3RXHA

Crystal structure of trypsin complexed with 2-(1h-imidazol-4-yl)ethanamine
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxhA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxhA02
3MTYA 4DJZB 4H42U 1QGFA 3VB7A 4DT7B 2R0KA 3CENA 3MU8A 1BBRH 1EUFA 5DP8A 5FHTA 1GI9B 4JZEH 2ZFSA 1BMNH 3BTFE 1ARBA 1IQFA 2Y6TA 3L33A 3L6PA 3ZYDA 4MPXA 3GCHB 1VJ9U 3SU3A 1NRPH 1SOTA 2BDYA 3M3SA 3SV6A 1SC8U 1JIMA 4VGCB 3A88A 8GCHG 3KQEA 3EA9A 5AFZH 4AYVB 2ZZUH 3A7WA 1ELDE 4WJG2 2UWLA 2UWPA 1AU8A 5HGGA 4B2CA 1FY8E 2B9LA 2R2WU 2OCVB 5L2YH 1QQUA 5FBEA 2OUAA 2ZHFH 3TVJB 2QIQA 2ANKH 2XBWA 1AIXH 7LPRA 4H6SB 3QX5H 3VPKA 1MKXH 1INCA 1V2QT 4WH6A 2PTCE 1ZPCA 1K1NA 3ZYEA 1AFQC 1QBOA 3A7XA 3R3GB 1LKBA 2OC8A 1MAYA 1GHBF 4Q7XA 2SGDE 3A84A 2VIDA 1THRH 5GCHG 4GAWA 1O3FA 1TMTH 3M61U 1IAUA 2PKSB 1QL7A 2ZHQH 4AG2A 4AN7A 3F6UH 3GYMA 2Z3CA 1GBTA 3LGUA 1UTOA 4Y8ZA 1Z6JH 1C2HA 4O3UA 1GJ4H 1J17T 1MTNC 3RMOH 3TK5A 2XCFA 1C5XB 1L1GA 2W5EA 1IQIA 2FESH 3BEUA 4ABEA 4FUCA 4GCHG 3E90B 5CMXH 3RXOA 1WU1A 4WMEA 4X8SH 3LGYA 3M37A 3GCOA 1PFXC 2BDCA 2ZP0H 3LH1A 2OLGA 3E16B 4IS5A 2OC1A 1C5SA 3HKJB 3GISB 3H7OA 1O0DH 1C4Y2 2QXHA 2A4GA 1THPB 3UOPA 1XM1A 3OX7U 2QAAA 4U2WA 2Z9GA 4FU8A 4U32A 1AGJA 2QV1A 1ZRBA 2TGAA 3PM3A 5EG4A 2FM2A 1OWJA 4ISOA 5C1YA 1GMHF 2ZCLP 1LPGB 4X2VA 1J15A 4MNYA 2XW9A 1UCYH 3HK3B 1ABJH 4X1QU 5E0GA 2R0LA 3T62A 1OXGA 1HRTH 3UWJH 1DLEA 1EP5A 4FVDA 3U9AH 1HJAB 3LIWA 2B8OH 4AGKA 1YLCA 4X1PU 2THFB 1V2OT 2FO9A 3CP7A 3BEIB 3UR9A 2NU1E 2ZDMA 3RLWH 3BIUH 5DP3A 3VEQB 1UMAH 1G37A 3GOVB 3NXPA 3HKIB 3UR6A 2VWOA 4X2XA 5F8XA 2QXGA 3K65B 2CHAB 1UTLM 1C2EA 4AZ2B 1L1JA 2XC0A 2J95A 1W7XH 3FZDA 3T26A 4Z6AH 3NUMA 1ELEE 3A8AA 5DKMA 3M7TA 4KTSA 1AVWA 1SI5H 2SNWA 3RXKA 3TNSA 2Y82A 1DUAA 5TCCA 2O9QA 1AFEH 1QFKH 4BAHB 3BEFB 4NIXA 4CHAC 2GP9B 2JKHA 2OC7A 1SBWA 2JH5D 2J34A 2WV5A 1ELGA 3SZNA 3LU9B 1QRWA 1A0LA 4DW2U 1C5ZB 2C8ZB 4HI3A 1MD8A 2BD8A 1F5LA 4FUJA 2QF0A 3OSYA 5HM9A 2BQWB 2RA0A 1KIGH 4K1TA 1DOJA 1FLEE 3P8OA 1O3KA 2O8LA 3QGNB 2ZTZA 3UREA 2A0QB 1LHEH 2LPRA 2Y5FA 3FVFB 2VU8E 1X7AC 3Q3KA 3B23B 1EAXA 2G51A 5DP7A 4FU9A 5I25A 1GI4A 2DUCA 4D7GA 3M5NA 3HPTB 1NRQH 1TALA 2OBQA 3HGNA 2YOLA 5E0HA 3E8LA 1GBCA 1JRTA 3B9FH 4DCDA 2GD4B 2FLBH 1ANEA 4MPVA 4D76A 3QLPH 1W8BH 3G01A 2F3CE 2D8WA 1AHTH 3V0XA 3ZZ4A 2FOEA 1AFQB 1AVGH 1BMMH 1TFXA 2RDLA 1QURH 1EZXC 5FPYA 1YBWA 2ILNA 2Z3EA 2XBXA 4K3JA 4FUGA 3SJOA 2IPHA 1C2LA 3SUGA 1L4DA 1UHBB 4GVUA 2B0FA 1GI2A 1KXDA 1D4PB 3LC5A 1DWCH 3P8GA 4AFUA 2OQ5A 3KGPA 3QTOH 1SG8B 3SNDA 1BBRE 1P2MA 1QTFA 2BDIA 4MNWA 5K0HA 1WCZA 1QNJA 1XUGA 1MTNB 3MO6A 1GBMA 1KXAA 2ZTYA 5FCKA 5EXNA 1XXDA 3LJJA 2GX4A 1O3GA 1B7XB 1AVXA 1UTMA 1HAHH 2ZHWH 5GJ4B 2Y5GA 1SVPA 1GI5A 1BRAA 3R0FA 4K8YA 5FBIA 1UHBA 1OPHB 1QL8A 2W7UA 1V2RT 2HNTF 3LC3A 1G32B 1P3EA 1O3PB 3DA9B 1CSOE 1NFYA 1P2JA 2H5DA 5A8ZA 1O5AB 1C2FA 1UVOA 1PQ5A 2P93A 5JBAS 1ZHMA 1DFPA 4KP0A 1HXFH 4UE7H 2GT8A 1O2RA 1GHXH 5E2OA 1LCYA 1QIXB 5FPTA 1OKXA 2F9NA 2YNBA 1P04A 3ZZDA 5JYIA 3P70B 4UFDH 3K9XB 1RRKA 2ZDAH 4M7GA 1UO6A 4LOYH 3MNXA 1CGJE 3GY5A 1KXFA 1O2IA 1SQAA 2HOBA 5LPEA 1IQKA 1F5KU 2QGRA 4X1SU 1NO9H 3D65E 2Z9JA 1ELTA 4ZHLU 1F0RA 1A5IA 1L4ZA 5GWZA 4JYUH 1ID5H 2GV6A 3NWUA 2TGPZ 1VCWA 3UNQA 3MMGA 4E7RG 1FY4A 4NZLA 2JETB 3SUFA 5C20A 1TA2A 2ZDKA 1O37A 1LVYA 1P12E 2BD7A 2G8TA 1K2I1 3QUMP 2PKAB 3SU0A 4YLQH 2ZGJA 1Y3UA 3OY6U 4YOIA 2BLVA 1O3NA 1O2LA 1ZJDA 1ZZZA 1EZUC 1MKWK 3Q77A 3PTNA 3MH7A 2PTNA 1E38B 1O5BB 3P8FA 2WYGA 3UUZA 1V2TT 1RTFB 4FU7A 1P9UA 1BZXE 3AASA 4KTUA 4KTCA 1GJ9B 4NWLA 1H4WA 1SLWB 2W26A 1YCPH 4XBCA 5K7RA 2BYAX 1SB1H 3D49H 1C5UA 1CGIE 1TONA 1AD8H 1UCYE 3EE0B 2GCHG 3TJVA 1MZAA 1HGTH 3PMJA 3RXBA 1C1SA 1NESE 3BG4B 2PFEA 3PWCA 9ESTA 5J4SA 1TNHA 5JBTA 1JOUB 2ZO3H 2ANMH 1B0EA 4CREA 1C5OH 2ZQ2A 3D23A 1K1JA 1C1PA 1ZTKA 2A32A 1GI3A 1O5FH 1MTSA 2Y7XA 5BRRE 2AMPA 4Q7YA 2C90B 3HGPA 4ISLA 3ZVDA 3PMHB 2AGEX 3ZVAA 5DO4H 1GI8B 1VITH 2VVCA 1GJDB 1TRYA 3ZVGA 1TX7A 1D3QB 1D6RA 4CRCA 2BQ6B 2EI8A 2OINA 3AW0A 1O36A 4CRAA 4AG1A 4X8UH 3S9CA 3EDXB 2CGAA 5A2MH 4TY6A 1MBMA 2GKVE 1O5EH 3DFLA 1O2SA 7KMEH 1NU7B 3A7YA 4MTBA 2VH0A 1PJPA 3URCA 1V6DA 1RTKA 3ATKA 3D62A 1TX6A 3SI3H 3P95A 1G3CA 3GDUA 2ZFFH 4WWYA 3TJOA 4CRBA 1NC6A 3V3MA 1GI7B 1OSSA 1KY9A 1ELVA 1GVZA 2CN0H 1GMCF 3RU4T 5T6FA 2A5IA 1TNLA 3GYLB 2SFAA 3UTUH 1ELCA 1G3EA 4YOJA 2P3UB 2C8YB 1DE7H 4J1YA 1HFDA 1FY1A 3FAOA 1FXYA 2F9OA 3BTQE 3I29A 3V12A 5JBCS 3SHCH 1IQJA 3MHWU 3E0NB 5A8YA 1GJBB 2PW8H 2HWLB 5C1UA 1T4VH 1BCUH 1BMLA 3A87A 5ESBA 1PYTD 5C1XA 1HAXB 1C2IA 4D8NA 4O03A 1CHGA 1KTTB 5DPAA 1IQEA 1N6YA 2BY8X 1IQMA 1T4UH 1F0UA 1EB1H 2A45B 1SOZA 2SGEE 1BTWA 1FAKH 2XC5A 5GPIB 1RFNA 2GZ7A 1CA0B 1CT2E 5EOKA 3ENSB 1S83A 4IC5A 1QB1A 4I8LA 2A7CA 4TPIZ 1RIWC 5AFYH 1BA8B 4ZROA 2K1QA 2ZFRH 1C1UH 2NU0E 1SQTA 5PTPA 1IQNA 1PQ7A 1GPZA 5JBBS 4I8HA 1Z6EA 3RXIA 3SN8A 1Y5UT 2FODA 5EPNA 3V7TA 2QXJA 1HAVA 3LT3A 4RKJB 4ABJA 3SJKA 4MG3A 1GL1A 1GHWH 1WTGH 4NFFA 2ZFTA 3TGIE 3U1JB 2FOGA 1SQOA 1GI6A 5DJ7A 4RKOB 1A7SA 1EQ9A 1Y5BT 1TB6H 2TPIZ 3UFAA 4DURA 3VXEH 4JZ1A 2CJIA 2ZA5A 4ZKRU 2H9HA 3KEEA 1JBUH 3PLPA 1C2KA 3JZ2B 1Z1JA 2Z6BD 1V2ST 2EI7A 1H8IH 1BUIA 1MQ5A 1F92A 3SI4H 5B6OA 2UWOA 1C5QA 1DWDH 3VB3A 1CBWC 2AFQB 4DG4A 3A8CA 4KELA 1C1TA 1XUKA 2VGCB 3RXVA 4AX9H 2ZHEH 1QL9A 1TNGA 2WYJA 2WPMS 3DUXH 4X2YA 5LPFA 1C2MA 3AVZA 1C5RA 1TBZH 1QB6A 1TPAE 3OTJE 3TPIZ 3IITA 4YOGA 1S85A 4Y71A 1WOFA 4Y0ZE 1H9LB 3GY2A 1K1OA 2VB0A 3I78A 3PO1B 1FN8A 4SGAE 4A1XA 1EJNA 3MU0A 4XBDA 5EQRA 3PYHA 2BMGB 2GCTC 1MU6B 1UVPA 1BTUA 1EOLA 4Y10E 1OWHA 1E35B 2I6QA 1PPZA 2Z3DA 2ZGBH 2Q6DA 2ZTXA 1SGFG 1KLIH 1SGFA 1EAIA 1BTPA 1Y3YA 3FP8E 7ESTE 1ESTA 2AERH 2RCEA 1TA6A 4I8KA 1LO6A 4OGYA 1L2EA 1Z8GA 3E6PH 1TLDA 1P2IA 3FP7E 4D9QA 3SQHE 4NGAH 3IWMA 1A1RA 3A83A 1BJUA 1FY5A 3BTEE 1NFXA 5LH8A 1TGNA 2AGGX 3PWBA 3SOSA 1VITF 2P16A 3GCTF 3PV4A 1XVMA 1D3DB 4BXSA 1FNIA 2J38A 2AMQA 3MYWA 3VGCB 3FANA 1XVOA 1DY8A 2GMTC 3KQDA 4AGJA 1DLKB 1C1OA 5CHAB 4D9RA 2PSYA 3EGKH 1O5DH 4ABGA 1SMFE 5A0CA 2ODQA 3M5LA 2SGFE 1EPTC 1P03A 5FXLA 1S84A 1V2VT 2A4RA 1Q31A 2A4OA 2UUYA 4XFQA 1YM0A 3SQEE 5L2ZH 3S7HB 2A2XH 2PR3A 2QYIA 3ODFA 4Y76A 2G00A 3C1KA 3ZZCA 1CU1A 4ASHA 1PPEE 1AN1E 1E0FD 1KDQB 1P2OA 5HM2A 1N8OC 1ESBA 2VINA 1ZTLA 2EI6A 2NU2E 1MUEB 4INLA 1RIWB 1T8MA 4Y8YA 1UK2A 5FX6A 2OD3B 5TCAA 1W11U 3RMNH 4GLYA 2XNIA 1GCDA 3BTDE 3MI4A 3RXRA 4AORA 2P94A 3UNRA 4X6PA 1UTQA 1TQ0B 1XMNB 1BHXB 2H6MA 1C1QA 1BDAA 1E34B 1LHCH 1SHHB 2DE9A 1KDQA 2ZGHA 2A7JA 1CHOG 3AAVA 4A1VA 2SGPE 1C1MA 3RXUA 4DIHH 2FDAA 3GY6A 4JCNA 1BITA 2GDDA 3LGTA 5JPMH 1F2SE 2YNAA 4BTTB 2FI5E 2W3KA 4ZAEA 1O2HA 4YESB 3ZVEA 6GCHG 3N7OA 3TH2H 5F8TA 1W13U 4BXWA 2VWMA 1MTWA 3SBKA 5F8ZA 1AKSB 3M7UA 2EA3A 1SGNE 2W3IA 4NWKA 4YLUA 1HAOH 1SFIA 3MH6A 1YLDA 4IMZA 4X8VH 1ZGVA 1FIZA 1WQVH 1QRZA 1GJ5H 3NKKA 3LPRA 1SLVB 5SGAE 1ZSJA 1CQQA 3CS0A 2BD4A 8GCHF 4A1TA 2G81E 2BDHA 3LGIA 4ZKSU 3S69A 3PB1E 4AB9A 1BTHH 1IQHA 4FXGH 1AE8H 2KAIA 5DP6A 3ITIA 1O3EA 1Z8RA 1W10U 4UDWH 2A31A 1AKSA 5C5OA 4UFGH 4CRGA 1WYKA 2XTTB 5A8XA 2FOFA 1H9IE 1DSUA 1SL3A 1O2UA 1GBIA 2BDAA 2GV7A 1JMOH 2D2DA 1ZMJA 2GCTB 1KLTA 1SLXB 1P02A 2VH6A 2F91A 5H4IB 4B73A 2OC0A 3KQCA 2F9PA 1GDUA 2UUFB 3S0NA 3QK1A 2STAE 1GBBA 4AFZA 2M5TA 3SU6A 5DK1A 1J8AA 3LGVA 5GCHF 1MKWH 4F4OC 1QA0A 4WVPE 4OS6A 4YZUA 3TJNA 1H8DH 2XBVA 1W14U 2RG3A 3EA8A 4JYTA 4TYDA 1XKBC 2JH6D 5T3HA 1V3XA 1ZYOA 1LVOA 5JB8S 3EAJA 2BY5X 4CRFA 4XBBA 1NU9A 2ESTE 2B7DH 3T5FH 4GCHF 1GDNA 2ZGXH 1ZTJA 3ATIA 2PUXB 2OTVA 1QJ1B 2G4TA 4Z0KA 1TNIA 2FLRH 5EU8A 4SGBE 5IYTA 1FZZA 2BX3A 1S6FA 1WBGB 3UIRA 3VXFH 3LKWA 4NCYA 1CVWH 1OX1A 4FVBA 1O2MA 3SNAA 4YM9A 2FMJA 1A46H 4IW4E 3RXFA 1OS8A 2ZU1A 3DT0H 3UQOA 3MWIU 5EQSA 1N8OB 1MU8B 1QCPA 1O38A 2XBYA 2XRCA 2FEQH 1SGCA 5GDSH 1EPTA 2BD9A 3I77A 4J2YB 1BTZA 5L30H 4NA9H 2A7HA 4Y7AA 2HALA 3SUDA 1KXCA 3ZVFA 4A6LA 3BV9B 2IOTA 1P09A 5T6GA 1T8OA 2VIOA 3MNSA 1P3CA 4XSKU 4CBOA 1NRNH 2WV4A 1Y8TA 1F0SA 2V3OH 2WPJS 3A86A 1UJ1A 2V35A 1OOKB 3K6ZA 2J94A 3BTWE 1ESAA 1YPMH 1Y3WA 3TH4H 1O2VA 1GJAB 1IHSH 3SO3A 5DP5A 2CF9H 1P01A 1TPOA 1LPZB 1TGTA 1P2NA 3M35A 1K22H 1DICA 2UUKB 2ZDLA 1SGYE 2HNTE 5EW2H 1O3MA 1OWKA 3SORA 1O3IA 3HK6B 1G36A 2QN5T 4BOHA 1ZSLA 3HATH 1S0QA 1XXFA 2OP9A 4H6TA 3PTBA 3QWCH 4WF8A 1OP0A 1QBVH 2HVXA 3T28A 1YF4A 4ZH8A 1ZHRA 2FOHA 1C1RA 1A4WH 2ZPRA 4X8TH 3QZQA 3VB5A 2H2ZA 2BD2A 5TJXA 2QF3A 4IMQA 3TU7H 1KLJH 1A0HB 1UTKA 2GZ8A 4AYYB 1XUJA 1IQGA 2BOHB 2NU3E 3UQVA 1TRMA 1IOEA 2ZNKH 3KN2A 4Y0YE 3OY5U 2AIQA 1C4U2 1MD7A 1QQ4A 4CHAB 1K1PA 1O30A 4B75A 2VIQA 1Q3XA 1AMHA 1O3DA 4JZDH 5A0BA 3DD2H 2CXVA 1S82A 5F6MA 1Q2WA 1Z8JB 2STBE 4PROA 1V2PT 4WXIA 1GHYH 2XWAA 1QHRB 1TRNA 1ZPBA 3K2UA 3SGQE 2QXIA 4WMFA 4JZIA 2P3TB 4RN6A 1ANDA 3BIVH 4ISIH 1W3CA 1P8VC 1C9TA 1K1LA 4MNVA 1K1MA 1BT7A 1UTNA 2ZC9H 2BXUH 1VJAU 1TOMH 3T27A 1A61H 1QR3E 3RXJA 3SNBA 1L0ZA 5AHGH 1OP8A 3SGBE 2Z94A 1MZDA 3H7TA 1XKAC 4X1RU 5EXLA 1EJMA 2BY7X 1HAIH 5E8EH 1PPCE 3BTME 5IDKA 1RJXB 3SJIA 3A85A 1EB2A 1AB9C 1C5YB 2BZAA 1C1NA 3RU4D 3AAUA 1NN6A 2XWBI 2HRVA 1V2MT 4Y11E 4F49A 1GBDA 3ODDA 2BX4A 3MNBA 1QY6A 4OS1A 4TWWA 1JRSA 1CO7E 1TAWA 3U8OH 1F5RA 1RGQA 2FYQA 3A7ZA 3M5MA 3GCHC 3RMLH 1A0JA 1TQ7B 2EEKA 1MTVA 2VWLA 2FI4E 5HMAA 5CE1A 1TOCB 3TNTA 1T8NA 1DXWA 1A5GH 3UPEA 4DOQA 1U6QA 1EAUA 2P3FH 1GJ6A 4FUDA 1PQAA 3MH5A 1O2JA 8ESTE 2Q1JA 1ZPZA 3WY8A 5C67A 2AEIH 4A7IB 4NIVA 3P6ZB 2A5AA 1BOQA 2CMYA 2ZPSA 5EGMA 3UWIA 2H5CA 3RXMA 3ZZBA 3Q3YA 3A7VA 1GBHA 5E0JA 4NA8A 4BAQB 1KXBA 1GHVH 4TPYA 1EATA 1DITH 1C2GA 2BM2A 1Y5AT 1FMGA 1ZR0A 2O8TA 1HAVB 2V6NA 1YP9A 3RM2H 4IGDA 2SGAA 2QCYA 3T2NA 1QB9A 2BDGA 1S6HA 4KKDA 4NSYA 3BTGE 3FFGA 2ANYA 1ZSKA 4K2YA 2PKSC 3RXCA 2Z7FE 1G3DA 1NY22 3F9EA 4K69A 2F9UA 3CS7A 2ALPA 2DE8A 3GY3A 1FAXA 1GBLA 1TMUH 1TWXB 4X6OA 1ZMNA 2BVRH 3MH4A 4Q7ZA 3MOCA 3F1SB 4X6NA 1SFQB 3SV8A 2GCHF 1NTPA 3E3TA 4BAOB 1J16A 1GMDG 3K6YA 3SUEA 2ZU5A 1LDTT 1DT2A 3SGAE 1QA7A 1HAPH 3SU1A 2H9TH 3M7QA 1VCPA 3RXLA 2WUBA 4I8GA 1W0ZU 1BIOA 5DGJA 2ZG0H 2FOMB 1S81A 2HNTC 1UTPA 4OGXA 1C5LH 4LXBH 1O39A 4MLFB 1GVLA 1ZJKA 1OWDA 1GBKA 1D9IA 1O5CB 1O2QA 1C5NH 4RSPA 4Y7BA 4GHQA 5HYOA 2GZ9A 4BANB 1P11E 1TGBA 2OXSA 4BNRA 4HTCH 1T7CA 1GBFA 1VR1H 2A5KA 3F9GA 3GCNA 1P57B 3ELAH 3FZZA 2BTCE 1GBAA 3MNCA 1J9CH 1E37B 1AUTC 1FPHH 2ZDNA 1W2KH 1WSSH 1O33A 1GMHG 1LPKB 2AS9A 3BN9A 4NSVA 2NWNA 3TJUA 1TNKA 1EAWA 2PGQB 1QJ7B 3BTTE 1C5TA 4ZUHA 2PLXA 4ISNA 3OYPA 1UVTH 2VNTA 3TITA 3SV2H 1DX5M 1SGPE 4U01A 1AI8H 1DSTA 2Y80A 4ABBA 1LVMA 4ZKNU 3V13A 1HUTH 5A0AE 1PPFE 2P59A 4JZFH 4Y79A 1IQLA 1WAYB 1ABIH 3SJ9A 1LHDH 3DHKH 2LNCA 1SGDE 4YTAA 5F03A 1ELAA 2VIWA 3ZZ8A 1AWFH 1W12U 5FPSA 3RC5A 1T31A 2V0BA 1C1VH 3S7KB 5DP9A 1TPSA 4UEHH 1YPGH 4CBNA 3GY4A 3TIUA 3ATLA 3BTKE 1PPGE 2FXRA 3ZZ9A 1GG6C 1V2NT 1B0FA 2Y81A 5BPEA 5FAHA 1BRUP 1O2PA 1TBQH 5ESTE 2FX6A 2VIPA 1XX9A 2G52A 4IN2A 1E36B 2UUJB 3Q3XA 2FPZA 3KQBA 1CT0E 2FOCA 2GT7A 2J2UA 3B8JA 1DM4B 1NM6A 2VIVA 2BHGA 2C8XB 1GMDF 4HGCA 3U69H 2CF8H 2WUCA 1FUJA 1LHFH 6LPRA 2XC4A 1CA8B 1RS0A 1O34A 2WPKS 3OU0A 3GDVA 1OYQA 1G30B 1JWTA 1O3CA 3TLOA 4YT6H 3UY9A 2H1UA 1BRCE 4MNXA 1RXPA 4QT8C 2D1JA 1Y59T 1DPOA 3LGWA 4ABAA 1RD3B 4INHA 1CE5A 2OBOA 1DWBH 1S0RA 1P10A 3SU5A 2FTLE 2IJOB 1GVKB 1YPEH 1YGCH 1ETSH 1L1NA 1C2DA 2TGTA 1G2MA 2D26C 2HLCA 1NRRH 7GCHG 3Q76A 2R2MB 2TGDA 4WMDA 5GXPA 4A5TS 1LQEA 3IG6B 2FZZA 1UK3A 1HLTH 8LPRA 1T32A 1GDQA 4KGAA 2AMDA 4MQAA 3QO6A 4ZHMU 1G3BA 3KF2A 1O3JA 1C9PA 1O5GH 2KAIB 1BQYA 3MO3A 2XYAA 2Y7ZA 1WTHD 1C1WH 1DVAH 1DXPA 2Z9IA 3M36A 1CBWB 3QDZB 1YPHE 1LTOA 3GDSA 1OYTH 3UNSA 1GJCB 2BVXH 1THSH 4FUHA 5J4QA 2ZU2A 3STIA 1GHAG 3E0PB 4YO9A 5AVDA 1YCPM 3O8CA 3LDXH 1O31A 1GL0E 4GHTA 1HCGA 1O3HA 1BBRK 2BB4A 2G5VA 2ZQ1A 3PROA 1FV9A 4JMYA 4BAKB 1XUFA 4NA7A 1SGEE 2GTBA 1Z7KA 1EASA 1AO5A 1FJSA 1MCTA 3RXEA 3FP6E 6ESTA 4BAMB 1FI8A 2ZPQA 3ZZAA 1VGCC 3U8RH 2ASUB 2SNVA 4UFEH 4LK4A 3ZZ5A 3ESTA 5JB9S 1QJ6B 4B2AA 2BD3A 3O8RA 2JETC 2I6SA 3P92A 1EZQA 4ZXYH 1YPKH 3ZVCA 1AY6H 1ETTH 3U98H 1HXEH 2CV3A 2IN2A 1LKAA 5T6DA 1SGTA 1G9IE 1SGRE 1TGCA 3ATMA 1XUHA 2BLOA 4R8TB 3PLKA 2C93B 1KXEA 2A4QA 1MCVA 3L3TA 3TK9A 4MPWA 1BMAA 4I8JA 5L6NH 1V2UT 1UVSH 2ODYB 1F0TA 1GCTC 3BTHE 2ZKSA 4OS2A 3TK6A 4CH2B 1C2JA 4HZHA 4NFEA 1MKXK 2EC9H 1W7GH 1EXFA 3F9FA 3S9AA 1O3AA 1A3EH 1O2OA 1AWHB 1P2KA 1XUIA 1PPBH 3KHVA 3O8DA 4CH8B 1NS3A 1PYTC 1N1LA 4XDEA 1IHTH 1GJ8B 4NZQA 3BG4C 1WUNH 2RA3A 1TABE 1GG6B 1GGDC 2ANWA 2O8UA 5LGOA 2GMTB 3A7TA 4TY7A 3ZZ6A 1O2TA 1ELFA 1OWEA 1YKTA 3LJOA 1TE0A 2W7SA 2F9VA 1EPTB 2Q6GA 1ORFA 1O2GH 2AIPA 4O3TA 1DDJA 4DY7B 2XXLA 1H9HE 3F68H 2FOAA 3RXDA 1HPGA 3A81A 2ODPA 3MFJA 2JH0D 4OS4A 4UONA 1ACBE 3VFEA 1CHOF 4BTIB 2WPIS 4INKA 7GCHF 2R9PA 3O8BA 1NPMA 5EQQA 2C3SA 1B5GH 4HFPB 3EQ0H 1WQSA 2QC2A 3LOXA 3SV9A 1N6XA 1MH0A 1A2CH 4IBLH 1FN6A 2FP7B 1SR5C 3NK8A 2ZECA 4GUXA 5EW1H 1LHGH 1BHXF 3A82A 1NRSH 6GCHF 3E91A 3PLBA 1O2XA 2FIRH 1UCYK 3EA7A 4B2BA 4FUIA 2BY9X 1ZRKA 1DS2E 4DGJA 2ALVA 1MTUA 1P2QA 3M3TA 1O3OA 4Q80A 3RC4A 3RP2A 2XCNA 1ANBA 3S9BA 1T8LA 1TX8A 3RMMH 4K1EA 1AZ8A 3RC6A 2BOKA 1GHAF 3SNEA 4LZ4B 1D3TB 2Z9KA 4GPGA 3GICB 3QTVH 2FI3E 4UFFH 4ESTE 2HPPH 4NIWA 3NCLA 1VZQH 5DP4A 2VJ1A 4AOQA 4D7FA 1HJ9A 1HAZB 1UVUH 3PMAB 4IN1A 3A8DA 3SNCA 2FYRA 2SGQE 5FX5A 1ETRH 4Q2KA 4B74A 1W0YH 1V2KT 3RXPA 2Z9LA 1EJAA 3RXGA 1UTJA 1OP2A 3RXHA 3ZVBA 3SJ8A 1EP6A 1SHYA 1LMWB 3T25A 4E06H 2AH4X 1AE5A 2VWNA 3JZ1B 1OWIA 1DANH 9LPRA 2ZIQH 2PGBB 1GMCG 3VB4A 1CA0C 3P17H 1EX3A 1NT1A 1HAYB 2VVVA 2ZDVH 1TGSZ 1Y3XA 1O2WA 1BTXA 4CR9A 2OQUA 4O97A 1MQ6A 2FWWA 4K8BA 3RM0H 4JK6A 5ABWA 1C5PA 2P8OC 4ABHA 3RXSA 1V2LT 1VCQA 1VGCB 3E1XB 3ZV8A 2GVFA 2B5TB 1JIRA 2C8WB 1KTSB 2PWXA 3RXTA 2Q6FA 1V2WT 1Z8IB 1TNJA 4GSOA 1BJVA 1DY9A 1O2YA 1V2JT 2FS8A 1EKBB 1C5MD 1AZZA 2AYWA 2R3YA 5ETXA 6CHAC 3TGKE 5FCRA 4WXVA 4B1TA 3U8TH 4O9VA 1YPHC 3MU4A 3T29A 1GBJA 3M5OA 1O2NA 1P06A 1GCTB 5EXMA 4FUFA 1YPLH 4ABFA 2WPLS 4X6MA 2PHBA 4TWYA 2O8WA 4AFSA 3M3VA 4MVNA 3SHAH 2ZU4A 3QN7A 5G4BA 2ZU3A 2PKAA 2FS9A 5A09A 1PPHE 1LQDB 1C5VA 1O3BA 2Y5HA 4NIYA 2PV9B 2WPHS 3U1IB 5GIBA 1GGDB 4I33A 1FDPA 4XE4A 1GJ7B 1SSXA 2VGCC 2ZI2H 2ZFPH 4JYVH 3STJA 1GHZA 1H1BA 1A5HA 2G55A 1D3PB 1J14A 1FONA 2F83A 1WV7H 1HAGE 3MU5A 4B71A 3BF6H 1NROH 1UK4A 1MBQA 1A3BH 1CT4E 1NFWA 2F9BH 3EYDA 5C3NA 4OS7A 1TBRH 4ZKOU 5EPYA 2BXTH 3PO1C 4CR5A 4X0WU 1LVBA 3A80A 3UOUA 1TYNA 4MPUA 1HBTH 4UD9H 3URDA 3RDZA 4B76A 3RLYH 4YT7H 1ZLRA 1TIOA 2J92A 1CGHA 4H4FA 1MAXA 3KIDU 2J9NA 1YYY1 2V3HH 2C4FH 4VGCC 3KCGH 1SLUB 4WH8A 4OS5A 2A1DB 1BRBE 4U30A 8KME2 1F7ZA 1TMBH 3GY8A 1JXPA 1ZHPA 2ZHDA 1P0SH 3NZIA 1O2KA 2BLQA 2A2QH 4DIIH 1P05A 2GDEH 2TBSA 4K60A 1FIWA 3KL6A 1RTLA 1K9OE 1QBNA 2VVUA 4ZMAH 1D6WA 1NFUA 4I32A 4I7YH 1HNEE 3MU1A 1YPJH 3SW2B 4ISHH 3TH3H 2BQ7B 3ZV9A 4E7NA 5C5NA 1K1IA 1PQ8A 2PUQH 2FOBA 2G5NA 4FUBA 3VGCC 4A92A 2O8MA 4WY3A 5CHAC 4X1NU 3RXQA 3TGJE 1O3LA 1AQ7A 3F9HA 2TIOA 3BSQA 2BLWA 4ABIA 1HIAB 1HV7A 2FTMA 2QA9E 5HXFA 1DUEA 1HJ8A 3P8NA 3A8BA 4ABDA 1SGQE 1O32A 3ZZ7A 4AFQA 3ATWA 1AUJA 2HPQH 4MDSA 4FUEA 3Q00A 1SPJA 1K21H 5I46H 3AW1A 1NZQH 3A89A 3PMBB 4K1SA 2PSXA 1VITG 1ARCA 3LH3A 2HGTH 3GCTG 4ZXXH 4BTUB 1C4V2 4NG9H 2H9EH 2WINI 4K5ZA 1HB0B 1GBEA 3W95A 4Y6DA 1HIAA 1GI0A 3ZZ3A 4ZHAA 3VB6A 1G2LA 2ZGCA 1Y3VA 2P8OB 1EOJA 1M9UA 2P95A 2QY0B 2BD5A 2AGIX 3BG8A 1GHBG 3RU4E 2R3UA 2GGVB 2ULLA 2BZ6H 2ZCKP 1ZMLA 4THNH 1GI1A 1YCPK 1C5WB 2BDBA 4E05H 1FQ3A 1ANCA 1Z1IA 4JK5A 3LONA 4CRDA 4AB8A 5LPRA 1SGIB 5DG6A 2NU4E 3GY7A 1ZOMA 6CHAB 1DWEH 1K28D 4I31A 4IC6A 1QRXA 2ZFQH 2ZF0H 1S5SA 2TRMA 3H5CB 3QGJA 1HDTH 5E2PA 1FPCH 3W94A 2ZCHP 3SU4A 1HJAC 1ELBA 2J4IA 1KSNA 2BVSH 1YC0A 1O2ZA 4XOJA 5C2ZA 4Y8XA 1TPPA 1EZSC 2ZEBA 1MMJN 5EODA 3RUOA 3MO9A 4LZ1H 2BY6X 1KYNA 1BB0B 1O35A 3NPSA 3KNXA 3SU2A 5AF9H 2G4UA 3RXAA 1HYLA 3C27B 4X2WA 1BTYA 2ZWLH 2CHAC 3DFJA 1FY3A 4DVAU 5JDUB 4R0IA 3QZRA 1P9SA 1Z71A 1GWAA 3SV7A 2FX4A 1ZGIA 1AB9B
chains in the Genus database with same CATH superfamily
3MTYA 4DJZB 4H42U 1QGFA 3VB7A 4DT7B 5EJZA 2R0KA 3CENA 3MU8A 1BBRH 1EUFA 5DP8A 5FHTA 1GI9B 4JZEH 2ZFSA 1BMNH 3BTFE 1ARBA 1IQFA 2Y6TA 3L33A 3L6PA 3ZYDA 4MPXA 3GCHB 1VJ9U 3SU3A 1NRPH 1SOTA 2BDYA 3M3SA 3SV6A 1SC8U 1JIMA 4VGCB 3A88A 8GCHG 3KQEA 3EA9A 5AFZH 4AYVB 2ZZUH 3A7WA 1ELDE 4WJG2 3PV5A 2UWLA 2UWPA 1AU8A 5HGGA 4B2CA 1FY8E 2B9LA 2R2WU 2OCVB 5L2YH 1QQUA 5FBEA 2OUAA 2ZHFH 3TVJB 3GS9A 2QIQA 2ANKH 2XBWA 1AIXH 7LPRA 4H6SB 3QX5H 3SZEA 3VPKA 1MKXH 1INCA 1V2QT 4WH6A 2PTCE 1ZPCA 1K1NA 3ZYEA 1AFQC 1QBOA 3A7XA 3R3GB 1LKBA 2OC8A 1MAYA 1GHBF 4Q7XA 2SGDE 3A84A 2VIDA 1THRH 5GCHG 4GAWA 1O3FA 1TMTH 3M61U 1IAUA 2PKSB 1QL7A 2ZHQH 4AG2A 4AN7A 3F6UH 3GYMA 2Z3CA 1GBTA 3LGUA 1UTOA 4Y8ZA 1Z6JH 1C2HA 1BMFD 4O3UA 1GJ4H 1J17T 1MTNC 3RMOH 3TK5A 2XCFA 1C5XB 1L1GA 2KX4A 2W5EA 1IQIA 2FESH 3BEUA 4ABEA 4FUCA 4GCHG 3E90B 5CMXH 3RXOA 1WU1A 4WMEA 4X8SH 3LGYA 3M37A 3GCOA 1PFXC 2BDCA 2ZP0H 4TSFD 3LH1A 2OLGA 3E16B 4IS5A 2OC1A 1C5SA 3HKJB 3GISB 3H7OA 1O0DH 1C4Y2 2QXHA 2A4GA 1THPB 2WHXA 3UOPA 1XM1A 1W0JD 3OX7U 1VKYA 2QAAA 4U2WA 2Z9GA 4FU8A 4U32A 1AGJA 2QV1A 1ZRBA 2TGAA 3PM3A 5EG4A 2FM2A 1OWJA 4ISOA 5C1YA 1GMHF 2ZCLP 1LPGB 4X2VA 1J15A 4MNYA 3OEED 2XW9A 1UCYH 3U28C 3HK3B 1ABJH 4X1QU 5E0GA 5KEDA 2R0LA 3T62A 2QF4A 1OXGA 5GNDA 5CHBA 1HRTH 3UWJH 1DLEA 1EP5A 4FVDA 3U9AH 1HJAB 3LIWA 2B8OH 4AGKA 1YLCA 4X1PU 1K0HA 2THFB 1V2OT 2FO9A 1E1RD 3CP7A 3BEIB 3UR9A 2YMSC 2NU1E 2ZDMA 3RLWH 3BIUH 5DP3A 3VEQB 1UMAH 1G37A 3GOVB 3NXPA 3HKIB 3UR6A 2VWOA 4X2XA 5F8XA 5FL7D 2QXGA 3K65B 2CHAB 1UTLM 1C2EA 4AZ2B 1L1JA 4Q63A 2XC0A 2J95A 1W7XH 3FZDA 3T26A 4Z6AH 3NUMA 1ELEE 3A8AA 5DKMA 3M7TA 4KTSA 1AVWA 1SI5H 2SNWA 2KR7A 3RXKA 3TNSA 2Y82A 1DUAA 3DCLA 5TCCA 2O9QA 1AFEH 1QFKH 4BAHB 3BEFB 4NIXA 4CHAC 2GP9B 2JKHA 2OC7A 1SBWA 2JH5D 2J34A 2WV5A 1ELGA 3SZNA 2V7QD 1QRWA 3LU9B 1A0LA 4DW2U 1C5ZB 2C8ZB 4HI3A 1MD8A 2BD8A 1F5LA 4FUJA 2QF0A 3OSYA 5HM9A 2BQWB 3OEHD 2RA0A 1KIGH 4K1TA 1DOJA 1FLEE 3P8OA 1O3KA 3UAIC 2O8LA 2M2AA 3QGNB 2ZTZA 3UREA 2A0QB 1LHEH 2LPRA 2Y5FA 3FVFB 2VU8E 1X7AC 3Q3KA 3B23B 1EAXA 2G51A 5DP7A 4FU9A 5I25A 1GI4A 2DUCA 4D7GA 3M5NA 3HPTB 1NRQH 1TALA 2OBQA 3HGNA 2YOLA 5E0HA 3E8LA 1GBCA 1JRTA 3B9FH 4DCDA 2GD4B 2FLBH 1ANEA 1QZ8A 4MPVA 4D76A 3QLPH 1W8BH 3G01A 2F3CE 2D8WA 1AHTH 3V0XA 3ZZ4A 2FOEA 1AFQB 1AVGH 1BMMH 1TFXA 2RDLA 1QURH 1EZXC 5C0UA 2QF5A 5FPYA 1YBWA 2ILNA 5HIZA 2Z3EA 3DSPA 2XBXA 4K3JA 4FUGA 3SJOA 2IPHA 5EIYA 1C2LA 3SUGA 1L4DA 2XNDD 1UHBB 4GVUA 2B0FA 1GI2A 1KXDA 1D4PB 3LC5A 1DWCH 3P8GA 4AFUA 2OQ5A 3KGPA 3QTOH 1SG8B 3SNDA 1BBRE 1P2MA 1QTFA 2BDIA 4MNWA 5K0HA 2KCYA 1WCZA 1QNJA 1XUGA 1MTNB 3MO6A 1GBMA 1KXAA 2ZTYA 5FCKA 5EXNA 1XXDA 3LJJA 2HLDD 2GX4A 1O3GA 1B7XB 2AHME 1AVXA 1UTMA 1HAHH 2ZHWH 5GJ4B 2Y5GA 1SVPA 1GI5A 1BRAA 3R0FA 4K8YA 5FBIA 1UHBA 1OHHD 4ZCNA 1OPHB 1QL8A 2W7UA 1V2RT 2HNTF 3LC3A 1G32B 1P3EA 1O3PB 3DA9B 1CSOE 1NFYA 1P2JA 2H5DA 5A8ZA 1O5AB 1C2FA 1UVOA 1PQ5A 5C94A 2P93A 5JBAS 1ZHMA 1DFPA 4KP0A 1HXFH 4UE7H 2GT8A 1O2RA 1GHXH 5KECA 5E2OA 1LCYA 1QIXB 5FPTA 1OKXA 2F9NA 2YNBA 1P04A 3ZZDA 5JYIA 3P70B 4UFDH 3K9XB 5C17A 2EY4C 1RRKA 2ZDAH 4M7GA 1UO6A 4LOYH 2YMSB 3MNXA 1CGJE 3GY5A 1KXFA 1O2IA 1SQAA 2HOBA 5LPEA 1IQKA 1F5KU 2QGRA 4X1SU 1NO9H 3D65E 2Z9JA 1ELTA 4ZHLU 1F0RA 1A5IA 1L4ZA 5GWZA 4JYUH 1ID5H 2GV6A 3NWUA 2TGPZ 1VCWA 3UNQA 3MMGA 4E7RG 1FY4A 4NZLA 2JETB 3SUFA 5C20A 1TA2A 2ZDKA 1O37A 1LVYA 1P12E 2BD7A 2G8TA 1WDIA 1K2I1 3QUMP 2PKAB 3SU0A 4YLQH 2ZGJA 1Y3UA 1UW7A 3OY6U 4YOIA 2BLVA 1O3NA 1O2LA 1ZJDA 1ZZZA 1EZUC 1MKWK 1FX0B 3Q77A 3PTNA 3MH7A 2PTNA 1E38B 1O5BB 4TT3D 3P8FA 2WYGA 3UUZA 1V2TT 1RTFB 4FU7A 1NBME 1BZXE 1P9UA 3AASA 4KTUA 4KTCA 2KM0A 1GJ9B 4NWLA 1H4WA 1SLWB 2W26A 1YCPH 4XBCA 5K7RA 2BYAX 1SB1H 3D49H 1C5UA 1CGIE 1TONA 1AD8H 1UCYE 3EE0B 1H8HD 2GCHG 3TJVA 1MZAA 1HGTH 3PMJA 3RXBA 1C1SA 1NESE 3BG4B 2PFEA 3PWCA 9ESTA 5J4SA 1TNHA 5JBTA 1JOUB 2ZO3H 5DN6D 2ANMH 1B0EA 1H8ED 4CREA 1C5OH 2ZQ2A 3D23A 3N7EA 1K1JA 1C1PA 1ZTKA 2A32A 1GI3A 1O5FH 1MTSA 2Y7XA 5BRRE 2AMPA 4Q7YA 2C90B 3HGPA 4ISLA 3ZVDA 3PMHB 2AGEX 3ZVAA 5DO4H 2HVYB 1GI8B 1VITH 2VVCA 1GJDB 1TRYA 3ZVGA 1TX7A 1D3QB 1D6RA 4CRCA 2BQ6B 2EI8A 2OINA 3AW0A 1O36A 4I86A 2XOKD 4CRAA 4AG1A 4X8UH 3S9CA 3EDXB 2CGAA 5A2MH 4TY6A 1MBMA 2GKVE 1O5EH 3DFLA 5C0TA 1O2SA 7KMEH 1NU7B 3A7YA 4MTBA 2VH0A 1PJPA 3URCA 1V6DA 1YLNA 1RTKA 3ATKA 3KYGA 3D62A 1TX6A 3SI3H 3PRBA 3P95A 1G3CA 3GDUA 2ZFFH 4WWYA 3TJOA 4CRBA 1NC6A 3V3MA 1GI7B 1OSSA 1KY9A 1ELVA 1GVZA 2CN0H 1GMCF 3RU4T 5T6FA 2A5IA 1TNLA 3GYLB 2SFAA 3UTUH 1ELCA 1G3EA 4YOJA 2P3UB 2IJD1 2C8YB 1DE7H 4J1YA 1HFDA 1FY1A 3FAOA 1FXYA 2F9OA 3BTQE 3I29A 3V12A 5JBCS 3SHCH 1IQJA 3MHWU 3AK5A 3E0NB 5A8YA 1GJBB 2PW8H 2HWLB 5C1UA 1T4VH 1BCUH 1BMLA 3A87A 5ESBA 1PYTD 5C1XA 1HAXB 1C2IA 4D8NA 4O03A 1CHGA 1KTTB 5DPAA 1IQEA 1N6YA 2BY8X 1IQMA 1T4UH 1F0UA 1EB1H 2A45B 1SOZA 2SGEE 1BTWA 3F2HA 1FAKH 2XC5A 5GPIB 1RFNA 2GZ7A 1CA0B 1CT2E 5EOKA 3ENSB 1S83A 4IC5A 1QB1A 4I8LA 2A7CA 4P00A 4TPIZ 3H09A 1RIWC 5AFYH 1BA8B 4ZROA 2K1QA 2ZFRH 1C1UH 2NU0E 1SQTA 5PTPA 1IQNA 1PQ7A 2CK3D 1GPZA 5JBBS 4I8HA 1Z6EA 3RXIA 3SN8A 1Y5UT 2FODA 5EPNA 3V7TA 2QXJA 1HAVA 3LT3A 4RKJB 4ABJA 3SJKA 4MG3A 1GL1A 1GHWH 1WTGH 4NFFA 2ZFTA 3TGIE 3U1JB 2FOGA 1SQOA 1GI6A 5DJ7A 4RKOB 1A7SA 1EQ9A 1Y5BT 1TB6H 2TPIZ 3UFAA 4DURA 3VXEH 4JZ1A 2CJIA 2ZA5A 4ZKRU 2H9HA 3KEEA 1JBUH 3PLPA 1C2KA 3JZ2B 1Z1JA 2Z6BD 1V2ST 2EI7A 1H8IH 1BUIA 1MQ5A 1F92A 3SI4H 5B6OA 2UWOA 1C5QA 4RT0A 4AC9A 1DWDH 3VB3A 1CBWC 2AFQB 4DG4A 3A8CA 4KELA 1C1TA 1XUKA 2VGCB 3RXVA 4AX9H 2ZHEH 1QL9A 1TNGA 2WYJA 2WPMS 3DUXH 4X2YA 5LPFA 4P02A 1C2MA 3AVZA 1C5RA 1TBZH 1QB6A 4XD7D 1TPAE 3OTJE 3TPIZ 3IITA 4YOGA 1S85A 4Y71A 1WOFA 4Y0ZE 1H9LB 3GY2A 1K1OA 2VB0A 3I78A 3PO1B 1FN8A 4SGAE 4A1XA 1EJNA 3MU0A 4XBDA 5EQRA 3PYHA 2BMGB 2GCTC 1MU6B 1UVPA 1BTUA 1EOLA 3F0PA 4Y10E 1OWHA 1E35B 2I6QA 1PPZA 2Z3DA 2ZGBH 2Q6DA 2ZTXA 1SGFG 1KLIH 1SGFA 1EAIA 1BTPA 1Y3YA 3FP8E 7ESTE 1ESTA 2AERH 2RCEA 1TA6A 4I8KA 1LO6A 4OGYA 1L2EA 1Z8GA 3E6PH 5HKKD 1TLDA 1P2IA 3FP7E 4D9QA 3SQHE 4NGAH 3IWMA 1A1RA 3A83A 1BJUA 1FY5A 3BTEE 1NFXA 5LH8A 1TGNA 2AGGX 3PWBA 3SOSA 4ACAA 1VITF 2P16A 3GCTF 3PV4A 1XVMA 1D3DB 4BXSA 1FNIA 2J38A 2AMQA 3MYWA 2L74A 3VGCB 3FANA 1XVOA 1DY8A 2GMTC 3KQDA 4AGJA 1DLKB 1C1OA 5CHAB 4D9RA 2PSYA 3EGKH 1O5DH 4ABGA 2L6OA 1SMFE 5A0CA 2ODQA 3M5LA 2SGFE 1EPTC 1P03A 5FXLA 1S84A 1V2VT 2A4RA 1Q31A 2A4OA 2UUYA 4XFQA 2KCPA 1YM0A 3SQEE 5L2ZH 3S7HB 2A2XH 2PR3A 2QYIA 3ODFA 4Y76A 2G00A 2OK5A 3C1KA 3ZZCA 1CU1A 4ASHA 1PPEE 1AN1E 1E0FD 1KDQB 1P2OA 5HM2A 1N8OC 1ESBA 4F55A 2VINA 1ZTLA 2EI6A 2NU2E 1MUEB 3F2FA 4INLA 1RIWB 1T8MA 4Y8YA 1UK2A 5FX6A 2OD3B 5TCAA 1W11U 3RMNH 4GLYA 2XNIA 1GCDA 3BTDE 4B6EA 3MI4A 3RXRA 4AORA 2P94A 3UNRA 4X6PA 1UTQA 1TQ0B 1XMNB 1BHXB 2H6MA 1C1QA 1BDAA 1E34B 1LHCH 1SHHB 2DE9A 1KDQA 2ZGHA 2A7JA 1CHOG 3AAVA 4A1VA 2SGPE 1C1MA 5DSFA 3RXUA 4DIHH 2FDAA 3GY6A 4JCNA 1BITA 2GDDA 3LGTA 5JPMH 1F2SE 2YNAA 4BTTB 2FI5E 2W3KA 4ZAEA 3OFND 1O2HA 4YESB 3F3BA 3ZVEA 1YWUA 6GCHG 2RFKC 3N7OA 3TH2H 5F8TA 1W13U 4BXWA 2IPQX 2VWMA 1MTWA 3SBKA 5F8ZA 1AKSB 3M7UA 2EA3A 1SGNE 2J98B 2W3IA 4NWKA 4YLUA 1HAOH 1SFIA 3MH6A 1YLDA 4IMZA 4X8VH 1ZGVA 1FIZA 1WQVH 1QRZA 1GJ5H 3NKKA 3LPRA 1SLVB 5SGAE 1ZSJA 1CQQA 3CS0A 2BD4A 8GCHF 4A1TA 2G81E 2BDHA 3LGIA 4ZKSU 3S69A 3PB1E 4AB9A 1BTHH 1IQHA 4FXGH 1AE8H 2KAIA 5DP6A 3ITIA 1O3EA 1Z8RA 1W10U 4UDWH 2A31A 1AKSA 5C5OA 4UFGH 4CRGA 2J98A 1WYKA 2XTTB 5A8XA 2FOFA 1H9IE 1DSUA 1SL3A 1O2UA 1GBIA 2BDAA 2GV7A 1JMOH 2D2DA 1ZMJA 2GCTB 1KLTA 3F2GA 1SLXB 1P02A 2VH6A 2F91A 5H4IB 4B73A 2OC0A 3KQCA 2F9PA 1GDUA 2UUFB 3S0NA 3QK1A 2STAE 1GBBA 4AFZA 2M5TA 3SU6A 5DK1A 1J8AA 3LGVA 5GCHF 1MKWH 4F4OC 1QA0A 4WVPE 4OS6A 4YZUA 3TJNA 1H8DH 2XBVA 1W14U 2RG3A 2J5UA 3EA8A 4JYTA 4TYDA 1XKBC 2JH6D 3EE7A 5T3HA 4RT1A 1V3XA 1ZYOA 1LVOA 5JB8S 3EAJA 5EJLA 2BY5X 4CRFA 4XBBA 1NU9A 2ESTE 2B7DH 3T5FH 4GCHF 1GDNA 2ZGXH 1ZTJA 3ATIA 2PUXB 2OTVA 1QJ1B 2G4TA 4Z0KA 1TNIA 2FLRH 5EU8A 4SGBE 5IYTA 1FZZA 2BX3A 1S6FA 1WBGB 3OAAD 3UIRA 3VXFH 3LKWA 4NCYA 1CVWH 1OX1A 4FVBA 1O2MA 3SNAA 4YM9A 2FMJA 1A46H 4IW4E 3RXFA 1OS8A 2ZU1A 3DT0H 3UQOA 3MWIU 5EQSA 1N8OB 1MU8B 2K8IA 1QCPA 1O38A 2XBYA 2XRCA 2FEQH 1SGCA 5GDSH 1EPTA 2BD9A 3I77A 4J2YB 1BTZA 5L30H 4NA9H 2A7HA 4Y7AA 2HALA 3SUDA 1KXCA 3ZVFA 4A6LA 3BV9B 2IOTA 1P09A 5T6GA 1T8OA 2VIOA 3MNSA 1P3CA 4XSKU 4CBOA 1NRNH 2WV4A 1S6LA 1Y8TA 1F0SA 2V3OH 2WPJS 3A86A 1UJ1A 2V35A 1OOKB 3K6ZA 2J94A 3BTWE 1ESAA 1KMHB 1YPMH 3W1EA 1Y3WA 4HG6A 3TH4H 1O2VA 1GJAB 1IHSH 3SO3A 5DP5A 2CF9H 1P01A 1TPOA 1LPZB 1TGTA 1P2NA 3M35A 1K22H 1DICA 2UUKB 2ZDLA 1SGYE 2HNTE 5EW2H 1O3MA 1OWKA 3SORA 1O3IA 3HK6B 1G36A 2QN5T 4BOHA 1ZSLA 3HATH 1S0QA 1XXFA 2OP9A 4H6TA 3PTBA 3QWCH 4WF8A 1OP0A 1QBVH 2HVXA 3T28A 1YF4A 4ZH8A 1ZHRA 2FOHA 1C1RA 1A4WH 2ZPRA 4X8TH 3QZQA 3VB5A 2H2ZA 2BD2A 5TJXA 2QF3A 4IMQA 3DSGA 3TU7H 1KLJH 1A0HB 1UTKA 2GZ8A 4AYYB 1XUJA 1IQGA 2BOHB 2NU3E 3UQVA 1TRMA 1IOEA 2ZNKH 3KN2A 4Y0YE 3OY5U 2AIQA 1C4U2 1MD7A 1QQ4A 4CHAB 1K1PA 1O30A 4B75A 2VIQA 1Q3XA 1AMHA 1O3DA 4JZDH 5A0BA 3DD2H 2CXVA 1S82A 5F6MA 1Q2WA 1Z8JB 2STBE 4PROA 1V2PT 4WXIA 4M9FA 1GHYH 2XWAA 1QHRB 1TRNA 1ZPBA 3K2UA 3SGQE 2QXIA 4WMFA 3WWBA 4JZIA 2P3TB 4RN6A 1ANDA 3BIVH 4ISIH 1W3CA 1P8VC 1C9TA 1K1LA 4MNVA 1K1MA 1BT7A 1UTNA 2ZC9H 2BXUH 1VJAU 3KQ5A 1TOMH 3T27A 1A61H 1QR3E 3FO8D 3RXJA 3SNBA 1L0ZA 5AHGH 1OP8A 2V3MA 3SGBE 2Z94A 1MZDA 3H7TA 1XKAC 4X1RU 5EXLA 2YMSD 1EJMA 2BY7X 4ACBA 1HAIH 5E8EH 1PPCE 3BTME 5IDKA 1RJXB 3SJIA 2JDID 3A85A 1EB2A 1W0KD 1AB9C 3ZIAD 1C5YB 2K0QA 2BZAA 1C1NA 3NRLA 3RU4D 3AAUA 1NN6A 2XWBI 2HRVA 1V2MT 4Y11E 4F49A 1GBDA 3ODDA 2BX4A 3MNBA 1QY6A 4OS1A 4TWWA 1JRSA 5IK2D 1CO7E 1TAWA 3U8OH 1F5RA 1RGQA 4FOUC 2FYQA 3A7ZA 3M5MA 3GCHC 3RMLH 1A0JA 1TQ7B 2EEKA 1MTVA 2VWLA 2FI4E 5HMAA 5CE1A 1TOCB 3TNTA 1T8NA 1DXWA 1SQRA 1A5GH 3UPEA 4DOQA 1U6QA 1EAUA 2P3FH 1GJ6A 4FUDA 1PQAA 3MH5A 1O2JA 8ESTE 2Q1JA 1ZPZA 3WY8A 5C67A 2AEIH 4A7IB 4NIVA 3P6ZB 2A5AA 1BOQA 2CMYA 2ZPSA 5EGMA 3UWIA 3WW7A 2H5CA 3RXMA 3ZZBA 2GJGA 3FKSD 3Q3YA 3A7VA 1GBHA 5E0JA 4NA8A 4BAQB 1KXBA 1GHVH 4TPYA 1EATA 1DITH 1C2GA 2BM2A 1Y5AT 1FMGA 1ZR0A 2O8TA 1HAVB 2V6NA 1YP9A 3RM2H 4IGDA 2SGAA 2QCYA 3T2NA 1QB9A 2BDGA 1S6HA 4KKDA 4NSYA 3BTGE 3FFGA 2ANYA 1ZSKA 4K2YA 2PKSC 3RXCA 2Z7FE 1G3DA 1NY22 3F9EA 4K69A 2F9UA 3CS7A 2ALPA 2DE8A 3GY3A 1FAXA 1GBLA 1TMUH 1TWXB 4X6OA 1ZMNA 2BVRH 2WPDD 3MH4A 4Q7ZA 3MOCA 3F1SB 4X6NA 2WZQA 1SFQB 3PV2A 3SV8A 2GCHF 1NTPA 3E3TA 4BAOB 1J16A 1GMDG 3K6YA 3SUEA 2ZU5A 1LDTT 1DT2A 3PRDA 3SGAE 1QA7A 1HAPH 3SU1A 2H9TH 1MABB 3M7QA 1VCPA 3RXLA 2WUBA 4I8GA 1W0ZU 1BIOA 5DGJA 2ZG0H 2FOMB 1S81A 2HNTC 1UTPA 2JJ2D 4OGXA 1C5LH 4LXBH 1O39A 4MLFB 1GVLA 1ZJKA 1OWDA 1GBKA 1D9IA 1O5CB 1O2QA 1C5NH 4RSPA 4Y7BA 4GHQA 5HYOA 1EFRD 2GZ9A 4BANB 1P11E 1TGBA 2OXSA 4BNRA 4HTCH 1T7CA 1GBFA 1VR1H 2A5KA 3F9GA 3GCNA 1P57B 3ELAH 3FZZA 2BTCE 1GBAA 3MNCA 1J9CH 1E37B 1AUTC 1FPHH 2ZDNA 1W2KH 1WSSH 1O33A 1GMHG 1LPKB 2AS9A 3BN9A 4NSVA 2NWNA 3TJUA 1TNKA 1EAWA 2PGQB 1QJ7B 3BTTE 1C5TA 4ZUHA 2PLXA 4ISNA 3OYPA 1UVTH 2VNTA 3TITA 3SV2H 1DX5M 1SGPE 4U01A 1AI8H 1DSTA 4RI0A 2Y80A 4ABBA 1LVMA 4ZKNU 3V13A 4OM9A 1HUTH 5A0AE 1PPFE 2P59A 4JZFH 4Y79A 1IQLA 1WAYB 1ABIH 3SJ9A 1LHDH 3DHKH 2LNCA 1SGDE 2KFWA 4YTAA 5F03A 4ASUD 1ELAA 2VIWA 3ZZ8A 1AWFH 1W12U 5FPSA 3RC5A 1T31A 2V0BA 1C1VH 3S7KB 5DP9A 1TPSA 4UEHH 1YPGH 4CBNA 3GY4A 3TIUA 3ATLA 3BTKE 1PPGE 2FXRA 2WV9A 3ZZ9A 1GG6C 1V2NT 1B0FA 2Y81A 4FETA 5BPEA 2F4LA 1BRUP 5FAHA 1O2PA 1TBQH 5ESTE 2FX6A 2VIPA 1XX9A 2G52A 4IN2A 1E36B 2UUJB 3Q3XA 2FPZA 3KQBA 1CT0E 2FOCA 2GT7A 2J2UA 3OE7D 3B8JA 1DM4B 1NM6A 3FOAA 2VIVA 2BHGA 2C8XB 1GMDF 4HGCA 3U69H 2CF8H 2WUCA 1FUJA 1LHFH 6LPRA 2XC4A 1CA8B 1RS0A 1O34A 2WPKS 3OU0A 3GDVA 1OYQA 1G30B 1JWTA 1O3CA 3TLOA 4YT6H 3UY9A 2H1UA 1BRCE 4MNXA 1RXPA 4QT8C 2D1JA 1Y59T 3DSOA 1DPOA 3LGWA 4ABAA 1RD3B 4INHA 1CE5A 2OBOA 2JJ1D 1DWBH 1S0RA 1P10A 3SU5A 2FTLE 2IJOB 1GVKB 1YPEH 1YGCH 1ETSH 1L1NA 4Q4LA 1C2DA 2TGTA 1G2MA 2D26C 2HLCA 1NRRH 7GCHG 3Q76A 2R2MB 2TGDA 4WMDA 5GXPA 4A5TS 1LQEA 3IG6B 2FZZA 1UK3A 1HLTH 8LPRA 1T32A 1GDQA 4KGAA 2AMDA 4B6FA 4MQAA 3QO6A 4ZHMU 1G3BA 3KF2A 1O3JA 3VG8A 1C9PA 1O5GH 2KAIB 1BQYA 3MO3A 2XYAA 2Y7ZA 1WTHD 1C1WH 1DVAH 1DXPA 2Z9IA 3M36A 1CBWB 3QDZB 1YPHE 5HIYA 1LTOA 3GDSA 1OYTH 3UNSA 1GJCB 2BVXH 1THSH 4FUHA 5J4QA 2ZU2A 3STIA 1GHAG 3E0PB 4YO9A 5AVDA 1YCPM 3O8CA 3LDXH 1O31A 1GL0E 4GHTA 1HCGA 1O3HA 1BBRK 2BB4A 2G5VA 2ZQ1A 3PROA 1FV9A 4JMYA 4BAKB 1XUFA 4NA7A 1SGEE 2GTBA 1Z7KA 1EASA 1AO5A 1FJSA 3FN8A 1MCTA 3RXEA 3FP6E 6ESTA 4BAMB 1FI8A 2ZPQA 3ZZAA 1VGCC 3U8RH 2ASUB 2SNVA 4UFEH 4LK4A 3ZZ5A 3ESTA 5JB9S 1QJ6B 4B2AA 2BD3A 3O8RA 2JETC 3MQKC 4Z1MD 2I6SA 3P92A 1EZQA 4ZXYH 1YPKH 3ZVCA 1AY6H 1ETTH 3U98H 1HXEH 2CV3A 2IN2A 1LKAA 5T6DA 1SGTA 1G9IE 1SGRE 3OTPA 1TGCA 3ATMA 1XUHA 2BLOA 4R8TB 3PLKA 2C93B 4F48B 1KXEA 2A4QA 1MCVA 2PP6A 3L3TA 3TK9A 4MPWA 1BMAA 4I8JA 5L6NH 1V2UT 1UVSH 2ODYB 1F0TA 1GCTC 3BTHE 2ZKSA 4OS2A 3TK6A 4CH2B 1C2JA 4HZHA 4NFEA 1MKXK 2EC9H 1W7GH 1EXFA 3F9FA 3S9AA 1O3AA 1A3EH 1O2OA 1AWHB 1P2KA 1XUIA 1PPBH 3KHVA 3O8DA 4CH8B 1NS3A 1PYTC 1N1LA 4XDEA 1IHTH 1GJ8B 4NZQA 3BG4C 1WUNH 2RA3A 1TABE 2J97A 1GG6B 1GGDC 2ANWA 2O8UA 5LGOA 2GMTB 4YXWD 3A7TA 4TY7A 3ZZ6A 1O2TA 1ELFA 1OWEA 1YKTA 3LJOA 1TE0A 2W7SA 2F9VA 1EPTB 2Q6GA 1ORFA 1O2GH 2AIPA 4O3TA 1DDJA 4DY7B 2XXLA 1H9HE 2WSSD 3F68H 2FOAA 3RXDA 1HPGA 1E79D 3A81A 2ODPA 3MFJA 2JH0D 4OS4A 4UONA 1ACBE 3VFEA 1CHOF 4BTIB 2WPIS 4INKA 7GCHF 2R9PA 3O8BA 1NPMA 5EQQA 2C3SA 1B5GH 4HFPB 3EQ0H 1WQSA 2QC2A 3LOXA 3SV9A 1N6XA 1MH0A 1A2CH 4IBLH 1FN6A 2FP7B 1SR5C 3NK8A 2ZECA 4GUXA 5EW1H 1NBMD 5B6LA 1LHGH 1BHXF 3A82A 1NRSH 6GCHF 3E91A 3PLBA 1O2XA 2FIRH 1UCYK 3EA7A 2W6JD 4B2BA 4FUIA 3KYFA 2BY9X 1ZRKA 1DS2E 4DGJA 2ALVA 1MTUA 1P2QA 3M3TA 1O3OA 4Q80A 3RC4A 3RP2A 2XCNA 1ANBA 3S9BA 1T8LA 2LELA 1TX8A 3RMMH 4K1EA 1AZ8A 3RC6A 2BOKA 1GHAF 3SNEA 4LZ4B 1D3TB 2Z9KA 4GPGA 3GICB 3QTVH 2FI3E 4UFFH 4ESTE 2HPPH 4NIWA 3NCLA 2F43B 1VZQH 5DP4A 2VJ1A 4AOQA 4D7FA 1HJ9A 1HAZB 1UVUH 3PMAB 4IN1A 3A8DA 3SNCA 2FYRA 2SGQE 5FX5A 1ETRH 4Q2KA 3WWFA 4B74A 1W0YH 1V2KT 3RXPA 2Z9LA 1EJAA 3RXGA 1UTJA 1OP2A 3RXHA 3ZVBA 3SJ8A 1EP6A 1SHYA 1LMWB 3T25A 4E06H 2AH4X 1AE5A 2VWNA 3JZ1B 1OWIA 1DANH 9LPRA 2ZIQH 2PGBB 1GMCG 3VB4A 1CA0C 3P17H 3CNRA 1EX3A 1NT1A 3F0OA 1HAYB 2VVVA 2ZDVH 1TGSZ 1Y3XA 1O2WA 1BTXA 2RDEA 2OQUA 4O97A 4CR9A 1MQ6A 2FWWA 4K8BA 3RM0H 4JK6A 5ABWA 1C5PA 2P8OC 4ABHA 3RXSA 1V2LT 1VCQA 1VGCB 3E1XB 3ZV8A 2GVFA 2B5TB 1JIRA 2C8WB 1KTSB 2PWXA 3RXTA 2JIZD 2Q6FA 1V2WT 1Z8IB 1TNJA 4GSOA 1BJVA 1DY9A 1O2YA 1V2JT 2FS8A 1EKBB 4DT4A 1C5MD 1AZZA 2AYWA 2R3YA 5ETXA 5KGOA 6CHAC 3TGKE 5FCRA 4WXVA 4B1TA 3U8TH 4O9VA 1YPHC 3MU4A 3T29A 2EQNA 1GBJA 3M5OA 5T1VA 1O2NA 1P06A 1GCTB 5EXMA 4FUFA 1YPLH 4ABFA 5EJ1A 2WPLS 4X6MA 2PHBA 4TWYA 2O8WA 4AFSA 3M3VA 4MVNA 3SHAH 2ZU4A 3QN7A 5G4BA 2ZU3A 2PKAA 2FS9A 5A09A 1PPHE 5F53A 1LQDB 1C5VA 1O3BA 2Y5HA 4NIYA 2PV9B 2WPHS 3U1IB 5GIBA 1GGDB 4I33A 1FDPA 4XE4A 1GJ7B 1SSXA 2VGCC 2ZI2H 2ZFPH 4JYVH 3STJA 1GHZA 1H1BA 1A5HA 2G55A 1D3PB 1J14A 1FONA 2F83A 1WV7H 1HAGE 2KZ4A 3MU5A 4B71A 3BF6H 1NROH 1UK4A 1MBQA 1A3BH 1CT4E 1NFWA 2F9BH 3EYDA 5C3NA 4OS7A 1TBRH 4ZKOU 5EPYA 2BXTH 3PO1C 4CR5A 4X0WU 1LVBA 3A80A 3UOUA 1E1QD 1TYNA 4MPUA 2LP6A 1HBTH 4UD9H 3URDA 3RDZA 4B76A 2KCOA 3RLYH 4YT7H 1ZLRA 1TIOA 2J92A 1CGHA 4H4FA 1MAXA 3KIDU 2J9NA 1YYY1 2V3HH 2C4FH 4VGCC 3KCGH 1SLUB 4WH8A 4OS5A 2A1DB 1BRBE 4U30A 4XRNA 8KME2 1F7ZA 1TMBH 3GY8A 2QE7D 1JXPA 1ZHPA 2ZHDA 1P0SH 3NZIA 1O2KA 2BLQA 2A2QH 4DIIH 1P05A 2GDEH 2TBSA 4K60A 1FIWA 3KL6A 1RTLA 1K9OE 1QBNA 2VVUA 2W6ID 4ZMAH 2KCAA 1D6WA 1NFUA 4I32A 4I7YH 1HNEE 3MU1A 1YPJH 3SW2B 4ISHH 3TH3H 2BQ7B 3ZV9A 4E7NA 5C5NA 1K1IA 1PQ8A 2PUQH 2FOBA 2G5NA 4FUBA 3VGCC 4A92A 2O8MA 1SKYE 4WY3A 5CHAC 4X1NU 3RXQA 3TGJE 1O3LA 1AQ7A 3F9HA 2TIOA 3BSQA 2BLWA 4ABIA 1HIAB 1HV7A 2FTMA 2QA9E 5HXFA 1DUEA 1HJ8A 3N99A 3P8NA 3A8BA 4ABDA 5CDFE 1SGQE 1O32A 3ZZ7A 4AFQA 3ATWA 1AUJA 2HPQH 4MDSA 4FUEA 3Q00A 1SPJA 1K21H 5I46H 3AW1A 1NZQH 3A89A 3PMBB 4K1SA 2PSXA 1VITG 1ARCA 3LH3A 2HGTH 3GCTG 4ZXXH 4BTUB 1C4V2 4NG9H 3SYJA 2H9EH 2WINI 4K5ZA 1HB0B 1GBEA 3W95A 4Y6DA 1HIAA 1GI0A 3ZZ3A 4ZHAA 3VB6A 1G2LA 2ZGCA 1Y3VA 2P8OB 1EOJA 1M9UA 2P95A 2QY0B 2BD5A 2AGIX 3BG8A 1GHBG 3RU4E 2R3UA 2GGVB 2ULLA 2BZ6H 2ZCKP 1ZMLA 4THNH 1GI1A 1YCPK 1C5WB 2BDBA 4E05H 1FQ3A 1ANCA 1Z1IA 4JK5A 3UB0A 3LONA 4CRDA 4AB8A 5LPRA 2VBCA 1SGIB 3N7DA 1YY3A 2NU4E 5DG6A 3GY7A 1ZOMA 6CHAB 1DWEH 1K28D 4I31A 4IC6A 1QRXA 2ZFQH 2ZF0H 1S5SA 2TRMA 3H5CB 3QGJA 1HDTH 5E2PA 1FPCH 3W94A 2ZCHP 3SU4A 1HJAC 1ELBA 2J4IA 1KSNA 2BVSH 1YC0A 1O2ZA 4XOJA 5C2ZA 4Y8XA 1TPPA 1EZSC 1COWD 2ZEBA 1MMJN 5EODA 3RUOA 3MO9A 4LZ1H 2BY6X 1KYNA 1BB0B 1O35A 1WXRA 3NPSA 3KNXA 3SU2A 5AF9H 2G4UA 3RXAA 1HYLA 3C27B 4X2WA 1BTYA 2ZWLH 2CHAC 3DFJA 1FY3A 4DVAU 5JDUB 4R0IA 3QZRA 1P9SA 1Z71A 1GWAA 3SV7A 2FX4A 1ZGIA 1AB9B
chains in the Genus database with same CATH topology
3MTYA 4DJZB 4H42U 1QGFA 3VB7A 4DT7B 2R0KA 3CENA 3MU8A 1BBRH 1EUFA 5DP8A 5FHTA 1GI9B 4JZEH 2ZFSA 1BMNH 3BTFE 1ARBA 1IQFA 2Y6TA 3L33A 3L6PA 3ZYDA 4MPXA 3GCHB 1VJ9U 3SU3A 1NRPH 1SOTA 2BDYA 3M3SA 3SV6A 1SC8U 1JIMA 4VGCB 3A88A 8GCHG 3KQEA 3EA9A 5AFZH 4AYVB 2ZZUH 3A7WA 1ELDE 4WJG2 2UWLA 2UWPA 1AU8A 5HGGA 4B2CA 1FY8E 2B9LA 2R2WU 2OCVB 5L2YH 1QQUA 5FBEA 2OUAA 2ZHFH 3TVJB 2QIQA 2ANKH 2XBWA 1AIXH 7LPRA 4H6SB 3QX5H 3VPKA 1MKXH 1INCA 1V2QT 4WH6A 2PTCE 1ZPCA 1K1NA 3ZYEA 1AFQC 1QBOA 3A7XA 3R3GB 1LKBA 2OC8A 1MAYA 1GHBF 4Q7XA 2SGDE 3A84A 2VIDA 1THRH 5GCHG 4GAWA 1O3FA 1TMTH 3M61U 1IAUA 2PKSB 1QL7A 2ZHQH 4AG2A 4AN7A 3F6UH 3GYMA 2Z3CA 1GBTA 3LGUA 1UTOA 4Y8ZA 1Z6JH 1C2HA 4O3UA 1GJ4H 1J17T 1MTNC 3RMOH 3TK5A 2XCFA 1C5XB 1L1GA 2W5EA 1IQIA 2FESH 3BEUA 4ABEA 4FUCA 4GCHG 3E90B 5CMXH 3RXOA 1WU1A 4WMEA 4X8SH 3LGYA 3M37A 3GCOA 1PFXC 2BDCA 2ZP0H 3LH1A 2OLGA 3E16B 4IS5A 2OC1A 1C5SA 3HKJB 3GISB 3H7OA 1O0DH 1C4Y2 2QXHA 2A4GA 1THPB 3UOPA 1XM1A 3OX7U 2QAAA 4U2WA 2Z9GA 4FU8A 4U32A 1AGJA 2QV1A 1ZRBA 2TGAA 3PM3A 5EG4A 2FM2A 1OWJA 4ISOA 5C1YA 1GMHF 2ZCLP 1LPGB 4X2VA 1J15A 4MNYA 2XW9A 1UCYH 3HK3B 1ABJH 4X1QU 5E0GA 2R0LA 3T62A 1OXGA 1HRTH 3UWJH 1DLEA 1EP5A 4FVDA 3U9AH 1HJAB 3LIWA 2B8OH 4AGKA 1YLCA 4X1PU 2THFB 1V2OT 2FO9A 3CP7A 3BEIB 3UR9A 2NU1E 2ZDMA 3RLWH 3BIUH 5DP3A 3VEQB 1UMAH 1G37A 3GOVB 3NXPA 3HKIB 3UR6A 2VWOA 4X2XA 5F8XA 2QXGA 3K65B 2CHAB 1UTLM 1C2EA 4AZ2B 1L1JA 2XC0A 2J95A 1W7XH 3FZDA 3T26A 4Z6AH 3NUMA 1ELEE 3A8AA 5DKMA 3M7TA 4KTSA 1AVWA 1SI5H 2SNWA 3RXKA 3TNSA 2Y82A 1DUAA 5TCCA 2O9QA 1AFEH 1QFKH 4BAHB 3BEFB 4NIXA 4CHAC 2GP9B 2JKHA 2OC7A 1SBWA 2JH5D 2J34A 2WV5A 1ELGA 3SZNA 3LU9B 1QRWA 1A0LA 4DW2U 1C5ZB 2C8ZB 4HI3A 1MD8A 2BD8A 1F5LA 4FUJA 2QF0A 3OSYA 5HM9A 2BQWB 2RA0A 1KIGH 4K1TA 1DOJA 1FLEE 3P8OA 1O3KA 2O8LA 3QGNB 2ZTZA 3UREA 2A0QB 1LHEH 2LPRA 2Y5FA 3FVFB 2VU8E 1X7AC 3Q3KA 3B23B 1EAXA 2G51A 5DP7A 4FU9A 5I25A 1GI4A 2DUCA 4D7GA 3M5NA 3HPTB 1NRQH 1TALA 2OBQA 3HGNA 2YOLA 5E0HA 3E8LA 1GBCA 1JRTA 3B9FH 4DCDA 2GD4B 2FLBH 1ANEA 4MPVA 4D76A 3QLPH 1W8BH 3G01A 2F3CE 2D8WA 1AHTH 3V0XA 3ZZ4A 2FOEA 1AFQB 1AVGH 1BMMH 1TFXA 2RDLA 1QURH 1EZXC 5FPYA 1YBWA 2ILNA 2Z3EA 2XBXA 4K3JA 4FUGA 3SJOA 2IPHA 1C2LA 3SUGA 1L4DA 1UHBB 4GVUA 2B0FA 1GI2A 1KXDA 1D4PB 3LC5A 1DWCH 3P8GA 4AFUA 2OQ5A 3KGPA 3QTOH 1SG8B 3SNDA 1BBRE 1P2MA 1QTFA 2BDIA 4MNWA 5K0HA 1WCZA 1QNJA 1XUGA 1MTNB 3MO6A 1GBMA 1KXAA 2ZTYA 5FCKA 5EXNA 1XXDA 3LJJA 2GX4A 1O3GA 1B7XB 1AVXA 1UTMA 1HAHH 2ZHWH 5GJ4B 2Y5GA 1SVPA 1GI5A 1BRAA 3R0FA 4K8YA 5FBIA 1UHBA 1OPHB 1QL8A 2W7UA 1V2RT 2HNTF 3LC3A 1G32B 1P3EA 1O3PB 3DA9B 1CSOE 1NFYA 1P2JA 2H5DA 5A8ZA 1O5AB 1C2FA 1UVOA 1PQ5A 2P93A 5JBAS 1ZHMA 1DFPA 4KP0A 1HXFH 4UE7H 2GT8A 1O2RA 1GHXH 5E2OA 1LCYA 1QIXB 5FPTA 1OKXA 2F9NA 2YNBA 1P04A 3ZZDA 5JYIA 3P70B 4UFDH 3K9XB 1RRKA 2ZDAH 4M7GA 1UO6A 4LOYH 3MNXA 1CGJE 3GY5A 1KXFA 1O2IA 1SQAA 2HOBA 5LPEA 1IQKA 1F5KU 2QGRA 4X1SU 1NO9H 3D65E 2Z9JA 1ELTA 4ZHLU 1F0RA 1A5IA 1L4ZA 5GWZA 4JYUH 1ID5H 2GV6A 3NWUA 2TGPZ 1VCWA 3UNQA 3MMGA 4E7RG 1FY4A 4NZLA 2JETB 3SUFA 5C20A 1TA2A 2ZDKA 1O37A 1LVYA 1P12E 2BD7A 2G8TA 1K2I1 3QUMP 2PKAB 3SU0A 4YLQH 2ZGJA 1Y3UA 3OY6U 4YOIA 2BLVA 1O3NA 1O2LA 1ZJDA 1ZZZA 1EZUC 1MKWK 3Q77A 3PTNA 3MH7A 2PTNA 1E38B 1O5BB 3P8FA 2WYGA 3UUZA 1V2TT 1RTFB 4FU7A 1P9UA 1BZXE 3AASA 4KTUA 4KTCA 1GJ9B 4NWLA 1H4WA 1SLWB 2W26A 1YCPH 4XBCA 5K7RA 2BYAX 1SB1H 3D49H 1C5UA 1CGIE 1TONA 1AD8H 1UCYE 3EE0B 2GCHG 3TJVA 1MZAA 1HGTH 3PMJA 3RXBA 1C1SA 1NESE 3BG4B 2PFEA 3PWCA 9ESTA 5J4SA 1TNHA 5JBTA 1JOUB 2ZO3H 2ANMH 1B0EA 4CREA 1C5OH 2ZQ2A 3D23A 1K1JA 1C1PA 1ZTKA 2A32A 1GI3A 1O5FH 1MTSA 2Y7XA 5BRRE 2AMPA 4Q7YA 2C90B 3HGPA 4ISLA 3ZVDA 3PMHB 2AGEX 3ZVAA 5DO4H 1GI8B 1VITH 2VVCA 1GJDB 1TRYA 3ZVGA 1TX7A 1D3QB 1D6RA 4CRCA 2BQ6B 2EI8A 2OINA 3AW0A 1O36A 4CRAA 4AG1A 4X8UH 3S9CA 3EDXB 2CGAA 5A2MH 4TY6A 1MBMA 2GKVE 1O5EH 3DFLA 1O2SA 7KMEH 1NU7B 3A7YA 4MTBA 2VH0A 1PJPA 3URCA 1V6DA 1RTKA 3ATKA 3D62A 1TX6A 3SI3H 3P95A 1G3CA 3GDUA 2ZFFH 4WWYA 3TJOA 4CRBA 1NC6A 3V3MA 1GI7B 1OSSA 1KY9A 1ELVA 1GVZA 2CN0H 1GMCF 3RU4T 5T6FA 2A5IA 1TNLA 3GYLB 2SFAA 3UTUH 1ELCA 1G3EA 4YOJA 2P3UB 2C8YB 1DE7H 4J1YA 1HFDA 1FY1A 3FAOA 1FXYA 2F9OA 3BTQE 3I29A 3V12A 5JBCS 3SHCH 1IQJA 3MHWU 3E0NB 5A8YA 1GJBB 2PW8H 2HWLB 5C1UA 1T4VH 1BCUH 1BMLA 3A87A 5ESBA 1PYTD 5C1XA 1HAXB 1C2IA 4D8NA 4O03A 1CHGA 1KTTB 5DPAA 1IQEA 1N6YA 2BY8X 1IQMA 1T4UH 1F0UA 1EB1H 2A45B 1SOZA 2SGEE 1BTWA 1FAKH 2XC5A 5GPIB 1RFNA 2GZ7A 1CA0B 1CT2E 5EOKA 3ENSB 1S83A 4IC5A 1QB1A 4I8LA 2A7CA 4TPIZ 1RIWC 5AFYH 1BA8B 4ZROA 2K1QA 2ZFRH 1C1UH 2NU0E 1SQTA 5PTPA 1IQNA 1PQ7A 1GPZA 5JBBS 4I8HA 1Z6EA 3RXIA 3SN8A 1Y5UT 2FODA 5EPNA 3V7TA 2QXJA 1HAVA 3LT3A 4RKJB 4ABJA 3SJKA 4MG3A 1GL1A 1GHWH 1WTGH 4NFFA 2ZFTA 3TGIE 3U1JB 2FOGA 1SQOA 1GI6A 5DJ7A 4RKOB 1A7SA 1EQ9A 1Y5BT 1TB6H 2TPIZ 3UFAA 4DURA 3VXEH 4JZ1A 2CJIA 2ZA5A 4ZKRU 2H9HA 3KEEA 1JBUH 3PLPA 1C2KA 3JZ2B 1Z1JA 2Z6BD 1V2ST 2EI7A 1H8IH 1BUIA 1MQ5A 1F92A 3SI4H 5B6OA 2UWOA 1C5QA 1DWDH 3VB3A 1CBWC 2AFQB 4DG4A 3A8CA 4KELA 1C1TA 1XUKA 2VGCB 3RXVA 4AX9H 2ZHEH 1QL9A 1TNGA 2WYJA 2WPMS 3DUXH 4X2YA 5LPFA 1C2MA 3AVZA 1C5RA 1TBZH 1QB6A 1TPAE 3OTJE 3TPIZ 3IITA 4YOGA 1S85A 4Y71A 1WOFA 4Y0ZE 1H9LB 3GY2A 1K1OA 2VB0A 3I78A 3PO1B 1FN8A 4SGAE 4A1XA 1EJNA 3MU0A 4XBDA 5EQRA 3PYHA 2BMGB 2GCTC 1MU6B 1UVPA 1BTUA 1EOLA 4Y10E 1OWHA 1E35B 2I6QA 1PPZA 2Z3DA 2ZGBH 2Q6DA 2ZTXA 1SGFG 1KLIH 1SGFA 1EAIA 1BTPA 1Y3YA 3FP8E 7ESTE 1ESTA 2AERH 2RCEA 1TA6A 4I8KA 1LO6A 4OGYA 1L2EA 1Z8GA 3E6PH 1TLDA 1P2IA 3FP7E 4D9QA 3SQHE 4NGAH 3IWMA 1A1RA 3A83A 1BJUA 1FY5A 3BTEE 1NFXA 5LH8A 1TGNA 2AGGX 3PWBA 3SOSA 1VITF 2P16A 3GCTF 3PV4A 1XVMA 1D3DB 4BXSA 1FNIA 2J38A 2AMQA 3MYWA 3VGCB 3FANA 1XVOA 1DY8A 2GMTC 3KQDA 4AGJA 1DLKB 1C1OA 5CHAB 4D9RA 2PSYA 3EGKH 1O5DH 4ABGA 1SMFE 5A0CA 2ODQA 3M5LA 2SGFE 1EPTC 1P03A 5FXLA 1S84A 1V2VT 2A4RA 1Q31A 2A4OA 2UUYA 4XFQA 1YM0A 3SQEE 5L2ZH 3S7HB 2A2XH 2PR3A 2QYIA 3ODFA 4Y76A 2G00A 3C1KA 3ZZCA 1CU1A 4ASHA 1PPEE 1AN1E 1E0FD 1KDQB 1P2OA 5HM2A 1N8OC 1ESBA 2VINA 1ZTLA 2EI6A 2NU2E 1MUEB 4INLA 1RIWB 1T8MA 4Y8YA 1UK2A 5FX6A 2OD3B 5TCAA 1W11U 3RMNH 4GLYA 2XNIA 1GCDA 3BTDE 3MI4A 3RXRA 4AORA 2P94A 3UNRA 4X6PA 1UTQA 1TQ0B 1XMNB 1BHXB 2H6MA 1C1QA 1BDAA 1E34B 1LHCH 1SHHB 2DE9A 1KDQA 2ZGHA 2A7JA 1CHOG 3AAVA 4A1VA 2SGPE 1C1MA 3RXUA 4DIHH 2FDAA 3GY6A 4JCNA 1BITA 2GDDA 3LGTA 5JPMH 1F2SE 2YNAA 4BTTB 2FI5E 2W3KA 4ZAEA 1O2HA 4YESB 3ZVEA 6GCHG 3N7OA 3TH2H 5F8TA 1W13U 4BXWA 2VWMA 1MTWA 3SBKA 5F8ZA 1AKSB 3M7UA 2EA3A 1SGNE 2W3IA 4NWKA 4YLUA 1HAOH 1SFIA 3MH6A 1YLDA 4IMZA 4X8VH 1ZGVA 1FIZA 1WQVH 1QRZA 1GJ5H 3NKKA 3LPRA 1SLVB 5SGAE 1ZSJA 1CQQA 3CS0A 2BD4A 8GCHF 4A1TA 2G81E 2BDHA 3LGIA 4ZKSU 3S69A 3PB1E 4AB9A 1BTHH 1IQHA 4FXGH 1AE8H 2KAIA 5DP6A 3ITIA 1O3EA 1Z8RA 1W10U 4UDWH 2A31A 1AKSA 5C5OA 4UFGH 4CRGA 1WYKA 2XTTB 5A8XA 2FOFA 1H9IE 1DSUA 1SL3A 1O2UA 1GBIA 2BDAA 2GV7A 1JMOH 2D2DA 1ZMJA 2GCTB 1KLTA 1SLXB 1P02A 2VH6A 2F91A 5H4IB 4B73A 2OC0A 3KQCA 2F9PA 1GDUA 2UUFB 3S0NA 3QK1A 2STAE 1GBBA 4AFZA 2M5TA 3SU6A 5DK1A 1J8AA 3LGVA 5GCHF 1MKWH 4F4OC 1QA0A 4WVPE 4OS6A 4YZUA 3TJNA 1H8DH 2XBVA 1W14U 2RG3A 3EA8A 4JYTA 4TYDA 1XKBC 2JH6D 5T3HA 1V3XA 1ZYOA 1LVOA 5JB8S 3EAJA 2BY5X 4CRFA 4XBBA 1NU9A 2ESTE 2B7DH 3T5FH 4GCHF 1GDNA 2ZGXH 1ZTJA 3ATIA 2PUXB 2OTVA 1QJ1B 2G4TA 4Z0KA 1TNIA 2FLRH 5EU8A 4SGBE 5IYTA 1FZZA 2BX3A 1S6FA 1WBGB 3UIRA 3VXFH 3LKWA 4NCYA 1CVWH 1OX1A 4FVBA 1O2MA 3SNAA 4YM9A 2FMJA 1A46H 4IW4E 3RXFA 1OS8A 2ZU1A 3DT0H 3UQOA 3MWIU 5EQSA 1N8OB 1MU8B 1QCPA 1O38A 2XBYA 2XRCA 2FEQH 1SGCA 5GDSH 1EPTA 2BD9A 3I77A 4J2YB 1BTZA 5L30H 4NA9H 2A7HA 4Y7AA 2HALA 3SUDA 1KXCA 3ZVFA 4A6LA 3BV9B 2IOTA 1P09A 5T6GA 1T8OA 2VIOA 3MNSA 1P3CA 4XSKU 4CBOA 1NRNH 2WV4A 1Y8TA 1F0SA 2V3OH 2WPJS 3A86A 1UJ1A 2V35A 1OOKB 3K6ZA 2J94A 3BTWE 1ESAA 1YPMH 1Y3WA 3TH4H 1O2VA 1GJAB 1IHSH 3SO3A 5DP5A 2CF9H 1P01A 1TPOA 1LPZB 1TGTA 1P2NA 3M35A 1K22H 1DICA 2UUKB 2ZDLA 1SGYE 2HNTE 5EW2H 1O3MA 1OWKA 3SORA 1O3IA 3HK6B 1G36A 2QN5T 4BOHA 1ZSLA 3HATH 1S0QA 1XXFA