1PA 1UVSH 1YM0A 1ELEE 3M7UA 3MU5A 2BY8X 3GYMA 1TPOA 3H7OA 4ABEA 1C2GA 1GG6B 1DE7H 1HAXB 5HXFA 1ZTJA 1WYKA 1C9PA 1O3CA 1QURH 3GCHB 4CRFA 4X1QU 1CBWC 1D3TB 1J15A 1TBRH 4BTUB 3SHAH 4AFQA 7ESTE 1LO6A 1ZMLA 5DP9A 5K7RA 3H7TA 4MPXA 4I8GA 4WY3A 1SGIB 1THPB 1T32A 3SV6A 3MH6A 3SU3A 2C4FH 1BTZA 1O2RA 2BD4A 1G9IE 2EI7A 5A8YA 1TNJA 4NWLA 3SUEA 1UO6A 3SJKA 1C1OA 1T4VH 4KELA 1P57B 3F6UH 2TGTA 2DE8A 1O3NA 3UWJH 2PKAA 2ZFRH 1ZMNA 2V6NA 1LCYA 1KDQB 2PGQB 1UTNA 4HZHA 4XOJA 1KXAA 3HK3B 1D9IA 1ZHPA 4KTSA 4LXBH 1BQYA 1Z1IA 2VWMA 5F6MA 1VITF 5FPTA 1AZ8A 2VVUA 2BMGB 4JZEH 4B74A 5LPEA 3A87A 5A8XA 3DA9B 2ZDMA 1P10A 2XBVA 3BG4B 3P8NA 1A4WH 1MTSA 2Y5GA 1FN6A 3ATWA 3OYPA 3VPKA 1RJXB 2VWOA 1F0UA 1FIZA 4SGAE 4CHAB 1O34A 3SNDA 1GVLA 1O5CB 3M7QA 4ZKSU 1C5ZB 4CR9A 1A61H 4D76A 1EKBB 2BZAA 1LMWB 2H5CA 2A5IA 1GHZA 1GHXH 3BTGE 1HLTH 3RXVA 1KXBA 1TGCA 2SGAA 4SGBE 1GBAA 3ZZ6A 3QZQA 4WVPE 3MO9A 2CHAC 4XSKU 4GLYA 1AGJA 1CA0B 1UCYE 4GVUA 1O36A 3OSYA 2WYJA 2XXLA 3ENSB 4KP0A 1LHFH 3ZZ3A 1C2HA 4MG3A 1AE8H 4FUBA 4IC6A 1G3DA 3MWIU 3TVJB 1FZZA 1AI8H 1SBWA 3UIRA 5IYTA 3QTOH 1NPMA 1MZDA 4Z6AH 1YCPH 4Z0KA 2TGPZ 3VB7A 2FX6A 3HKJB 2AH4X 4NIXA 4O9VA 1O0DH 3RXIA 1NM6A 1QB9A 3EQ0H 1FY4A 1N1LA 2HRVA 2V35A 4UD9H 1N6XA 1IQHA 2A45B 2R3UA 2A7CA 5ETXA 4KTUA 2ZZUH 3EA9A 5L30H 1C5RA 2BHGA 5EXNA 4XDEA 1A3BH 1HCGA 1H8IH 3FAOA 1L1JA 1DM4B 3BN9A 1P9UA 2BLWA 3F9HA 5LH8A 5DP6A 1MQ6A 3M5OA 2W7SA 2P93A 3C1KA 1KTSB 4O03A 2ZHQH 5E8EH 3D62A 1C1RA 1MBQA 1NTPA 3MH7A 3CENA 1P2JA 1BTUA 2OBOA 1KSNA
chains in the Genus database with same CATH superfamily
3N7OA 1LKAA 8GCHG 1UTMA 2GT8A 4GSOA 4AORA 1BTHH 1HJ8A 4INKA 1T31A 4M7GA 1AFEH 1QJ6B 1Q31A 1ZPBA 1IOEA 4Y76A 1XUFA 1T8NA 3N7DA 3P8GA 1SGTA 4YLQH 5EG4A 1O3KA 3FO8D 1YPKH 1MAYA 3AK5A 1YC0A 2P3FH 2JIZD 1OYQA 2KFWA 1BBRK 1H9IE 1ELCA 3RXHA 1V2NT 1TABE 1XKBC 1BITA 1GBHA 2ZTZA 3KYFA 3A7VA 3BTQE 1K1NA 3BEUA 2ODPA 1QBVH 4Z1MD 1E37B 1HB0B 2VIOA 3ATIA 1SFIA 2FS9A 1WUNH 4ABJA 1EZSC 2FOHA 1QA0A 1TAWA 1EJAA 1ZPZA 1VCWA 2BY7X 2BLQA 3V12A 1DLEA 1A5HA 4WWYA 4AB9A 4B6FA 5GWZA 3B23B 4ABHA 1Z8GA 1O2NA 2RDLA 3VB6A 1MAXA 3MNXA 3E3TA 3M7TA 1Z71A 2ZGCA 1A2CH 3BEIB 1LQDB 2W6JD 3E1XB 2EI6A 1CHOF 2Q6FA 1O2IA 5FCKA 3U9AH 3FOAA 1QTFA 1MKWH 2WINI 1QB1A 1TB6H 3LGIA 1J9CH 2P8OB 2BXTH 1GMDG 1C1QA 4E06H 3UY9A 1SFQB 1TALA 2D2DA 3AASA 1AUTC 4UFGH 2A31A 1LHDH 1KLIH 2QV1A 3RLWH 3SNCA 4ESTE 3F68H 1GCTC 3HGNA 5EU8A 5A0BA 1FPCH 2FYRA 3K9XB 1SLUB 2R3YA 2YNAA 4IGDA 3ATMA 3ZYEA 3PLBA 3UPEA 3FP6E 4YTAA 4NFFA 3E8LA 1DXPA 1DUEA 2FMJA 1WV7H 1HUTH 3K6ZA 3MH4A 3BTTE 1K22H 1VKYA 1A0HB 1HPGA 2OXSA 3U8OH 2O8UA 2ZTXA 3ZZ7A 2F4LA 2ZDKA 4K1SA 3RXCA 1GI3A 3GY6A 4DJZB 4NA8A 1Y3YA 3M35A 4ZHAA 1P2QA 5C3NA 1N8OC 2A4OA 1T8OA 2JH5D 1HNEE 1S81A 5A2MH 2Z3EA 2ZFTA 4XD7D 4E05H 1YBWA 3GCTF 2FEQH 3FANA 1LQEA 1SR5C 1T4UH 4ZAEA 2VVVA 3ZZDA 2OLGA 4IW4E 3S7KB 2A4QA 5KECA 2BOHB 1Z1JA 2H6MA 2XBWA 4A7IB 4UFDH 3U1IB 2V3OH 3S9BA 1OWDA 1TWXB 4GCHF 2XOKD 3VB3A 1L1GA 4AFUA 4X8VH 2Y7XA 1YPGH 4Q2KA 1ZLRA 3RU4E 1DOJA 1GI1A 2PV9B 2W26A 1XUKA 2F9PA 1PYTD 3P92A 4ISIH 3U8TH 5A8ZA 3DFJA 3IG6B 3TJVA 3FKSD 2Q6GA 6CHAC 1EQ9A 5A0AE 5JYIA 1YPLH 3RXBA 2XTTB 2EC9H 4P00A 5GPIB 1BMMH 1KXDA 1ZSKA 2LPRA 3U28C 1P3CA 4RSPA 4BAOB 1H8ED 3LC5A 4XE4A 1BHXF 4BAMB 3UR6A 3QX5H 1ANDA 2ZU3A 1HBTH 1S6LA 1GGDC 1MUEB 1HJAC 3EA8A 3MNBA 4K69A 1JXPA 1GBJA 1RTFB 1Z6EA 2BX3A 2ZGJA 1F92A 1IQKA 4RT1A 3RC6A 1ZGVA 2C93B 1HJ9A 1DS2E 2XBYA 4FU7A 1SVPA 2AHME 3PO1B 3PRBA 1AE5A 1K9OE 3PMHB 3SJIA 4AYYB 1GL1A 1K1OA 1YGCH 4I86A 1NY22 3DD2H 1W14U 1BBRE 1MD8A 1QY6A 1INCA 3R3GB 1ZR0A 1BUIA 4NSYA 2PUXB 2XYAA 3Q76A 2FOAA 5LGOA 4ZUHA 4Y0YE 1TYNA 4AG1A 4KGAA 1V2TT 1HAYB 1MZAA 3HGPA 3LH1A 1ELTA 1GHBG 1FIWA 3ATLA 3LH3A 5I46H 3TH2H 2AEIH 2BD3A 3E0NB 3B9FH 2AERH 3GY5A 3O8BA 1QRZA 4K5ZA 5EXLA 8ESTE 1XUIA 1O35A 2GDDA 2BQ6B 2IPHA 5DO4H 1AO5A 1XVOA 1D3QB 4INHA 1GJCB 1P2OA 5AHGH 3GISB 3NWUA 2Y6TA 2G5NA 1SI5H 2FI3E 5J4QA 2VJ1A 3W1EA 1MCTA 4WXIA 4WJG2 5DPAA 2FX4A 2C8ZB 2KCOA 3N7EA 1NU7B 2P95A 1ZHMA 1O2KA 2OC8A 3RXRA 5EQQA 2A5AA 1J14A 4B2BA 2GZ9A 1VR1H 4ZHLU 1XUJA 3RXPA 1GMHG 5AF9H 4CRCA 1W12U 1W11U 1FY5A 2ZHFH 2SGQE 3ZZ4A 1O2LA 1CT2E 1G3BA 1XXDA 1OXGA 1MKWK 1SLXB 3RDZA 3EE7A 3TH4H 1RIWB 2AGGX 3UREA 1JRTA 1P03A 1TGBA 5CHAB 3K6YA 3OY5U 3FZDA 1UK2A 1Y5AT 1OP2A 2PTNA 2ZTYA 3F9GA 1YPHE 1PPCE 2HOBA 1YPJH 2ZG0H 3GY8A 1EX3A 3SU0A 2TIOA 4B2CA 2C8XB 3NCLA 2ALPA 2BDHA 1YWUA 4NA9H 1D3PB 1TOMH 2I6SA 2WZQA 4Q80A 1C2EA 5DGJA 3I29A 4UFFH 4YT7H 4FOUC 1ELVA 2GX4A 1ZYOA 4Y7AA 3TGIE 2FOCA 1P3EA 2ANMH 3BTFE 2W7UA 5AFYH 3SUFA 1OHHD 3M5MA 2ZO3H 1NFWA 3DT0H 3UR9A 2GGVB 3A86A 1EP5A 2GP9B 2OBQA 1W0ZU 4OS2A 1FAKH 3SV7A 1TONA 1O3FA 3GOVB 3RXSA 1F5LA 4NIYA 1C1TA 1C5WB 1XM1A 2F3CE 3M5LA 4MPWA 3RMMH 3VEQB 4D9QA 4JMYA 1OP0A 2GCHF 4Y11E 1QRXA 3GYLB 4O3UA 1TPAE 4IN2A 5DP4A 1G30B 2ANWA 2DE9A 1AVXA 1DANH 1PPZA 1EASA 1G2LA 1HAHH 3V13A 1GBTA 5C2ZA 2H9TH 2JETC 1C4V2 1LTOA 4DIHH 2G55A 2ZFQH 1TE0A 1C5MD 2Y5HA 3SNBA 4AYVB 2FOBA 4FVDA 5FAHA 4ZXXH 4Y0ZE 1PFXC 4FUHA 2BVRH 2VGCC 4WH8A 5PTPA 1GI9B 1UTJA 1EJMA 2AYWA 4A1VA 1TOCB 2G52A 1YLNA 4ISLA 1A0JA 3BF6H 3ZYDA 1ZGIA 1BB0B 2Z9JA 3E91A 1SQRA 1S0RA 4CH2B 3URDA 1ESBA 1WTHD 1CO7E 3VB4A 1QB6A 2A2QH 3KQBA 3QTVH 1AQ7A 2ZKSA 1QIXB 1EAIA 3FZZA 1AMHA 1ETTH 1EOJA 3SZNA 1DVAH 4NWKA 1C5NH 3SU1A 1SGQE 4AZ2B 4I8KA 4GHQA 9LPRA 3IWMA 1FPHH 3LGUA 3QLPH 1NC6A 1YPHC 2SGFE 1HFDA 2FODA 4IN1A 1O2PA 1WOFA 1O2WA 3SOSA 1FDPA 5C1XA 3QN7A 1IQJA 1RRKA 3RMOH 1WU1A 2TGAA 1S6FA 3W95A 1EAWA 2R2WU 1CU1A 1BBRH 1V2LT 3Q3XA 2BB4A 4U2WA 3GY3A 4UDWH 2PKAB 1DWCH 1PPHE 2XCNA 5T1VA 2CF8H 1E35B 2K8IA 1TPPA 1WTGH 1C1NA 1LVOA 2VIQA 4BOHA 1Z7KA 5EODA 4BTIB 2VIWA 4TY6A 3KHVA 3MNCA 3SHCH 5I25A 3A7ZA 3V3MA 1NRRH 2VNTA 1Y5BT 3VGCB 1KY9A 3M3SA 2PUQH 1EZUC 1TIOA 9ESTA 1THRH 1VJ9U 3PV5A 1K28D 5CHBA 4FUIA 3VFEA 1GJBB 1UK4A 2FPZA 4YOJA 2Y5FA 2ZCKP 3LJOA 1X7AC 2OQ5A 3UOPA 3PTNA 4HI3A 1O5FH 2BD7A 2V0BA 1S83A 2XRCA 1ZSJA 1HXEH 1TNGA 5C0UA 1BRUP 3P8FA 4F55A 3MU4A 1HGTH 1TA2A 1EJNA 8KME2 1C5OH 1V2JT 1L0ZA 3FVFB 5EIYA 1VITG 1NN6A 1Q2WA 1O2HA 4TYDA 3EE0B 3PB1E 1CVWH 2HWLB 1O3PB 3KQEA 2IN2A 4ASHA 3RXKA 1IQNA 4IMQA 4YOIA 3U98H 3UNRA 3A83A 2ANYA 3A7YA 3GDUA 3TJUA 3SN8A 1P09A 2XC0A 4X0WU 4Y8ZA 2OC0A 2C90B 4Y79A 2FESH 1BTWA 2ZDNA 2C8YB 5JPMH 1CGJE 2RDEA 1SG8B 1UW7A 3MYWA 1C1UH 2B9LA 3F9EA 4K2YA 3TH3H 5C1UA 3A81A 1IHTH 3OE7D 4AC9A 3SV9A 3BTWE 2FI4E 2FLRH 2J97A 5HIZA 3U1JB 1WAYB 1ZHRA 3S7HB 1UHBA 4FXGH 4A92A 2QF4A 1JBUH 1ARBA 1S82A 4JZIA 3TIUA 1XUHA 2FZZA 1HDTH 5AFZH 3T28A 2ZU4A 1G3EA 7GCHF 1ACBE 2BDAA 2VINA 3DCLA 4TT3D 2J5UA 1QJ1B 2QCYA 2UWOA 4Q63A 2FYQA 2BY9X 2WV5A 1O5DH 1VGCB 1C1MA 3P17H 1MBMA 5BRRE 4OS4A 3S69A 2B0FA 1A5IA 3LC3A 2GMTB 3O8CA 3SV8A 1P0SH 2WPIS 3Q77A 2AIPA 1YYY1 4ABIA 1TFXA 2SGDE 1QL7A 1VZQH 4X8TH 3A85A 4Y8YA 2F9UA 1A3EH 2FXRA 2IJD1 3RXEA 5EW1H 3DHKH 2PKSB 2RCEA 2G5VA 3P6ZB 1OSSA 1LDTT 1QQUA 2PGBB 3E6PH 1O39A 1EB2A 3GS9A 2ZF0H 3RXMA 4M9FA 1SPJA 1HRTH 1TQ7B 3P70B 1TRNA 1T8MA 5DSFA 3LGVA 2VIPA 3TK6A 5JBTA 3DUXH 1ABJH 1SGEE 4U32A 3SJ9A 2J2UA 3PWBA 3KGPA 5C17A 2Z94A 3KF2A 1UTLM 3ODFA 3PWCA 1AFQB 1C5SA 2J9NA 1SLVB 4FUFA 1KXFA 4VGCB 1DY9A 1F5RA 1SGCA 2WYGA 5C5NA 1GJ4H 4B2AA 1T7CA 1O3GA 3OTPA 1PQ7A 4XRNA 1VJAU 3SW2B 1OX1A 2AMPA 3ZVCA 5FBIA 1KXEA 3A82A 3LGWA 1Y3WA 1JMOH 2HNTE 4I7YH 1XUGA 2WV4A 4NGAH 3RLYH 3I77A 4BANB 2WPHS 4PROA 1Y3XA 4WH6A 1SOTA 2WPKS 2BDCA 1C4Y2 1GJ9B 2BY5X 3GDVA 2Z9LA 1GMCF 5CHAC 4X8UH 2XC4A 1AD8H 1CT4E 2P3UB 2WPJS 1UMAH 3M36A 1BMLA 5C94A 1C5QA 1FY3A 2G51A 5CDFE 5KEDA 4ZXYH 5HM9A 1LHGH 1V2UT 2O8LA 3O8DA 3PV4A 1AB9C 1CHOG 1K1IA 1P2MA 3MOCA 1G3CA 1E0FD 5AVDA 1BHXB 4ABDA 4XBBA 3RC4A 3OEHD 4X6OA 2GCTB 1C5TA 4DOQA 1SSXA 4AGJA 1GHVH 1UVPA 1ZMJA 4X6MA 3EGKH 2ZFPH 1NBMD 2VBCA 2XCFA 3QK1A 1NBME 3SU6A 5JB9S 1TNHA 4X8SH 2GD4B 2L74A 1W2KH 4GPGA 4UEHH 4K1EA 2M2AA 3E0PB 1MABB 2SNVA 3SQHE 4D8NA 2TRMA 4NIWA 1MTNB 2J95A 1UVUH 3MI4A 1TGNA 1C5LH 1AVWA 1HAVA 1OYTH 3LIWA 3ZVFA 1DWBH 1L4DA 2QGRA 1F5KU 2R9PA 2PLXA 4DVAU 2AMDA 1O2SA 1OS8A 3ZVDA 1B0EA 1SGRE 1P2IA 3AAVA 3ZZBA 5EJLA 1O3OA 2BDBA 2FI5E 1HAOH 4IMZA 1P2NA 3MU0A 1GBFA 1NO9H 3AW0A 3T29A 1XKAC 3R0FA 1O2QA 2PHBA 4MNVA 1MTVA 3FP8E 4ZROA 1B0FA 5C20A 2ZQ1A 1GJ6A 1CBWB 1EPTC 3UB0A 1YLCA 1DWDH 1S84A 1OWHA 3K2UA 2G8TA 4GCHG 3F9FA 1D4PB 5JDUB 4I31A 4IS5A 4OS5A 1NROH 4UFEH 1QBNA 5FX6A 2KR7A 1G2MA 2PW8H 2HNTC 1ANCA 3PLPA 3WW7A 1BA8B 1FMGA 1GVKB 3BTKE 1C5PA 2JJ1D 3PMJA 3I78A 5DP5A 1BTXA 3RU4D 2FIRH 2EY4C 2H1UA 2C3SA 3QGJA 5E2PA 3KEEA 1CGHA 2HLCA 1GHYH 5GCHF 1XMNB 2RA0A 2IOTA 2ALVA 4JZFH 3SORA 5FBEA 3JZ2B 3WY8A 1GJ7B 1ZRKA 2UUYA 5KGOA 3JZ1B 3LJJA 2OCVB 3UTUH 3ESTA 1O2JA 2W6ID 7KMEH 1BMFD 1TNIA 3RM2H 4MTBA 1D3DB 1DFPA 2THFB 5H4IB 1O2TA 1DSUA 1GI4A 4JZDH 1AY6H 2KCPA 1MD7A 4BXWA 4CBOA 2FDAA 2QAAA 4IC5A 1NRPH 3SJ8A 3SYJA 1O3DA 3K65B 4B75A 4BNRA 5C67A 1O3HA 1ELGA 1LVBA 1VCQA 2OC1A 4XFQA 4CR5A 5F53A 2J34A 1QFKH 2YMSC 1GG6C 1F7ZA 2GT7A 2CHAB 2H5DA 2STAE 2VB0A 4TWWA 5JBAS 2HVYB 2V7QD 3QGNB 3A8BA 1DDJA 2RA3A 1Y5UT 3GCHC 2M5TA 1PQ5A 1E34B 5LPRA 3T25A 1MKXK 4FUJA 3ATKA 2ZNKH 2KAIA 1EB1H 2ZFFH 4I8HA 4X1SU 2BDYA 5CMXH 4A1TA 1YP9A 3LGYA 1K21H 1Y59T 1ID5H 2K1QA 4H6SB 1RXPA 5ESBA 3GDSA 1PPBH 2A2XH 2Z3CA 4WXVA 1JRSA 1AZZA 2BVSH 1C2LA 2GKVE 5L2YH 3O8RA 1EFRD 3MHWU 2QY0B 2WPMS 1OWKA 2D1JA 1FJSA 4YT6H 1XX9A 1GBKA 2CK3D 1SGFA 1Z6JH 3EA7A 4MNXA 3A8CA 3BIUH 1GI5A 1TA6A 4WF8A 3SGQE 4AGKA 4U01A 3HKIB 1MTUA 5HM2A 2G00A 2KCYA 2AIQA 2GV7A 5L2ZH 1U6QA 1S85A 3BG4C 4B76A 1AWHB 1SLWB 3A7WA 2G4UA 2VIVA 3SZEA 4CHAC 3RP2A 2P59A 3MH5A 1NFXA 5GIBA 5JB8S 4I33A 1DPOA 3PTBA 3D23A 1SKYE 1W8BH 2UUJB 3LU9B 1O31A 1OWEA 4FU8A 2HGTH 2C8WB 3A7XA 1JOUB 4F49A 4R0IA 3NPSA 2ZDLA 1ZSLA 3DFLA 3SGAE 1CA0C 4GAWA 4BAKB 1W7GH 5C1YA 4FETA 5SGAE 4Q7YA 2WHXA 5HGGA 1ELDE 2YNBA 4B1TA 1PYTC 1WQVH 2ASUB 2ZECA 3ZZ8A 3B8JA 2QXHA 4AG2A 1EZQA 5DP7A 1LPZB 1O32A 3LGTA 1MTWA 4K60A 1P12E 4LZ4B 1TX8A 2QN5T 5E0GA 1H9HE 2PKSC 3SUDA 4ABBA 2GCHG 2XWAA 1AKSB 4XBCA 1BOQA 1VCPA 1O2VA 2QXJA 2QF3A 2PSYA 3SGBE 1OOKB 4TWYA 4JYUH 2J94A 2Z3DA 4LZ1H 4B6EA 2W3IA 1S5SA 2FO9A 2FP7B 3STJA 3MO3A 1PPGE 4ZKRU 1GI7B 5A09A 2ZP0H 1E1RD 2ILNA 5DN6D 1IQGA 3CS7A 4FUGA 1PJPA 1TRMA 3PROA 1GBEA 2O9QA 2OP9A 3MO6A 4O97A 2QA9E 3F2FA 1AU8A 2OK5A 1J16A 6LPRA 2OUAA 3Q00A 4U30A 2UUFB 1GJDB 4D7GA 1GVZA 1BMNH 1BJUA 1V2PT 4VGCC 1P9SA 1TPSA 1L2EA 4DIIH 1W0YH 1FY8E 3GY2A 1GBCA 1GCTB 1PQ8A 5EW2H 1O3JA 1XXFA 4DG4A 4ZHMU 2FLBH 3SU2A 1BTPA 3MMGA 2QE7D 3C27B 2UWLA 1GI8B 1P2KA 2ZA5A 3SU5A 1UCYK 4ZKNU 3NKKA 2F9NA 5JBCS 2WPDD 4DW2U 4YESB 1HAZB 5EPNA 4I8LA 2J98A 1AKSA 4NZLA 3BSQA 2FWWA 3NZIA 2GZ8A 4JK5A 2Z9IA 6GCHF 3M5NA 2A7JA 1J8AA 4Y8XA 1N8OB 1BT7A 1D6RA 4THNH 5ABWA 1UTPA 3WWBA 4ABAA 4TY7A 1C2IA 2CV3A 1DWEH 1SGDE 2SFAA 1O3IA 1TLDA 3EYDA 1RTKA 4WMFA 2STBE 3NUMA 3RXJA 1TGSZ 2BVXH 3SNAA 1C2MA 4DT4A 4OS7A 1O2UA 1FUJA 3SV2H 4YOGA 1GDNA 1QRWA 1TBQH 4ACBA 1PPFE 1NRSH 1ELFA 4ZCNA 2ZDAH 2IJOB 2O8MA 1BJVA 1BZXE 6CHAB 3CS0A 2P8OC 3QWCH 1A5GH 1Z8JB 5HYOA 2ZQ2A 2EA3A 1GBBA 1MTNC 3D49H 2HALA 5GXPA 1C4U2 1W13U 1SL3A 1C1VH 2P94A 1FV9A 1O2YA 1WXRA 1GHAF 2ZHDA 1GBMA 2ZPSA 2QYIA 4RI0A 1HIAA 3HPTB 1EPTA 2Z9GA 1GGDB 2FOGA 4F4OC 1HJAB 3P95A 5FXLA 1LKBA 1NZQH 1BCUH 1D6WA 1PPEE 5TJXA 1A0LA 1V2ST 5B6OA 1F0TA 1UHBB 1KXCA 1QQ4A 4ACAA 1GDQA 4JYVH 2A32A 3MU8A 5EGMA 1C5UA 5EOKA 3OTJE 4X2VA 2LELA 4CH8B 1ZZZA 4MPUA 5E2OA 2WUBA 1V3XA 3GCNA 3TU7H 1KTTB 3TITA 1Q3XA 3HATH 4F48B 2HPPH 1KLJH 1O3AA 3RXFA 4ISNA 2JJ2D 1LVYA 1EUFA 2BZ6H 2O8WA 1DUAA 2ODQA 3GY7A 1BRCE 4JCNA 4A6LA 1H4WA 2GVFA 3W94A 4K8YA 2PP6A 4OS1A 4TSFD 2UUKB 1P11E 1SHYA 2BXUH 2GJGA 4GHTA 1A46H 1QNJA 1M9UA 1O2MA 1S0QA 4IBLH 1P02A 1K0HA 3BV9B 3L6PA 3UWIA 7GCHG 3OX7U 4X6NA 4ZMAH 4INLA 4RKJB 1EZXC 1O5AB 1H8DH 4UE7H 3V0XA 3RXQA 3S9AA 4YXWD 1GBDA 2LNCA 1CGIE 4X2WA 1V2VT 3RUOA 2XC5A 1GJ5H 2HNTF 1MH0A 1BDAA 1NRNH 1DT2A 5EXMA 1OP8A 1NS3A 1O5GH 1TBZH 2VIDA 3A80A 3TK9A 4DURA 3S0NA 2H9EH 2P16A 1LPKB 2KX4A 1ARCA 1LHCH 1T8LA 2A5KA 3GCOA 3FFGA 3EAJA 3BTHE 4A5TS 2AS9A 1HV7A 1OWIA 1UTQA 5L6NH 1AN1E 2ZWLH 4XBDA 3PO1C 2BYAX 6ESTA 7LPRA 2RG3A 2Q1JA 1E36B 3S9CA 1TMBH 3M3TA 4FU9A 2F9BH 3H5CB 2VWNA 2WUCA 1QGFA 2NU2E 2ZEBA 4CBNA 1HAPH 2J4IA 3STIA 1SGYE 3D65E 2Z9KA 4AFSA 3ZZ9A 3MFJA 1KDQA 2H9HA 1LVMA 2ZPQA 4HG6A 3LKWA 3RM0H 2ULLA 1UTOA 4OGXA 2ZGXH 2ZPRA 3V7TA 2VWLA 2BD9A 2BD8A 3UQVA 1YKTA 2QC2A 3RXTA 1ESAA 1W0KD 2FOFA 1EAUA 4NIVA 2F83A 1SGPE 3AAUA 2NU1E 3TNSA 2SGPE 2XW9A 5FL7D 1E38B 3AVZA 4TPYA 1SMFE 2R0LA 1HAIH 1TX6A 1UK3A 2BD2A 2Y82A 2BD5A 3ODDA 5F03A 3KN2A 5E0HA 1COWD 3SBKA 2UWPA 1GMCG 2ZGHA 1Y8TA 1MKXH 4MPVA 2BQ7B 2JETB 1O2ZA 3LONA 3SQEE 3BIVH 1P04A 1P8VC 4YO9A 1ORFA 4AOQA 2EQNA 4I32A 1C5XB 3LDXH 3OU0A 1RIWC 5DKMA 4P02A 4D9RA 5F8XA 4DT7B 3VXEH 1GBLA 1RS0A 1SC8U 4O3TA 1GJAB 3QDZB 1UVOA 5K0HA 4MLFB 2VGCB 3VG8A 1HAVB 3A7TA 8GCHF 1EAXA 2OQUA 4B71A 2ZDVH 3M37A 2ZHEH 3ITIA 5TCCA 4KKDA 1AHTH 1AUJA 1C9TA 3NRLA 1P01A 2ZU1A 4OS6A 3BG8A 3RXUA 1L4ZA 1YLDA 4QT8C 3UNQA 1SHHB 1C2KA 1NFUA 3DSGA 4K1TA 4ISHH 3TJOA 3QZRA 2XBXA 3OFND 3UNSA 3ZVEA 2VU8E 3M61U 3P8OA 2XNIA 2QXGA 2VH0A 2B5TB 1GL0E 3KQ5A 2BLVA 4RN6A 1FAXA 1C1PA 5HIYA 2ESTE 1QBOA 1HXFH 1O30A 2YMSD 1O2OA 1TNKA 4H6TA 3UFAA 2G81E 3ZVAA 1O33A 4UONA 4TPIZ 3G01A 2FOEA 3ZIAD 2BM2A 4CRGA 4J2YB 1WCZA 2EI8A 2F9OA 5FHTA 5FX5A 1LPGB 3CP7A 1YPEH 5T6GA 1GI2A 1BRBE 1GDUA 2FOMB 3ZV8A 2PR3A 5FCRA 2CMYA 1YF4A 2BDGA 2Y80A 5C5OA 3RXAA 3ZVGA 3A84A 4Y7BA 4AN7A 1O3LA 2NWNA 2CGAA 1TRYA 1K1MA 1YPMH 3GCTG 8LPRA 1DLKB 3RXGA 1EATA 1AWFH 1O3EA 3A89A 2ZHWH 2BDIA 1DX5M 3URCA 1BRAA 2Z6BD 1FQ3A 3PMBB 1QCPA 3ZZAA 2O8TA 1GMDF 2TPIZ 3IITA 2Z7FE 2KM0A 3N99A 4YZUA 1KIGH 5E0JA 4I8JA 5EJ1A 1Z8RA 1P05A 1TQ0B 3KNXA 3VB5A 4H42U 1MQ5A 3RU4T 1GWAA 1THSH 3NK8A 3UOUA 3KQCA 1HYLA 5FPYA 5HMAA 3U8RH 1RTLA 3MU1A 2V3MA 3KCGH 3L33A 5GCHG 1NRQH 5CE1A 5T6FA 1RGQA 1AIXH 1ELBA 3KL6A 4HTCH 3TGKE 1DSTA 1TX7A 1ESTA 2ZC9H 3NXPA 1IQIA 3H09A 3FN8A 2DUCA 3L3TA 5DP3A 1QJ7B 1BMAA 1GHWH 2FTLE 3SO3A 1IQFA 4FVBA 5T6DA 5BPEA 3QO6A 2KAIB 4LOYH 1ZJDA 1IQLA 3T62A 2ZU2A 3GICB 5F8TA 2B8OH 1JIRA 1MU6B 1FY1A 3UAIC 3T5FH 1UCYH 1QL8A 1IHSH 2I6QA 3A88A 1O2XA 2V3HH 2NU0E 4DGJA 1Y3UA 1CSOE 4X6PA 2JH6D 5GJ4B 4FUCA 1YCPK 1V2QT 1ZOMA 4NZQA 4YM9A 2BY6X 1TNLA 4CRDA 2WPLS 3KYGA 4X1NU 3RXDA 4Q4LA 4DY7B 1QR3E 5LPFA 1QL9A 1DITH 5J4SA 5EPYA 2J92A 1W7XH 3BEFB 1E1QD 1UVTH 2H2ZA 2A4RA 4MDSA 2TGDA 3VGCC 2GDEH 4BAHB 1NFYA 1SGNE 2D8WA 3F1SB 3ZVBA 2A1DB 5EQRA 5C0TA 4AB8A 1OPHB 1H1BA 1ANEA 1EP6A 3LT3A 4MQAA 1XVMA 2A0QB 5GNDA 1G37A 5B6LA 2VH6A 2Y7ZA 2ZCLP 3UQOA 3ZZ5A 3ELAH 4MVNA 3T26A 1IQEA 3A8AA 2ZGBH 1FI8A 4HGCA 3RXOA 3SUGA 2VVCA 2HVXA 5F8ZA 1VITH 2NU4E 3F2GA 2KCAA 4Q7XA 1JWTA 5G4BA 4ABFA 5TCAA 3KQDA 2CJIA 2D26C 2JKHA 2W5EA 2GTBA 2BOKA 2IPQX 1GI6A 1GPZA 2B7DH 1N6YA 1ZPCA 1TGTA 2GZ7A 4NFEA 3TGJE 3EDXB 2ODYB 5ESTE 3T2NA 1TMUH 1L1NA 3RC5A 4ZKOU 3BTME 1O5EH 3E90B 4JZ1A 2OINA 5FPSA 3UUZA 1QHRB 5T3HA 1IQMA 2YOLA 5DJ7A 4ZH8A 1WBGB 3RMLH 2P3TB 1V2OT 1B5GH 2BLOA 1SQTA 2BTCE 1GHBF 1O2GH 2OD3B 4JK6A 4X1RU 1V6DA 2PTCE 1C2DA 3Q3YA 1GCDA 1CA8B 1J17T 5JBBS 1MMJN 1C5YB 3PMAB 3E16B 3F3BA 3BTEE 2Q6DA 1C1WH 1GI0A 4X2XA 1IAUA 3DSOA 1DICA 2A4GA 3AW1A 1V2MT 1A1RA 1SGFG 2JDID 1JIMA 2KZ4A 3HK6B 1ETSH 2XWBI 2Y81A 2AFQB 2JH0D 3TPIZ 1VGCC 2BX4A 3OAAD 2L6OA 1A7SA 1E79D 4ABGA 4YLUA 1QA7A 1K1JA 1GMHF 2R0KA 1O38A 1OKXA 2GMTC 2RFKC 1GJ8B 2QF0A 4Y6DA 4AFZA 1FX0B 3QUMP 1FN8A 3Q3KA 4RKOB 1BTYA 2W3KA 1NU9A 2J38A 2FTMA 1NESE 2CN0H 4KTCA 3SI4H 4X2YA 3BTDE 1SQOA 1Y3VA 2SNWA 1B7XB 1YY3A 3RMNH 1NT1A 2J98B 1AB9B 3M3VA 2CXVA 2G4TA 4J1YA 2GV6A 3TNTA 1S6HA 4E7RG 2NU3E 1RFNA 2R2MB 1KYNA 1YCPM 1WQSA 2EEKA 2BQWB 4BXSA 2F9VA 5DK1A 1RD3B 1O37A 1Z8IB 3TK5A 2AMQA 1H9LB 4BTTB 2ZCHP 1FXYA 1LHEH 1ANBA 1W3CA 3RXLA 2AGEX 2ANKH 1FONA 1AFQC 3GY4A 4X1PU 4CREA 3PYHA 1SOZA 1F2SE 1ABIH 5IDKA 4FUEA 1O5BB 4B73A 3VXFH 5A0CA 4HFPB 1CQQA 4OGYA 1K2I1 4CRAA 1C5VA 4R8TB 6GCHG 1PQAA 2ZU5A 2PSXA 2PFEA 3TLOA 4AX9H 1V2RT 3MNSA 2CF9H 3U69H 1C2FA 3PLKA 1ZTKA 1W10U 2AGIX 1G36A 1ELAA 2OTVA 2QF5A 2OC7A 1EOLA 1SQAA 1WSSH 1K1LA 4WMDA 1FLEE 4LK4A 4MNWA 4K8BA 4E7NA 2F91A 2XNDD 2ZFSA 3SJOA 1OWJA 1CE5A 2FM2A 1CHGA 1HIAB 5EQSA 1EPTB 1UTKA 4A1XA 5HKKD 3F2HA 1ETRH 3OY6U 2QIQA 4ISOA 2TBSA 1KLTA 4MNYA 4FUDA 4Y71A 1O3BA 3SI3H 4H4FA 4WMEA 3OEED 1HAGE 1SB1H 1UJ1A 1ZRBA 3MTYA 5DG6A 4NA7A 3ZZCA 5IK2D 5DP8A 2GCTC 2ZIQH 1MCVA 3KIDU 2SGEE 1GBIA 1F0RA 2FS8A 4JYTA 1O3MA 3PM3A 1F0SA 4NG9H 1GHAG 2PWXA 5EJZA 4D7FA 1P06A 1MU8B 3LPRA 1C1SA 3SNEA 1V2WT 3ZV9A 4DCDA 4NCYA 1DY8A 2QXIA 1DXWA 5GDSH 4Q7ZA 1V2KT 1AVGH 1C2JA 3TJNA 4CRBA 4NSVA 1G32B 3FP7E 1ZJKA 3SU4A 3MQKC 3A8DA 1FNIA 3LOXA 4K3JA 1TMTH 1EXFA 2HPQH 4Y10E 1WDIA 1ZTLA 2A7HA 3T27A 4BAQB 4GUXA 2ZI2H 1BIOA 1CT0E 1K1PA 1UVSH 1YM0A 1ELEE 3M7UA 3MU5A 2BY8X 3GYMA 1KMHB 1TPOA 3H7OA 4ABEA 1C2GA 2YMSB 1GG6B 1DE7H 1HAXB 5HXFA 1ZTJA 1WYKA 1C9PA 2K0QA 1O3CA 1QURH 3GCHB 4CRFA 4X1QU 1CBWC 1D3TB 1J15A 1TBRH 4BTUB 3SHAH 4AFQA 7ESTE 1LO6A 1ZMLA 5DP9A 5K7RA 3H7TA 4MPXA 4I8GA 4WY3A 1SGIB 1THPB 1T32A 3WWFA 3SV6A 3PV2A 1QZ8A 3MH6A 3SU3A 2C4FH 1BTZA 1O2RA 2BD4A 1G9IE 2EI7A 5A8YA 1TNJA 4NWLA 3SUEA 2WSSD 1UO6A 3SJKA 1C1OA 1T4VH 4KELA 1P57B 3F6UH 2TGTA 2DE8A 1O3NA 2WV9A 2PKAA 3UWJH 2ZFRH 4ASUD 1ZMNA 2V6NA 1LCYA 1KDQB 2LP6A 1UTNA 2PGQB 4HZHA 4XOJA 1KXAA 3HK3B 3F0OA 1D9IA 1ZHPA 4KTSA 1W0JD 4LXBH 1BQYA 1Z1IA 2VWMA 5F6MA 1VITF 5FPTA 1AZ8A 2VVUA 2BMGB 4JZEH 4B74A 5LPEA 3A87A 2F43B 5A8XA 3DA9B 2ZDMA 1P10A 2XBVA 3BG4B 4RT0A 3P8NA 1A4WH 1MTSA 2Y5GA 1FN6A 3ATWA 3OYPA 3VPKA 1RJXB 2VWOA 1F0UA 1FIZA 4SGAE 4CHAB 1O34A 3SNDA 1GVLA 1O5CB 1H8HD 3M7QA 4ZKSU 1C5ZB 4CR9A 1A61H 4D76A 1EKBB 2BZAA 2H5CA 1LMWB 2A5IA 1GHZA 1GHXH 3BTGE 1HLTH 3RXVA 4OM9A 1KXBA 1TGCA 2SGAA 4SGBE 1GBAA 3ZZ6A 3QZQA 4WVPE 3MO9A 2CHAC 4XSKU 4GLYA 1AGJA 1CA0B 1UCYE 4GVUA 1O36A 3OSYA 2WYJA 2XXLA 3ENSB 4KP0A 1LHFH 3ZZ3A 1C2HA 4MG3A 1AE8H 4FUBA 4IC6A 1G3DA 3MWIU 3TVJB 1FZZA 1AI8H 1SBWA 3UIRA 5IYTA 3QTOH 1NPMA 1MZDA 3DSPA 4Z6AH 2HLDD 1YCPH 4Z0KA 2TGPZ 3VB7A 2FX6A 3HKJB 2AH4X 4NIXA 4O9VA 1O0DH 3RXIA 3F0PA 1NM6A 1QB9A 3EQ0H 1FY4A 1N1LA 2HRVA 2V35A 4UD9H 3CNRA 1N6XA 1IQHA 2A45B 2R3UA 2A7CA 5ETXA 4KTUA 2ZZUH 3EA9A 5L30H 1C5RA 2BHGA 5EXNA 4XDEA 1A3BH 3PRDA 1HCGA 1H8IH 3FAOA 1L1JA 1DM4B 3BN9A 1P9UA 2BLWA 3F9HA 5LH8A 5DP6A 1MQ6A 3M5OA 2W7SA 2P93A 3C1KA 1KTSB 4O03A 2ZHQH 5E8EH 3D62A 1C1RA 1MBQA 1NTPA 3MH7A 3CENA 1P2JA 1BTUA 2OBOA 1KSNA
chains in the Genus database with same CATH topology
3N7OA 1LKAA 8GCHG 1UTMA 2GT8A 4GSOA 4AORA 1BTHH 1HJ8A 4INKA 1T31A 4M7GA 1AFEH 1QJ6B 1Q31A 1ZPBA 1IOEA 4Y76A 1XUFA 1T8NA 3P8GA 1SGTA 4YLQH 5EG4A 1O3KA 1YPKH 1MAYA 1YC0A 2P3FH 1OYQA 1BBRK 1H9IE 1ELCA 3RXHA 1V2NT 1TABE 1XKBC 1BITA 1GBHA 2ZTZA 3A7VA 3BTQE 1K1NA 3BEUA 2ODPA 1QBVH 1E37B 1HB0B 2VIOA 3ATIA 1SFIA 2FS9A 1WUNH 4ABJA 1EZSC 2FOHA 1QA0A 1TAWA 1EJAA 1ZPZA 1VCWA 2BY7X 2BLQA 3V12A 1DLEA 1A5HA 4WWYA 4AB9A 5GWZA 3B23B 4ABHA 1Z8GA 1O2NA 2RDLA 3VB6A 1MAXA 3MNXA 3E3TA 3M7TA 1Z71A 2ZGCA 1A2CH 3BEIB 1LQDB 3E1XB 2EI6A 1CHOF 2Q6FA 1O2IA 5FCKA 3U9AH 1QTFA 1MKWH 2WINI 1QB1A 1TB6H 3LGIA 1J9CH 2P8OB 2BXTH 1GMDG 1C1QA 4E06H 3UY9A 1SFQB 1TALA 2D2DA 3AASA 1AUTC 4UFGH 2A31A 1LHDH 1KLIH 2QV1A 3RLWH 3SNCA 4ESTE 3F68H 1GCTC 3HGNA 5EU8A 5A0BA 1FPCH 2FYRA 3K9XB 1SLUB 2R3YA 2YNAA 4IGDA 3ATMA 3ZYEA 3PLBA 3UPEA 3FP6E 4YTAA 4NFFA 3E8LA 1DXPA 1DUEA 2FMJA 1WV7H 1HUTH 3K6ZA 3MH4A 3BTTE 1K22H 1A0HB 1HPGA 2OXSA 3U8OH 2O8UA 2ZTXA 3ZZ7A 2ZDKA 4K1SA 3RXCA 1GI3A 3GY6A 4DJZB 4NA8A 1Y3YA 3M35A 4ZHAA 1P2QA 5C3NA 1N8OC 2A4OA 1T8OA 2JH5D 1HNEE 1S81A 5A2MH 2Z3EA 2ZFTA 4E05H 1YBWA 3GCTF 2FEQH 3FANA 1LQEA 1SR5C 1T4UH 4ZAEA 2VVVA 3ZZDA 2OLGA 4IW4E 3S7KB 2A4QA 2BOHB 1Z1JA 2H6MA 2XBWA 4A7IB 4UFDH 3U1IB 2V3OH 3S9BA 1OWDA 1TWXB 4GCHF 3VB3A 1L1GA 4AFUA 4X8VH 2Y7XA 1YPGH 4Q2KA 1ZLRA 3RU4E 1DOJA 1GI1A 2PV9B 2W26A 1XUKA 2F9PA 1PYTD 3P92A 4ISIH 3U8TH 5A8ZA 3DFJA 3IG6B 3TJVA 2Q6GA 6CHAC 1EQ9A 5A0AE 5JYIA 1YPLH 3RXBA 2XTTB 2EC9H 5GPIB 1BMMH 1KXDA 1ZSKA 2LPRA 1P3CA 4RSPA 4BAOB 3LC5A 4XE4A 1BHXF 4BAMB 3UR6A 3QX5H 1ANDA 2ZU3A 1HBTH 1GGDC 1MUEB 1HJAC 3EA8A 3MNBA 4K69A 1JXPA 1GBJA 1RTFB 1Z6EA 2BX3A 2ZGJA 1F92A 1IQKA 3RC6A 1ZGVA 2C93B 1HJ9A 1DS2E 2XBYA 4FU7A 1SVPA 3PO1B 1AE5A 1K9OE 3PMHB 3SJIA 4AYYB 1GL1A 1K1OA 1YGCH 3DD2H 1NY22 1W14U 1BBRE 1MD8A 1QY6A 1INCA 3R3GB 1ZR0A 1BUIA 4NSYA 2PUXB 2XYAA 3Q76A 2FOAA 5LGOA 4ZUHA 4Y0YE 1TYNA 4AG1A 4KGAA 1V2TT 1HAYB 1MZAA 3HGPA 3LH1A 1ELTA 1GHBG 1FIWA 3ATLA 3LH3A 5I46H 3TH2H 2AEIH 2BD3A 3E0NB 3B9FH 2AERH 3GY5A 3O8BA 1QRZA 4K5ZA 5EXLA 8ESTE 1XUIA 1O35A 2GDDA 2BQ6B 2IPHA 5DO4H 1AO5A 1XVOA 1D3QB 4INHA 1GJCB 1P2OA 5AHGH 3GISB 3NWUA 2Y6TA 2G5NA 1SI5H 2FI3E 5J4QA 2VJ1A 1MCTA 4WXIA 4WJG2 5DPAA 2FX4A 2C8ZB 1NU7B 2P95A 1ZHMA 1O2KA 2OC8A 3RXRA 5EQQA 2A5AA 1J14A 4B2BA 2GZ9A 1VR1H 4ZHLU 1XUJA 3RXPA 1GMHG 5AF9H 4CRCA 1W12U 1W11U 1FY5A 2ZHFH 2SGQE 3ZZ4A 1O2LA 1CT2E 1G3BA 1XXDA 1OXGA 1MKWK 1SLXB 3RDZA 3TH4H 1RIWB 2AGGX 3UREA 1JRTA 1P03A 1TGBA 5CHAB 3K6YA 3OY5U 3FZDA 1UK2A 1Y5AT 1OP2A 2PTNA 2ZTYA 3F9GA 1YPHE 1PPCE 2HOBA 1YPJH 2ZG0H 3GY8A 1EX3A 3SU0A 2TIOA 4B2CA 2C8XB 3NCLA 2ALPA 2BDHA 4NA9H 1D3PB 1TOMH 2I6SA 4Q80A 1C2EA 5DGJA 3I29A 4UFFH 4YT7H 1ELVA 2GX4A 1ZYOA 4Y7AA 3TGIE 2FOCA 1P3EA 2ANMH 3BTFE 2W7UA 5AFYH 3SUFA 3M5MA 2ZO3H 1NFWA 3DT0H 3UR9A 2GGVB 3A86A 1EP5A 2GP9B 2OBQA 1W0ZU 4OS2A 1FAKH 3SV7A 1TONA 1O3FA 3GOVB 3RXSA 1F5LA 4NIYA 1C1TA 1C5WB 1XM1A 2F3CE 3M5LA 4MPWA 3RMMH 3VEQB 4D9QA 4JMYA 1OP0A 2GCHF 4Y11E 1QRXA 3GYLB 4O3UA 1TPAE 4IN2A 5DP4A 1G30B 2ANWA 2DE9A 1AVXA 1DANH 1PPZA 1EASA 1G2LA 1HAHH 3V13A 1GBTA 5C2ZA 2H9TH 2JETC 1C4V2 1LTOA 4DIHH 2G55A 2ZFQH 1TE0A 1C5MD 2Y5HA 3SNBA 4AYVB 2FOBA 4FVDA 5FAHA 4ZXXH 4Y0ZE 1PFXC 4FUHA 2BVRH 2VGCC 4WH8A 5PTPA 1GI9B 1UTJA 1EJMA 2AYWA 4A1VA 1TOCB 2G52A 4ISLA 1A0JA 3BF6H 3ZYDA 1ZGIA 1BB0B 2Z9JA 3E91A 1S0RA 4CH2B 3URDA 1ESBA 1WTHD 1CO7E 3VB4A 1QB6A 2A2QH 3KQBA 3QTVH 1AQ7A 2ZKSA 1QIXB 1EAIA 3FZZA 1AMHA 1ETTH 1EOJA 3SZNA 1DVAH 4NWKA 1C5NH 3SU1A 1SGQE 4AZ2B 4I8KA 4GHQA 9LPRA 3IWMA 1FPHH 3LGUA 3QLPH 1NC6A 1YPHC 2SGFE 1HFDA 2FODA 4IN1A 1O2PA 1WOFA 1O2WA 3SOSA 1FDPA 5C1XA 3QN7A 1IQJA 1RRKA 3RMOH 1WU1A 2TGAA 1S6FA 3W95A 1EAWA 2R2WU 1CU1A 1BBRH 1V2LT 3Q3XA 2BB4A 4U2WA 3GY3A 4UDWH 2PKAB 1DWCH 1PPHE 2XCNA 2CF8H 1E35B 1TPPA 1WTGH 1C1NA 1LVOA 2VIQA 4BOHA 1Z7KA 5EODA 4BTIB 2VIWA 4TY6A 3KHVA 3MNCA 3SHCH 5I25A 3A7ZA 3V3MA 1NRRH 2VNTA 1Y5BT 3VGCB 1KY9A 3M3SA 2PUQH 1EZUC 1TIOA 9ESTA 1THRH 1VJ9U 1K28D 4FUIA 3VFEA 1GJBB 1UK4A 2FPZA 4YOJA 2Y5FA 2ZCKP 3LJOA 1X7AC 2OQ5A 3UOPA 3PTNA 4HI3A 1O5FH 2BD7A 2V0BA 1S83A 2XRCA 1ZSJA 1HXEH 1TNGA 1BRUP 3P8FA 3MU4A 1HGTH 1TA2A 1EJNA 8KME2 1C5OH 1V2JT 1L0ZA 3FVFB 1VITG 1NN6A 1Q2WA 1O2HA 4TYDA 3EE0B 3PB1E 1CVWH 2HWLB 1O3PB 3KQEA 2IN2A 4ASHA 3RXKA 1IQNA 4IMQA 4YOIA 3U98H 3UNRA 3A83A 2ANYA 3A7YA 3GDUA 3TJUA 3SN8A 1P09A 2XC0A 4X0WU 4Y8ZA 2OC0A 2C90B 4Y79A 2FESH 1BTWA 2ZDNA 2C8YB 5JPMH 1CGJE 1SG8B 3MYWA 1C1UH 2B9LA 3F9EA 4K2YA 3TH3H 5C1UA 3A81A 1IHTH 3SV9A 3BTWE 2FI4E 2FLRH 3U1JB 1WAYB 1ZHRA 3S7HB 1UHBA 4FXGH 4A92A 1JBUH 1ARBA 1S82A 4JZIA 3TIUA 1XUHA 2FZZA 1HDTH 5AFZH 3T28A 2ZU4A 1G3EA 7GCHF 1ACBE 2BDAA 2VINA 2UWOA 1QJ1B 2QCYA 2FYQA 2BY9X 2WV5A 1O5DH 1VGCB 1C1MA 3P17H 1MBMA 5BRRE 4OS4A 3S69A 2B0FA 1A5IA 3LC3A 2GMTB 3O8CA 3SV8A 1P0SH 2WPIS 3Q77A 2AIPA 1YYY1 4ABIA 1TFXA 2SGDE 1QL7A 1VZQH 4X8TH 3A85A 4Y8YA 2F9UA 1A3EH 2FXRA 3RXEA 5EW1H 3DHKH 2PKSB 2RCEA 2G5VA 3P6ZB 1OSSA 1LDTT 1QQUA 2PGBB 3E6PH 1O39A 1EB2A 2ZF0H 3RXMA 1SPJA 1HRTH 1TQ7B 3P70B 1TRNA 1T8MA 3TK6A 3LGVA 2VIPA 5JBTA 3DUXH 1ABJH 1SGEE 4U32A 3SJ9A 2J2UA 3PWBA 3KGPA 2Z94A 3KF2A 1UTLM 3ODFA 3PWCA 1AFQB 1C5SA 2J9NA 1SLVB 4FUFA 1KXFA 4VGCB 1DY9A 1F5RA 1SGCA 2WYGA 5C5NA 1GJ4H 4B2AA 1T7CA 1O3GA 1PQ7A 1VJAU 3SW2B 1OX1A 2AMPA 3ZVCA 5FBIA 1KXEA 3A82A 3LGWA 1Y3WA 1JMOH 2HNTE 4I7YH 1XUGA 2WV4A 4NGAH 3RLYH 3I77A 4BANB 2WPHS 4PROA 1Y3XA 4WH6A 1SOTA 2WPKS 2BDCA 1C4Y2 1GJ9B 2BY5X 3GDVA 2Z9LA 1GMCF 5CHAC 4X8UH 2XC4A 1AD8H 1CT4E 2P3UB 2WPJS 1UMAH 3M36A 1BMLA 1C5QA 1FY3A 2G51A 4ZXYH 5HM9A 1LHGH 1V2UT 2O8LA 3O8DA 3PV4A 1AB9C 1CHOG 1K1IA 1P2MA 3MOCA 1G3CA 1E0FD 5AVDA 1BHXB 4ABDA 4XBBA 3RC4A 4X6OA 2GCTB 1C5TA 4DOQA 1SSXA 4AGJA 1GHVH 1UVPA 1ZMJA 4X6MA 3EGKH 2ZFPH 2XCFA 3QK1A 3SU6A 5JB9S 1TNHA 4X8SH 2GD4B 1W2KH 4GPGA 4UEHH 4K1EA 3E0PB 2SNVA 3SQHE 4D8NA 2TRMA 4NIWA 1MTNB 2J95A 1UVUH 3MI4A 1TGNA 1C5LH 1AVWA 1HAVA 1OYTH 3LIWA 3ZVFA 1DWBH 1L4DA 2QGRA 1F5KU 2R9PA 2PLXA 4DVAU 2AMDA 1O2SA 1OS8A 3ZVDA 1B0EA 1SGRE 1P2IA 3AAVA 3ZZBA 1O3OA 2BDBA 2FI5E 1HAOH 4IMZA 1P2NA 3MU0A 1GBFA 1NO9H 3AW0A 3T29A 1XKAC 3R0FA 1O2QA 2PHBA 4MNVA 1MTVA 3FP8E 4ZROA 1B0FA 5C20A 2ZQ1A 1GJ6A 1CBWB 1EPTC 1YLCA 1DWDH 1S84A 1OWHA 3K2UA 2G8TA 4GCHG 3F9FA 1D4PB 5JDUB 4I31A 4IS5A 4OS5A 1NROH 4UFEH 1QBNA 5FX6A 1G2MA 2PW8H 2HNTC 1ANCA 3PLPA 1BA8B 1FMGA 1GVKB 3BTKE 1C5PA 3PMJA 3I78A 5DP5A 1BTXA 3RU4D 2FIRH 2H1UA 2C3SA 3QGJA 5E2PA 3KEEA 1CGHA 2HLCA 1GHYH 5GCHF 1XMNB 2RA0A 2IOTA 2ALVA 4JZFH 3SORA 5FBEA 3JZ2B 3WY8A 1GJ7B 1ZRKA 2UUYA 3JZ1B 3LJJA 2OCVB 3UTUH 3ESTA 1O2JA 7KMEH 1TNIA 3RM2H 4MTBA 1D3DB 1DFPA 2THFB 5H4IB 1O2TA 1DSUA 1GI4A 4JZDH 1AY6H 1MD7A 4BXWA 4CBOA 2FDAA 2QAAA 4IC5A 1NRPH 3SJ8A 1O3DA 3K65B 4B75A 4BNRA 5C67A 1O3HA 1ELGA 1LVBA 1VCQA 2OC1A 4XFQA 4CR5A 2J34A 1QFKH 1GG6C 1F7ZA 2GT7A 2CHAB 2H5DA 2STAE 2VB0A 4TWWA 5JBAS 3QGNB 3A8BA 1DDJA 2RA3A 1Y5UT 3GCHC 2M5TA 1PQ5A 1E34B 5LPRA 3T25A 1MKXK 4FUJA 3ATKA 2ZNKH 2KAIA 1EB1H 2ZFFH 4I8HA 4X1SU 2BDYA 5CMXH 4A1TA 1YP9A 3LGYA 1K21H 1Y59T 1ID5H 2K1QA 4H6SB 1RXPA 5ESBA 3GDSA 1PPBH 2A2XH 2Z3CA 4WXVA 1JRSA 1AZZA 2BVSH 1C2LA 2GKVE 5L2YH 3O8RA 3MHWU 2QY0B 2WPMS 1OWKA 2D1JA 1FJSA 4YT6H 1XX9A 1GBKA 1SGFA 1Z6JH 3EA7A 4MNXA 3A8CA 3BIUH 1GI5A 1TA6A 4WF8A 3SGQE 4AGKA 4U01A 3HKIB 1MTUA 5HM2A 2G00A 2AIQA 2GV7A 5L2ZH 1U6QA 1S85A 3BG4C 4B76A 1AWHB 1SLWB 3A7WA 2G4UA 2VIVA 4CHAC 3RP2A 2P59A 3MH5A 1NFXA 5GIBA 5JB8S 4I33A 1DPOA 3PTBA 3D23A 1W8BH 2UUJB 3LU9B 1O31A 1OWEA 4FU8A 2HGTH 2C8WB 3A7XA 1JOUB 4F49A 4R0IA 3NPSA 2ZDLA 1ZSLA 3DFLA 3SGAE 1CA0C 4GAWA 4BAKB 1W7GH 5C1YA 5SGAE 4Q7YA 5HGGA 1ELDE 2YNBA 4B1TA 1PYTC 1WQVH 2ASUB 2ZECA 3ZZ8A 3B8JA 2QXHA 4AG2A 1EZQA 5DP7A 1LPZB 1O32A 3LGTA 1MTWA 4K60A 1P12E 4LZ4B 1TX8A 2QN5T 5E0GA 1H9HE 2PKSC 3SUDA 4ABBA 2GCHG 2XWAA 1AKSB 4XBCA 1BOQA 1VCPA 1O2VA 2QXJA 2QF3A 2PSYA 3SGBE 1OOKB 4TWYA 4JYUH 2J94A 2Z3DA 4LZ1H 2W3IA 1S5SA 2FO9A 2FP7B 3STJA 3MO3A 1PPGE 4ZKRU 1GI7B 5A09A 2ZP0H 2ILNA 1IQGA 3CS7A 4FUGA 1PJPA 1TRMA