3RXPA

Crystal structure of trypsin complexed with (1,5-dimethylpyrazol-3-yl)methanamine
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxpA02
1LVBA 1VCQA 3SV6A 3LGVA 2ZQ2A 2CXVA 2H9EH 5FPYA 4KELA 1FJSA 1EQ9A 3M7QA 8LPRA 2BTCE 4DIIH 1JIMA 1LMWB 3TH2H 1ANEA 3KQEA 2ZGCA 1KIGH 1TNIA 3SBKA 2ILNA 2B5TB 2GMTB 3LGIA 1CT4E 1BRCE 3LIWA 3I77A 4CH8B 1W8BH 3SJIA 1GHZA 1OWJA 1T8OA 5HYOA 3UWJH 1YLCA 1S82A 1IQIA 1HCGA 3BEFB 1TPPA 2ZTYA 1ZRBA 1BBRH 1HV7A 1GBCA 1UCYE 1GCTC 1IQLA 3HGNA 1KXDA 1RXPA 1NRRH 3ZV8A 1EOJA 1PJPA 2G51A 4TY6A 1KLIH 1C2LA 5FPTA 3LJOA 1EZUC 3BEIB 3ZVAA 4INKA 1SQTA 1NTPA 3A86A 3LDXH 1YPHC 1MBQA 2WPLS 1FXYA 5FAHA 2BD9A 1RRKA 3RXBA 4CRFA 3P92A 4KKDA 4X1PU 1OX1A 4AFUA 4INHA 1GHYH 3QX5H 2J95A 1O3CA 4Y6DA 4INLA 2XXLA 1XUFA 1VR1H 3MNCA 1O3OA 1LCYA 1AWHB 3M5MA 3DUXH 1GBHA 1P2JA 3RUOA 1UTNA 4FUDA 1BTWA 4DURA 2GV6A 2P8OB 1O31A 2OC7A 3LJJA 3CENA 1EP6A 4IN1A 4Q7ZA 2ZU4A 1QJ6B 2HLCA 4A7IB 1YC0A 3A81A 3GICB 2F9NA 1N6XA 4ISOA 2VIDA 1BMLA 2QV1A 5G4BA 1EJMA 1LQDB 3ZVBA 1F0RA 1O2YA 1Z1IA 2FXRA 4MPXA 3RXOA 1BMAA 3ZZ8A 5T6FA 2B9LA 4CHAB 8ESTE 1GBDA 5HGGA 3MO6A 1UTMA 1JMOH 1Y5AT 3UTUH 1GJ8B 4Y8XA 1THSH 4MNVA 3TGKE 3MHWU 4YOGA 3SUEA 3SUFA 3SV9A 4K60A 1BIOA 2PTNA 4JZEH 4WY3A 5LPFA 3I29A 4WF8A 1GHBG 4O9VA 3AASA 2J9NA 3EA8A 3D23A 3QZRA 4FUHA 2BDBA 3E90B 1AFQC 1NU9A 3TNSA 1MCTA 1V2QT 2XWBI 2O8WA 1OWKA 2FOHA 5A0AE 2ZU2A 2GTBA 1NRSH 3ATKA 1OWDA 4ZAEA 1EASA 1GBJA 1MBMA 2SNWA 1CA0C 1Z6JH 2PV9B 3FP6E 1GMCF 1D4PB 2NU2E 2OC8A 1ZMLA 1C1RA 1XKBC 3M7UA 3PMJA 3TJOA 5DPAA 3NXPA 2W26A 2WUBA 2AGGX 4KTCA 1DFPA 3BIUH 3A83A 1K1NA 5C5NA 1AHTH 1NY22 1QNJA 4XBCA 1CT2E 3RXPA 1WTGH 2B8OH 1SGCA 1Y5UT 3MH4A 4X6PA 2OXSA 5FCKA 2SFAA 3NPSA 3RMOH 1RFNA 3UREA 3TLOA 4MVNA 3T25A 1H9IE 1O2GH 2ESTE 1ELTA 4ASHA 1LVOA 2AGEX 2BB4A 1LHGH 2HPPH 3GISB 1WQVH 3GY6A 2FOEA 1C5ZB 1QBNA 3QN7A 3TK9A 4D9RA 1MQ5A 3BV9B 5DG6A 4K8BA 3DFJA 3SQHE 5JPMH 3SO3A 3HATH 1GI8B 5FX6A 1AZ8A 1EX3A 1SVPA 1DX5M 1SFIA 1UHBB 4FUGA 1W12U 4O97A 2ANMH 2XW9A 2BY9X 1BBRK 5L2YH 3A84A 3GY4A 3ZZAA 4E05H 4MPWA 3U98H 4MNWA 3ZZCA 4E7RG 2QF0A 2HOBA 5GPIB 1A0JA 3RXQA 4WJG2 4FUFA 1O2WA 5FPSA 1GJ6A 1GBIA 1K22H 1SLVB 1C2HA 1G3DA 2FPZA 1NROH 1XKAC 1O36A 1D6WA 1PQAA 1C5LH 1O2LA 1OOKB 1ELEE 1TRMA 3F6UH 1CBWB 3A82A 3M7TA 4B73A 2A0QB 2IPHA 1TGCA 1KTTB 1A0LA 4JZDH 3N7OA 1V2WT 3F9EA 4FVDA 5FX5A 1FV9A 1GG6B 1AB9C 1GGDB 4AN7A 2AGIX 2B0FA 1UTPA 3FANA 4MQAA 4AB8A 1BOQA 1EZSC 2NU0E 2OP9A 1GI1A 3P8FA 3SU6A 1FY8E 2GX4A 3Q77A 5EW2H 3SJ9A 1CHOG 1SGFA 2FESH 1QRXA 1L1JA 1MTNB 2VVCA 4WMEA 1VCWA 1O38A 3MYWA 1MZAA 3BG8A 1UVUH 1C5RA 2Z9KA 1PPHE 4VGCC 2VGCC 3K2UA 1A3EH 1CHOF 1O3MA 4LZ4B 1TBZH 1ELDE 4O3TA 1NFWA 2M5TA 3T26A 3PB1E 1NC6A 1ANDA 1N8OC 2IN2A 2FS8A 2ZGXH 3K65B 1BMMH 1S6HA 3A8BA 3EYDA 2HNTE 2O8MA 2YOLA 2F83A 1PFXC 1EB1H 1QGFA 3PO1B 1O2XA 2ODYB 3MH5A 1BHXF 3SHCH 3HK3B 3P70B 3A8CA 1CE5A 1IQJA 1JRTA 3OTJE 1PPZA 2BD8A 1QB9A 5DO4H 1S0QA 1UTKA 5C67A 3RXHA 1ZLRA 3ZVCA 2I6QA 1KLTA 4UONA 3TH4H 1AGJA 3ATIA 1INCA 3STIA 1P01A 3L33A 3M5OA 1A7SA 3R3GB 2OUAA 2FOBA 1GJ4H 2QAAA 3RC6A 2VWLA 4KP0A 5GIBA 3KQBA 2A4OA 3ZVGA 2DUCA 5F6MA 2SGPE 1V2OT 4K1TA 1HJ9A 2ZKSA 5ETXA 3IG6B 1F0UA 4IC5A 1DDJA 6ESTA 1Z7KA 5A2MH 3PLKA 4Q7XA 4Y8YA 4IN2A 4Y0YE 3RXGA 4MNYA 5A8XA 1P3CA 3PTNA 5EQQA 1WQSA 5EW1H 2A31A 1WTHD 1TQ7B 1IQFA 4TWWA 3RXLA 4OGYA 1OYTH 1IQEA 2QYIA 4HI3A 3LH3A 3RXSA 1AD8H 1F5LA 1IQNA 2LPRA 2EI8A 1PQ5A 3SN8A 1DWCH 4UFDH 2BD3A 2BDGA 1TLDA 1ELCA 5C3NA 1C5QA 1ABJH 3C27B 1YGCH 5I25A 1XUHA 1SMFE 3VXEH 1E34B 1HXFH 1V3XA 1UCYK 1O3KA 2VVVA 4WMFA 1AZZA 2ZQ1A 1D6RA 4LOYH 4OS4A 3MU4A 4X8VH 1C9TA 2BZAA 5C1XA 1VGCB 3FVFB 4F49A 1TRYA 5TJXA 3PWBA 4BAQB 1ACBE 3Q3YA 1K1OA 2ZWLH 1NT1A 2AERH 2A1DB 1TMBH 1IQGA 4RKJB 2C8ZB 1EAUA 2XCFA 1T31A 2ZDNA 1AIXH 3KCGH 4BXWA 4BOHA 1W2KH 3LPRA 1GL1A 1O3BA 4UEHH 3UNRA 1SOZA 5L2ZH 3RXKA 1ARCA 4FUJA 5DP7A 4F4OC 4BAOB 1ZJDA 2OBQA 4ABHA 3W95A 1O5FH 3SJKA 1O2PA 3UQVA 2TGTA 4Y76A 3H5CB 3KHVA 1O2NA 3S7KB 3KGPA 1LHDH 1P06A 1SGTA 2ODPA 2HNTC 1DWDH 4OS6A 2F9PA 1O32A 2XBWA 7LPRA 1P3EA 2ZI2H 1C2MA 1KXAA 2KAIA 1LTOA 5CHAC 1OP2A 1SBWA 1TX8A 2PKSC 1RTKA 1W0YH 4I8LA 2ULLA 3A7XA 1FY5A 3SHAH 1GVLA 1UK4A 4OS1A 2XC4A 5JYIA 1NPMA 2P8OC 2J94A 2ZGBH 1EOLA 1C5OH 4UDWH 4ABAA 1NFUA 2XBVA 3MU8A 1V2JT 3DA9B 4JYTA 1OP0A 1JXPA 4I8HA 1O2UA 3KF2A 2XBYA 2P3TB 3LOXA 3RXFA 1C2FA 2TPIZ 1ETSH 1LPKB 1LHFH 1OYQA 2GZ8A 1KDQB 3D62A 4NIYA 3HK6B 1AVWA 1KXFA 2PUQH 2SGQE 5HMAA 2AMDA 2OC1A 1V2VT 1ANCA 1O3HA 3ZZ7A 3MNSA 1LHCH 5FBIA 1O5CB 3QTOH 2VIPA 1DPOA 3LGYA 1EP5A 5DP9A 1VITF 1QL9A 1TPSA 1UK2A 1ARBA 3NCLA 4IBLH 2O9QA 4CRDA 1O3PB 1LHEH 1Y8TA 2VIOA 4B2BA 1O5BB 2BVRH 4HTCH 4AYVB 2A5AA 3ZVFA 3K9XB 1ZJKA 2SGDE 1YBWA 5EG4A 2WPIS 3TIUA 2LNCA 1P03A 3RXEA 3VB5A 5C20A 1UMAH 2Z6BD 2F91A 5AVDA 4ABBA 3GCNA 2BY8X 3AAUA 2ZHWH 3BF6H 2BDYA 1C1OA 2QXIA 3TJVA 1SLWB 3VGCB 1TGNA 3M5LA 2W3IA 1F0SA 1B0EA 4AGJA 2FOCA 1O5EH 3ZYEA 1A0HB 4CRCA 1DS2E 3LONA 4K3JA 1GI6A 2BQ7B 3GCTG 1C1WH 5IYTA 5E8EH 1ZSJA 1GI0A 3OY5U 1C9PA 5AFZH 3T29A 2CV3A 2PKAB 2IJOB 1TE0A 4X1SU 5CE1A 2STAE 1UVTH 5T3HA 1L2EA 3ZZ9A 1EAWA 4BAMB 1TQ0B 2GT7A 3RXMA 4B74A 3LU9B 2ZFQH 1O3NA 2TGPZ 4I8GA 1QFKH 4GHQA 1CGJE 4BTIB 3BTHE 1GMCG 2NU3E 4K8YA 2VB0A 4NSYA 2WPKS 4I32A 1TBQH 1PPCE 4NA7A 3IITA 3A7WA 4HFPB 1O3DA 1C5UA 2P3UB 2BXUH 2ZHDA 2JH0D 1CA8B 5ABWA 4MDSA 3PYHA 5T6DA 1W7GH 2C8XB 2FI5E 4BXSA 2V3HH 3RU4E 1V2MT 4BAKB 2TGAA 1EAXA 1CVWH 1O3GA 1GHBF 2J92A 1DANH 1IAUA 4JK5A 2A5IA 1BBRE 3CS0A 4HZHA 1NRPH 1Z1JA 1CHGA 2GKVE 2HPQH 2Y7XA 1MTNC 1GG6C 1AI8H 1BTYA 2BYAX 3VPKA 2TRMA 2WYGA 1BB0B 5JDUB 4UE7H 1BTXA 2C90B 4A92A 1BUIA 2ZGHA 1AKSB 5LGOA 2STBE 2HVXA 1O2MA 1GBLA 3GOVB 1TFXA 1V2KT 1T7CA 1IQMA 1LDTT 1GI2A 1WU1A 4AG2A 1QQ4A 1QL8A 2XTTB 2J2UA 1TNKA 1SGFG 5A0CA 1SGRE 2BQ6B 1P2QA 3TK5A 1P09A 2FIRH 5E2OA 2FOAA 4WWYA 4UD9H 3CS7A 1YPJH 4FU8A 1LPGB 3ODFA 2QXHA 1K21H 1P2IA 1TB6H 1TGTA 4CBOA 1DXWA 4YLQH 2ZU3A 3MWIU 1O2TA 3A87A 3QZQA 1ZTLA 1O5DH 2UWOA 1S6FA 3IWMA 5DP3A 3F9HA 2FEQH 2A5KA 3C1KA 1O2ZA 3KEEA 2ZDKA 2Q6DA 2ZFSA 1CGHA 1V2RT 3SU3A 4XFQA 3R0FA 1HAHH 3ELAH 1NFYA 1DT2A 3HKJB 4PROA 4CH2B 3SQEE 1ETTH 2GV7A 1A2CH 3WY8A 2W3KA 1EZQA 3B9FH 1UVSH 2OCVB 3RXCA 2C8WB 2ZCKP 3E0NB 4ZKSU 3VB7A 3K6ZA 2EI6A 1Q2WA 3SU0A 2G4TA 2PSXA 3V13A 1ZOMA 3LKWA 1FI8A 4RSPA 3VGCC 2ZU5A 2AIPA 2ANWA 1CBWC 1WUNH 4ZMAH 1O3AA 2G4UA 3V3MA 4D8NA 4MLFB 4E06H 1LPZB 4GHTA 1C2DA 1ESBA 1XVOA 5EXNA 1NN6A 5EOKA 1UHBA 2F9UA 1K9OE 2GCHG 1WYKA 2GD4B 5ESTE 3GCHB 5JBCS 5HM9A 2VINA 3SU5A 1TONA 4I8JA 2ZA5A 1BRBE 2GCTC 2BLWA 3S9AA 4X8TH 1SB1H 4XSKU 1NZQH 4YZUA 3EQ0H 4BTUB 1SGPE 1ZHMA 1BTUA 3JZ1B 2Y5FA 2PGBB 4K2YA 1H8DH 1YP9A 5AF9H 4GCHF 1T8NA 3VB4A 3KIDU 2BZ6H 2Z7FE 3SZNA 1TNJA 1EKBB 1FAKH 1UK3A 2G52A 3VEQB 2BLQA 4I31A 4IMZA 1WAYB 3PMAB 2FP7B 2BLVA 4AFQA 1J8AA 3OSYA 2FI4E 5DK1A 3PMBB 1KYNA 4K1SA 1GMDF 5DGJA 3BTWE 3PM3A 3SGAE 3UY9A 1AU8A 1RIWB 1JOUB 1FY4A 2FODA 4NIVA 4UFGH 3GY7A 1C4V2 3MMGA 3KNXA 3SI3H 1BJVA 3BSQA 1MAXA 3F9FA 1LVYA 2G00A 3OU0A 4YOJA 2ZGJA 4OS2A 3NWUA 1NESE 2BD4A 4NWLA 4Q7YA 1FDPA 2ZDLA 1CGIE 2UUYA 1ZPBA 2GP9B 2UUJB 2NU1E 4SGAE 2BY5X 5F8ZA 4ZHAA 3KQCA 3SI4H 1CQQA 1ORFA 3T27A 4H4FA 4X2VA 1K1LA 2XBXA 2WUCA 2ZECA 1KTSB 1HGTH 2AH4X 4D7FA 2QA9E 5DP4A 1QB1A 2G55A 1Z71A 2GGVB 1Y3WA 3QUMP 2PWXA 5H4IB 5C1UA 4FU9A 2AIQA 3Q76A 2H5CA 2ZO3H 1BITA 1BA8B 2Q1JA 3MOCA 5GDSH 1C2GA 1O35A 1P11E 1G9IE 3ZZ4A 2FLRH 1ZHPA 4NA9H 5GJ4B 3GCTF 5JBAS 2WV4A 1ESAA 3GYLB 2GDEH 3ZVDA 3UWIA 5I46H 4FVBA 4CRAA 4ZH8A 5J4QA 3RXAA 1TGBA 3BTGE 3TGIE 1G30B 1Q31A 2F9BH 3SGQE 4CR5A 3FZDA 4YM9A 5A8YA 1VGCC 1ELGA 1GBTA 3UFAA 3BTKE 3DD2H 4TYDA 1K1JA 1OWHA 3UNQA 3TNTA 3BTTE 5K0HA 2VNTA 2FMJA 1P02A 1C2IA 1J17T 2FI3E 1E35B 1GJBB 2AYWA 4X8UH 3MU5A 1GBFA 1BHXB 5AFYH 1DLEA 2PHBA 1PYTD 1YPEH 4GLYA 1BTHH 7ESTE 2FYQA 3HPTB 3LT3A 1GDUA 2ZCLP 3SU4A 2QGRA 2PLXA 1DXPA 1LQEA 3BIVH 3SNDA 3GDSA 1D3TB 2RCEA 2ZPSA 1H9HE 1J15A 1LO6A 1KXEA 2BM2A 1QRZA 3D49H 2FOFA 1P2KA 4LK4A 1MU6B 1HJ8A 5CMXH 2FTMA 3AVZA 3TU7H 1S85A 1RGQA 3EDXB 3PLPA 1HAXB 1ZTJA 2JETC 3T2NA 4K69A 1C2EA 1VCPA 2H9HA 4AFSA 1EAIA 1QQUA 1TGSZ 3TVJB 4TY7A 4ISHH 5C1YA 1W13U 1OP8A 2UWPA 4WXVA 2A7JA 1AQ7A 1OSSA 2P95A 1MUEB 2FS9A 1DITH 2R3YA 2EC9H 2WINI 2XYAA 1THRH 3SU1A 2CHAC 4LXBH 3QTVH 3SORA 4YT6H 2SNVA 2SGEE 1GDQA 2GT8A 4X8SH 3AW0A 1W7XH 3H7TA 1GI5A 4ABGA 1DOJA 1GJ7B 2W7SA 4IW4E 9ESTA 4DIHH 1IQHA 2OD3B 4ZROA 1X7AC 1F92A 2XWAA 5L30H 3S69A 3BTQE 2BVSH 1GJ9B 3Q00A 3LGTA 3SNBA 1XX9A 3S9BA 1FAXA 3STJA 4ZKRU 2BDHA 1FNIA 5EGMA 2GDDA 3P95A 1O3JA 2B7DH 3VB6A 5JB9S 1NM6A 1CSOE 1UO6A 3LGWA 1E38B 3DHKH 2ANYA 4YLUA 1BRAA 2V0BA 5K7RA 1C5WB 2FTLE 1DSUA 3PROA 1Y59T 3EE0B 1ETRH 2Q6GA 4NZQA 1YM0A 5GCHF 1DE7H 1ZGIA 1C1MA 2FLBH 2PW8H 1DUEA 4BNRA 5E0JA 4YT7H 1O2IA 1KDQA 1NRNH 1UCYH 2GVFA 3M61U 1K2I1 1TABE 2ZIQH 4X6NA 2GCTB 3MO3A 2OC0A 1LKBA 1TX7A 3A88A 4J1YA 2ZFRH 2ZC9H 1FMGA 1VZQH 3ITIA 2O8TA 5BPEA 3ZZBA 1DVAH 1HNEE 2I6SA 8KME2 1P57B 3K6YA 3OY6U 3BTEE 3TJUA 1Y3UA 1HBTH 1PPEE 1A3BH 4NFFA 1ZGVA 2QY0B 1S0RA 1GDNA 1VJAU 4WH6A 5GXPA 1ZZZA 1EB2A 4IMQA 2UWLA 2H5DA 3ZZ5A 4U32A 2ZF0H 1JIRA 4H6TA 1SC8U 1SR5C 4FXGH 3SNEA 5DJ7A 1UTJA 1XXFA 4X6MA 3HGPA 3B8JA 4A1XA 4ISLA 1MQ6A 2F9OA 1HDTH 4JZFH 3MTYA 1T32A 2ZG0H 2XRCA 4JZ1A 1BTZA 2R9PA 1GHAG 3PWCA 1TWXB 1XMNB 3W94A 1SSXA 1O37A 2RA3A 4MPUA 1WCZA 3U1JB 1MTWA 1AVGH 1J14A 5EQRA 1B5GH 4IGDA 1RTFB 1V2PT 2Y82A 1GI9B 3E16B 1HUTH 1GI4A 1AKSA 2XC0A 3T62A 1E0FD 4D7GA 2ZFPH 4J2YB 3BN9A 1ZYOA 3MNXA 1ID5H 2D8WA 1BQYA 2VGCB 1G37A 1IHTH 2ZDAH 1D9IA 1G2LA 1H4WA 3SUDA 1JBUH 2VIVA 3UUZA 5LPRA 1G2MA 5EPNA 4AB9A 1XUJA 2ANKH 1YCPM 1EPTA 1DUAA 1SPJA 2HNTF 3MU0A 1QRWA 1TMUH 1QA0A 3MH6A 2XC5A 4D76A 2BXTH 1P05A 2GMTC 3P17H 1O33A 1MMJN 2OLGA 3MNBA 2R2WU 4CR9A 1S5SA 2BMGB 2ASUB 2R3UA 5A09A 1FN6A 3P8GA 2VH0A 1QTFA 3E3TA 3ATWA 3H7OA 3VFEA 1HXEH 1W3CA 2BOHB 3BG4C 5T6GA 1HAIH 1MU8B 3A7VA 1HJAC 1PYTC 1IQKA 1WOFA 3BEUA 5JB8S 4KTUA 3EGKH 4XDEA 3RMLH 2G8TA 5C2ZA 1T8MA 1HAPH 3S0NA 1GWAA 1A46H 4WH8A 3RDZA 2PSYA 1PQ8A 2R0LA 3VXFH 1IHSH 1W10U 3PV4A 4BTTB 1F2SE 1SHYA 1TPOA 4ZUHA 2ZHFH 1W14U 4X2WA 1FN8A 2C93B 3PMHB 2BQWB 1EUFA 3U8OH 1PPGE 1A5IA 1AN1E 2W5EA 3RM0H 4JYUH 2TGDA 3SJOA 1AFQB 1BCUH 1TOCB 1XXDA 2IOTA 1QA7A 1VJ9U 1GHXH 1P04A 4AX9H 4DY7B 1GHWH 1EZXC 5B6OA 1SOTA 1C5PA 1DWEH 1KY9A 1OWEA 1P2OA 1N1LA 2JH6D 4Q2KA 4Y8ZA 4JMYA 1KXBA 2A4GA 2ZNKH 1QR3E 2VWOA 3RXIA 2FOMB 1FPHH 4FUIA 3GY5A 1YKTA 2THFB 2VIQA 3EAJA 1C1SA 3SNCA 1K1MA 1SFQB 4YO9A 2ZEBA 1HIAA 1GVZA 1AVXA 2FWWA 2H6MA 3ZVEA 5DP6A 1BJUA 2PTCE 2V3OH 4ZKNU 3U9AH 3ATMA 3P8NA 2UUKB 1A61H 1ELVA 1SGDE 3UNSA 1OXGA 3TITA 1HYLA 1ZPCA 4X1NU 4Y10E 3SV2H 1MD8A 1LVMA 2EEKA 2HWLB 2NWNA 3SV7A 1C1PA 3HKIB 7GCHG 1OKXA 2F3CE 5FXLA 1TRNA 5IDKA 2BD2A 5J4SA 1IOEA 2Y80A 1MKXH 3SJ8A 2P94A 2Y6TA 2SGAA 1P10A 1J16A 1GJAB 4B75A 1SLXB 2AMQA 5BRRE 4OS7A 1O2OA 6GCHG 1ZHRA 1AWFH 1HLTH 3PLBA 3ZZ6A 3AW1A 1GI7B 4JK6A 3GYMA 1O3FA 3A7ZA 3P8OA 2A32A 1AUTC 1HAZB 2VWNA 4XBDA 1THPB 1SGIB 2KAIB 2H2ZA 1O34A 2AMPA 1UVPA 5EXMA 3FZZA 2Z3DA 2ZHQH 1DSTA 2J4IA 3A89A 2NU4E 1O3EA 1MTVA 3UOUA 1TNGA 2CHAB 1HAGE 4JYVH 3RXVA 1QHRB 2C3SA 4ZHLU 1O5AB 3LGUA 2QXJA 1T4UH 1YPLH 1XUIA 3SOSA 4B1TA 5EU8A 1ZSKA 1TAWA 4ISNA 1SL3A 3F1SB 4THNH 2GZ9A 3A7TA 2QF3A 1L4DA 1GVKB 5E0HA 1N8OB 2CN0H 5SGAE 3RC5A 3UOPA 2ZTXA 4NIXA 2AS9A 1AMHA 2D26C 4JCNA 1Z8GA 1Z8JB 3GY2A 4CREA 4B76A 3M5NA 2JKHA 3FFGA 1QBOA 3O8DA 4ABJA 1OPHB 5LPEA 4NSVA 3VB3A 1GI3A 1HJAB 1CA0B 1YYY1 4X6OA 3SGBE 2BVXH 2QC2A 2BD7A 2Y7ZA 3BTME 3SU2A 1PPFE 3G01A 3M3TA 2Y5HA 2RA0A 1MTSA 2ZFFH 3SUGA 3E0PB 4I33A 3UR6A 1FONA 1GMDG 1GMHG 3ZYDA 3EA9A 1BTPA 4YOIA 3Q3XA 1K1PA 3PO1C 1NRQH 4MTBA 1QB6A 2QIQA 4WVPE 4Y0ZE 2A2XH 3B23B 4DG4A 1HIAB 2G5NA 2QN5T 1QURH 1A5HA 4M7GA 3FP7E 2D2DA 1P0SH 1Z8RA 1UJ1A 3O8RA 1G32B 1TX6A 6CHAB 5EXLA 2VIWA 2WYJA 1YPGH 4O3UA 1F7ZA 4H6SB 2WPHS 1K28D 2ODQA 2VWMA 1L4ZA 2RG3A 1O3LA 5EODA 2ALPA 4GUXA 2QCYA 4AOQA 4Y11E 1DY9A 4SGBE 1V2UT 3QDZB 2YNAA 4DCDA 1KXCA 2V6NA 1EJNA 1PPBH 2W7UA 4VGCB 9LPRA 2P16A 3A80A 2O8LA 4GCHG 4AYYB 1C5TA 3E6PH 1S83A 4DJZB 4GSOA 1EXFA 4RKOB 1L1NA 4JZIA 3RMMH 4B71A 5GCHG 5FCRA 1XUKA 1FUJA 2ALVA 4HGCA 2OTVA 4FUBA 1QY6A 1GBEA 1ZPZA 1Z6EA 4IC6A 1GBAA 4GPGA 2A7HA 1C4U2 1KSNA 2FYRA 3M36A 4ISIH 2ZDVH 1HAVA 4KTSA 4ABEA 4WMDA 4X1RU 1ZRKA 2GCHF 1O2JA 3U1IB 1F5RA 4MPVA 1L1GA 3BTDE 1D3QB 2BY6X 3PTBA 5FBEA 2Z9IA 2VH6A 1YPHE 4A6LA 1AB9B 2C8YB 2J34A 5FHTA 2FX4A 1P12E 2Z9JA 1JRSA 2OQUA 1HRTH 1YPKH 4B2AA 1HAYB 3QK1A 3FP8E 1O2RA 4AFZA 4D9QA 1EPTB 3UPEA 1SQAA 1TNHA 5CHAB 4ZXYH 1GJ5H 8GCHG 1K1IA 1ESTA 1UVOA 1S84A 5F8XA 1V2TT 4IS5A 1W11U 4O03A 3QGNB 3RXUA 4NG9H 1WBGB 1CT0E 2OINA 1V2LT 4Z0KA 2ZU1A 1A1RA 3TPIZ 1MKWK 1TA2A 2PGQB 3BG4B 2Z3CA 4OS5A 2BX3A 4GVUA 1YCPH 4R0IA 2Y81A 2Y5GA 3A8AA 1HAVB 5DP8A 4DW2U 4FU7A 2ZHEH 2A4QA 5A0BA 3O8CA 1HPGA 1MH0A 1G3CA 1C2JA 4TPYA 1OWIA 3V0XA 4FUCA 1GBKA 1U6QA 3TK6A 3MO9A 3SV8A 2D1JA 2PKAA 2P93A 1UTOA 2EI7A 2Z9GA 2C4FH 4B2CA 5C5OA 1G36A 2P59A 3U69H 2XNIA 1RJXB 1C5VA 4E7NA 2WV5A 3MI4A 1O3IA 1Z8IB 1TA6A 3KN2A 1ELFA 1E37B 2AEIH 5F03A 3M35A 3F9GA 3F68H 1L0ZA 2VJ1A 1B7XB 1B0FA 4K5ZA 2DE9A 1Y3YA 2UUFB 1NFXA 1GMHF 1P8VC 1ZTKA 2FZZA 4DOQA 4A1TA 1QIXB 2HALA 1YCPK 2A4RA 4NFEA 6LPRA 1GCTB 3M3VA 4BAHB 3FAOA 1GBMA 1SGQE 5JBTA 1SGNE 4AGKA 4X2XA 5EPYA 1RD3B 2Z9LA 2H1UA 5AHGH 3RLWH 4H42U 1Y5BT 1N6YA 2QXGA 1FPCH 1QJ1B 4X1QU 4Y7BA 1BRUP 1EATA 1EJAA 1H8IH 1MCVA 4R8TB 2A2QH 1XVMA 1O2HA 2ZZUH 3LC3A 1ZMNA 3RM2H 1O39A 1QCPA 4NGAH 1ZSLA 3NKKA 3P6ZB 3T5FH 1DM4B 2G81E 4DVAU 4LZ1H 1F5KU 3I78A 3GDVA 4CBNA 1MZDA 4I8KA 2OQ5A 1GPZA 3GDUA 2ZCHP 4TWYA 1G3BA 4Z6AH 1RTLA 3GCHC 3Q3KA 2BDAA 1O5GH 1P9SA 2Z3EA 4OGXA 5L6NH 4UFFH 4CHAC 4FUEA 4ABIA 1ABIH 3RC4A 3URCA 2TIOA 2ZP0H 1C5XB 2CMYA 3ODDA 2CJIA 3E91A 3L3TA 3U8RH 1SHHB 1RIWC 2ZPRA 4I7YH 5HM2A 4ZKOU 4MNXA 3TGJE 2JH5D 2PFEA 1AUJA 5PTPA 1SGEE 4Y71A 2ZPQA 1XM1A 2H9TH 1D3PB 1GCDA 2CGAA 5TCCA 5A8ZA 3DT0H 1T4VH 1O2SA 6GCHF 1BZXE 2SGFE 1GL0E 3E8LA 1FY1A 1KLJH 2R0KA 1Y3VA 1D3DB 2Q6FA 1C4Y2 3GY3A 5HXFA 2A45B 4U30A 1RS0A 1DY8A 2PUXB 2BLOA 2BDIA 3URDA 1GGDC 1G3EA 4XE4A 5ESBA 4A5TS 7GCHF 5LH8A 2BOKA 1FIWA 3S7HB 1SI5H 2BDCA 3OYPA 1SGYE 3NK8A 3DFLA 5DP5A 1HAOH 1ANBA 3JZ2B 4NZLA 3TH3H 3ESTA 1AY6H 1MKWH 3V7TA 4DGJA 4AG1A 4KGAA 4YESB 2YNBA 3UR9A 1VITG 3ZZ3A 1SG8B 5E2PA 1CU1A 1JWTA 4UFEH 4BANB 1GJDB 4YTAA 1ZMJA 1O2KA 1EPTC 2FX6A 3MFJA 2FDAA 1QBVH 3SW2B 1YPMH 3RXJA 3KQDA 4GAWA 2PKSB 3NZIA 2HGTH 3RMNH 3RXRA 3TJNA 3M3SA 1PQ7A 1H9LB 1O30A 1FQ3A 2VU8E 1BT7A 1TOMH 3QLPH 4CRBA 1TALA 4K1EA 1M9UA 3A85A 1C1QA 4ZXXH 2GZ7A 1YF4A 4MG3A 3ENSB 1WSSH 1C1VH 3A8DA 1H1BA 3O8BA 4AORA 4Y79A 1C5SA 3L6PA 1C5NH 3RU4T 1C2KA 1P2MA 3RLYH 4Q80A 2BHGA 3BTFE 1W0ZU 2A7CA 4NA8A 3V12A 2O8UA 3E1XB 1ZR0A 3ATLA 3QO6A 2ZFTA 4XOJA 3AAVA 1AFEH 1UTQA 3T28A 4CRGA 3LH1A 1A5GH 6CHAC 4XBBA 1V2ST 1FY3A 1P2NA 2XCNA 1LKAA 2OBOA 4TPIZ 1TNLA 1O2QA 1MTUA 1SQOA 1BMNH 2AFQB 2G5VA 3NUMA 3CP7A 1BDAA 1QJ7B 2CF8H 5F8TA 1S81A 1V2NT 1T8LA 4DT7B 5JBBS 3GCOA 3RU4D 2VVUA 3S9CA 1FLEE 3A7YA 1Q3XA 4NWKA 1C5YB 4ABDA 5DKMA 4WXIA 4Y7AA 1Y3XA 2WPJS 3M37A 3QWCH 2ZDMA 4U01A 2RDLA 1WV7H 2BX4A 2Z94A 3ZV9A 2TBSA 1F0TA 4RN6A 1E36B 2JETB 3OX7U 4X0WU 1C5MD 2ZTZA 3ZZDA 4ZHMU 1MKXK 2BY7X 1HFDA 1VITH 7KMEH 3D65E 1NS3A 4AZ2B 1TPAE 1DLKB 1GJCB 1AO5A 4NCYA 1P9UA 1ELBA 1TYNA 2FO9A 4ESTE 1GHVH 3QGJA 1AE5A 1DWBH 2HRVA 1YLDA 2V35A 3RXTA 1HB0B 5EQSA 5GWZA 2DE8A 1AE8H 1SLUB 3RXDA 8GCHF 1DICA 1GHAF 1OS8A 3MH7A 2EA3A 1V6DA 2WPMS 1UTLM 3GY8A 4ABFA 2K1QA 5TCAA 1NU7B 1MAYA 1C1TA 3MU1A 3UQOA 2FOGA 3RP2A 1XUGA 1O0DH 2J38A 1TMTH 1FIZA 4X2YA 1QL7A 4A1VA 2P3FH 1ELAA 2R2MB 1A4WH 2PR3A 4QT8C 3EA7A 1GBBA 4U2WA 2F9VA 3U8TH 2BD5A 2FM2A 3SNAA 1FZZA 1NO9H 1TBRH 1CO7E 5E0GA 1MD7A 3UIRA 4NIWA 1C1NA 1TIOA 1C1UH 1O2VA 2CF9H 1J9CH 3KL6A 3LC5A
chains in the Genus database with same CATH superfamily
1LVBA 1VCQA 3SV6A 3LGVA 2ZQ2A 2CXVA 2H9EH 5FPYA 3OEHD 4KELA 1FJSA 1EQ9A 3M7QA 8LPRA 2BTCE 2F43B 1JIMA 1LMWB 4DIIH 3TH2H 1ANEA 3KQEA 2ZGCA 1KIGH 1TNIA 3SBKA 2ILNA 2B5TB 2GMTB 3LGIA 1CT4E 1BRCE 3LIWA 3I77A 4CH8B 1W8BH 3SJIA 1GHZA 1OWJA 1T8OA 5HYOA 3UWJH 1YLCA 1S82A 1IQIA 1HCGA 3BEFB 1TPPA 2ZTYA 1ZRBA 1BBRH 1HV7A 1GBCA 1UCYE 1GCTC 1IQLA 3HGNA 1KXDA 1RXPA 1NRRH 3ZV8A 1EOJA 1PJPA 2G51A 4TY6A 1KLIH 1C2LA 5FPTA 3LJOA 1EZUC 3BEIB 3ZVAA 4INKA 1SQTA 1NTPA 2W6JD 3A86A 3LDXH 1YPHC 1MBQA 2WPLS 1FXYA 5FAHA 2BD9A 1RRKA 3RXBA 4CRFA 3P92A 4KKDA 4X1PU 2KZ4A 1OX1A 4AFUA 4INHA 1GHYH 3QX5H 2J95A 1O3CA 4Y6DA 4INLA 2XXLA 1XUFA 1VR1H 3MNCA 1O3OA 1LCYA 1AWHB 3M5MA 3DUXH 1GBHA 1P2JA 3RUOA 1UTNA 2XNDD 4FUDA 1BTWA 4DURA 2GV6A 2P8OB 1O31A 2OC7A 3LJJA 3CENA 1EP6A 4IN1A 4Q7ZA 2ZU4A 1QJ6B 2HLCA 4A7IB 1YC0A 3A81A 3GICB 2F9NA 1N6XA 4ISOA 2VIDA 1BMLA 2QV1A 5G4BA 1EJMA 1LQDB 3ZVBA 1BMFD 1F0RA 1O2YA 1Z1IA 2FXRA 4MPXA 3RXOA 1BMAA 3ZZ8A 5T6FA 2B9LA 4CHAB 8ESTE 1GBDA 5HGGA 3MO6A 1UTMA 1JMOH 1Y5AT 3UTUH 1GJ8B 4Y8XA 1THSH 4MNVA 3TGKE 3MHWU 4YOGA 2YMSC 3SUEA 3SUFA 3SV9A 4K60A 1BIOA 1E1QD 2PTNA 4JZEH 4WY3A 5LPFA 3I29A 4WF8A 1GHBG 4O9VA 3AASA 2J9NA 3EA8A 3D23A 3QZRA 4FUHA 2BDBA 3E90B 1AFQC 1NU9A 3TNSA 1MCTA 1V2QT 2XWBI 2O8WA 1OWKA 2FOHA 5A0AE 2ZU2A 2GTBA 1NRSH 3ATKA 1OWDA 4ZAEA 1EASA 1GBJA 1MBMA 2CK3D 2SNWA 1CA0C 1Z6JH 2PV9B 3FP6E 1GMCF 1D4PB 2NU2E 2OC8A 1ZMLA 1C1RA 1XKBC 3M7UA 3PMJA 3WWFA 3TJOA 5DPAA 3NXPA 2W26A 2WUBA 2AGGX 2KCPA 4KTCA 1DFPA 3BIUH 3A83A 1K1NA 2EY4C 5C5NA 1AHTH 1NY22 1QNJA 4XBCA 1CT2E 3RXPA 1WTGH 2B8OH 1SGCA 1Y5UT 3MH4A 4X6PA 2OXSA 5FCKA 2SFAA 3NPSA 3RMOH 1RFNA 3GS9A 3UREA 3TLOA 4MVNA 3T25A 1H9IE 1O2GH 2ESTE 1ELTA 4ASHA 1LVOA 2AGEX 2BB4A 1LHGH 2HPPH 3GISB 1WQVH 3GY6A 2FOEA 1C5ZB 1QBNA 3QN7A 3TK9A 4D9RA 1MQ5A 3BV9B 5DG6A 4K8BA 3DFJA 3SQHE 5JPMH 3SO3A 3HATH 1GI8B 5FX6A 3PRBA 1AZ8A 1EX3A 4Q63A 1SVPA 1DX5M 1SFIA 1UHBB 4FUGA 1FX0B 1W12U 4O97A 2ANMH 2XW9A 2BY9X 1BBRK 5L2YH 3A84A 3GY4A 3ZZAA 4E05H 4MPWA 3U98H 4MNWA 3ZZCA 4E7RG 2QF0A 2HOBA 5GPIB 1A0JA 2HVYB 3RXQA 4WJG2 4FUFA 1O2WA 5FPSA 1GJ6A 1GBIA 1K22H 1SLVB 1C2HA 1G3DA 2FPZA 1NROH 1XKAC 1O36A 1D6WA 1PQAA 1C5LH 1O2LA 1OOKB 1ELEE 1TRMA 3F6UH 1CBWB 3A82A 3M7TA 4B73A 2JJ2D 2A0QB 2IPHA 1TGCA 1KTTB 1A0LA 4JZDH 3N7OA 1V2WT 3F9EA 4FVDA 5FX5A 1FV9A 1GG6B 1AB9C 1GGDB 4AN7A 2AGIX 2B0FA 1UTPA 3FANA 4MQAA 4AB8A 1BOQA 1EZSC 2NU0E 2OP9A 1GI1A 3P8FA 3OE7D 3SU6A 1FY8E 2GX4A 3Q77A 5EW2H 3SJ9A 1CHOG 1SGFA 2FESH 1QRXA 1L1JA 1MTNB 2VVCA 4WMEA 3OEED 1VCWA 1O38A 3MYWA 1MZAA 3BG8A 1UVUH 1C5RA 2Z9KA 1PPHE 4VGCC 2VGCC 3K2UA 1A3EH 1CHOF 1O3MA 4LZ4B 1TBZH 1ELDE 4O3TA 1NFWA 2M5TA 3T26A 3PB1E 1NC6A 1ANDA 1N8OC 2IN2A 2FS8A 2ZGXH 3K65B 1BMMH 1S6HA 3A8BA 3EYDA 2HNTE 2O8MA 2YOLA 2F83A 1PFXC 1EB1H 1QGFA 2WV9A 3F2HA 3PO1B 2RDEA 1O2XA 2ODYB 3MH5A 1BHXF 3SHCH 3HK3B 3P70B 3A8CA 1CE5A 1IQJA 1JRTA 3OTJE 1PPZA 2BD8A 1QB9A 5DO4H 1S0QA 1UTKA 5C67A 3RXHA 1ZLRA 4TSFD 3ZVCA 2I6QA 1KLTA 4UONA 3TH4H 1AGJA 3ATIA 1INCA 3STIA 1P01A 3L33A 3M5OA 1A7SA 3R3GB 2OUAA 2FOBA 1GJ4H 2QAAA 3RC6A 2VWLA 4KP0A 5GIBA 3KQBA 2A4OA 3ZVGA 2DUCA 5FL7D 2SGPE 5F6MA 1V2OT 4K1TA 1HJ9A 2ZKSA 5ETXA 3IG6B 1F0UA 4IC5A 1DDJA 6ESTA 1Z7KA 5A2MH 3PLKA 4Q7XA 4Y8YA 4IN2A 4Y0YE 3RXGA 4MNYA 5A8XA 1P3CA 3PTNA 5EQQA 1WQSA 5EW1H 2A31A 2PP6A 1WTHD 1S6LA 1TQ7B 1IQFA 4TWWA 3RXLA 3UAIC 4OGYA 1OYTH 1IQEA 2QYIA 4HI3A 1NBMD 3LH3A 3RXSA 1AD8H 1F5LA 1IQNA 2LPRA 2EI8A 1PQ5A 3SN8A 1DWCH 4UFDH 2BD3A 2BDGA 1TLDA 1ELCA 5C3NA 1C5QA 4P02A 1ABJH 3C27B 1YGCH 3FKSD 5I25A 1XUHA 1SMFE 3VXEH 1E34B 1HXFH 1V3XA 1UCYK 5KECA 1O3KA 2VVVA 4WMFA 1AZZA 2KR7A 2ZQ1A 1D6RA 4LOYH 4OS4A 3MU4A 4X8VH 1C9TA 2BZAA 5C1XA 1VGCB 3FVFB 4F49A 1TRYA 2J98B 5TJXA 3PWBA 4BAQB 1ACBE 3Q3YA 1K1OA 2ZWLH 1NT1A 2AERH 2A1DB 1TMBH 1IQGA 4RKJB 2C8ZB 1EAUA 2XCFA 1T31A 2ZDNA 1AIXH 3KCGH 4BXWA 4BOHA 1W2KH 3AK5A 3LPRA 1GL1A 1O3BA 4UEHH 3UNRA 1SOZA 5L2ZH 3RXKA 1ARCA 4FUJA 1OHHD 5DP7A 4F4OC 2OK5A 4BAOB 1ZJDA 2OBQA 4ABHA 3W95A 1O5FH 3SJKA 1O2PA 3UQVA 2TGTA 4Y76A 3H5CB 3KHVA 1O2NA 3S7KB 3KGPA 1LHDH 1P06A 1SGTA 2ODPA 2HNTC 1DWDH 4OS6A 2F9PA 1O32A 2XBWA 7LPRA 1P3EA 2ZI2H 1C2MA 1KXAA 2KAIA 1LTOA 5CHAC 1OP2A 1SBWA 1TX8A 2PKSC 1RTKA 1W0YH 4I8LA 2ULLA 3A7XA 1FY5A 3SHAH 1GVLA 1UK4A 4OS1A 2XC4A 5JYIA 1NPMA 2P8OC 2J94A 2ZGBH 1EOLA 1C5OH 4UDWH 4ABAA 3DSPA 1NFUA 2XBVA 3MU8A 1V2JT 3PV5A 3DA9B 4JYTA 1OP0A 1JXPA 4I8HA 1O2UA 3KF2A 2XBYA 2P3TB 3LOXA 3RXFA 1C2FA 2TPIZ 1ETSH 1LPKB 1LHFH 1OYQA 2GZ8A 1KDQB 3D62A 4NIYA 3HK6B 1AVWA 1KXFA 2PUQH 2SGQE 5HMAA 2AMDA 2OC1A 1V2VT 1ANCA 1O3HA 3ZZ7A 3MNSA 1LHCH 5FBIA 1O5CB 3KYFA 3QTOH 2VIPA 1DPOA 3LGYA 1EP5A 5DP9A 1VITF 1QL9A 1TPSA 1UK2A 1ARBA 3NCLA 4IBLH 2O9QA 4CRDA 1O3PB 1LHEH 1Y8TA 2VIOA 4B2BA 1O5BB 2BVRH 4HTCH 4AYVB 2A5AA 3ZVFA 3K9XB 1ZJKA 2SGDE 1YBWA 3ZIAD 5EG4A 2WPIS 3TIUA 2LNCA 1P03A 3RXEA 3VB5A 5C20A 2KCYA 1UMAH 2Z6BD 2F91A 5AVDA 4ABBA 3GCNA 3FO8D 2BY8X 3AAUA 2ZHWH 3BF6H 2BDYA 1C1OA 2QXIA 3TJVA 1SLWB 3VGCB 1TGNA 3M5LA 2W3IA 1F0SA 1B0EA 4AGJA 2FOCA 1O5EH 3ZYEA 1A0HB 4CRCA 1DS2E 3LONA 4K3JA 1GI6A 3PV2A 2BQ7B 3GCTG 1C1WH 5IYTA 5E8EH 4TT3D 1ZSJA 1GI0A 3OY5U 1C9PA 5AFZH 3T29A 5DN6D 2CV3A 2PKAB 2IJOB 1TE0A 4X1SU 5CE1A 2STAE 1UVTH 5T3HA 1L2EA 3ZZ9A 1EAWA 4BAMB 1TQ0B 2GT7A 3RXMA 4B74A 3LU9B 2ZFQH 2J5UA 1O3NA 4Q4LA 2TGPZ 4I8GA 1QFKH 4GHQA 1CGJE 4BTIB 3BTHE 1GMCG 2NU3E 4K8YA 2VB0A 4NSYA 2WPKS 4I32A 1TBQH 1PPCE 4NA7A 3IITA 3A7WA 4HFPB 1O3DA 1C5UA 2P3UB 2BXUH 2ZHDA 2JH0D 1CA8B 2L6OA 5ABWA 4MDSA 3PYHA 5T6DA 1W7GH 2C8XB 2FI5E 3VG8A 4BXSA 2V3HH 3RU4E 1V2MT 4BAKB 2TGAA 1EAXA 1CVWH 1O3GA 1GHBF 2J92A 1DANH 1IAUA 4JK5A 2A5IA 1BBRE 3CS0A 4HZHA 1NRPH 1Z1JA 1CHGA 2GKVE 2HPQH 2Y7XA 1MTNC 1GG6C 1AI8H 1BTYA 1SQRA 2BYAX 3VPKA 2TRMA 2WYGA 1BB0B 5JDUB 4UE7H 1BTXA 2C90B 4A92A 1BUIA 2ZGHA 1AKSB 5LGOA 2STBE 2HVXA 1O2MA 1GBLA 3GOVB 1TFXA 1V2KT 3SZEA 1T7CA 1IQMA 1LDTT 1GI2A 1WU1A 4AG2A 1QQ4A 4DT4A 1QL8A 2XTTB 4YXWD 2J2UA 1TNKA 1SGFG 5A0CA 1SGRE 2BQ6B 1P2QA 3TK5A 1P09A 2FIRH 5E2OA 2FOAA 4WWYA 4UD9H 3CS7A 1YPJH 4FU8A 1LPGB 3ODFA 2QXHA 1K21H 1P2IA 1TB6H 1TGTA 4CBOA 2RFKC 1DXWA 4YLQH 2ZU3A 3MWIU 1O2TA 3A87A 3QZQA 1ZTLA 1O5DH 2UWOA 1S6FA 3IWMA 5DP3A 3F9HA 2FEQH 2A5KA 3C1KA 1O2ZA 4XRNA 3KEEA 2ZDKA 2Q6DA 2ZFSA 1CGHA 1V2RT 3SU3A 1H8HD 4XFQA 3R0FA 1HAHH 3ELAH 1NFYA 1DT2A 2W6ID 3HKJB 4PROA 4CH2B 3SQEE 1ETTH 2GV7A 1A2CH 3WY8A 2W3KA 1EZQA 3B9FH 1UVSH 2OCVB 2XOKD 3RXCA 2C8WB 2ZCKP 3E0NB 4ZKSU 3VB7A 3K6ZA 2EI6A 1Q2WA 3SU0A 2G4TA 2PSXA 3V13A 1ZOMA 3LKWA 1FI8A 4RSPA 3VGCC 2ZU5A 2AIPA 2ANWA 1CBWC 1WUNH 4ZMAH 1O3AA 2G4UA 3V3MA 4D8NA 4MLFB 4E06H 1LPZB 4GHTA 1C2DA 1ESBA 1XVOA 5EXNA 1NN6A 5EOKA 5CDFE 1UHBA 2F9UA 1K9OE 1VKYA 2GCHG 1WYKA 2GD4B 2M2AA 5ESTE 3GCHB 5JBCS 5HM9A 2VINA 3SU5A 1TONA 4I8JA 2ZA5A 1BRBE 2GCTC 2BLWA 3S9AA 4X8TH 1SB1H 4XSKU 1COWD 1NZQH 4YZUA 3EQ0H 4BTUB 1SGPE 1ZHMA 3N7EA 1BTUA 3JZ1B 2Y5FA 2PGBB 4K2YA 1H8DH 1YP9A 5AF9H 4GCHF 1T8NA 3VB4A 3KIDU 2BZ6H 4FOUC 2Z7FE 3SZNA 1TNJA 1EKBB 1FAKH 1UK3A 2G52A 3VEQB 3N99A 2BLQA 4I31A 4IMZA 1WAYB 3PMAB 2FP7B 2BLVA 4AFQA 1J8AA 3OSYA 2FI4E 5DK1A 3PMBB 1KYNA 3U28C 4K1SA 1GMDF 5DGJA 3BTWE 3PM3A 3SGAE 2IPQX 3UY9A 1AU8A 1RIWB 1JOUB 1FY4A 2FODA 4NIVA 4UFGH 3GY7A 1C4V2 1H8ED 3MMGA 3KNXA 3SI3H 1BJVA 1YY3A 1MAXA 3BSQA 3F9FA 1LVYA 2G00A 3OU0A 4YOJA 2J97A 3W1EA 4P00A 2ZGJA 4OS2A 3NWUA 3OAAD 1NESE 2KCOA 2BD4A 4NWLA 4Q7YA 1FDPA 2ZDLA 1CGIE 2UUYA 1ZPBA 2GP9B 2UUJB 1WDIA 2NU1E 2BY5X 4SGAE 5F8ZA 4ZHAA 3KQCA 3SI4H 1CQQA 1ORFA 3T27A 4H4FA 4X2VA 1K1LA 2XBXA 2WUCA 2ZECA 1KTSB 1HGTH 2AH4X 2V7QD 3DSGA 2QA9E 3OTPA 1QB1A 5DP4A 4D7FA 2G55A 5EIYA 2GGVB 1Z71A 1Y3WA 3QUMP 5HIYA 2PWXA 5H4IB 5C1UA 4FU9A 2AIQA 1E79D 3Q76A 2H5CA 2ZO3H 1BITA 1BA8B 3F3BA 2Q1JA 3MOCA 5GDSH 1C2GA 1W0JD 1O35A 1P11E 1G9IE 3ZZ4A 2FLRH 1ZHPA 4NA9H 5GJ4B 3GCTF 5JBAS 2WV4A 1ESAA 3GYLB 2GDEH 3ZVDA 3UWIA 5I46H 4FVBA 4CRAA 4ZH8A 5J4QA 3RXAA 5HIZA 1TGBA 3BTGE 4FETA 3TGIE 1G30B 4AC9A 1Q31A 2F9BH 2WPDD 3SGQE 4CR5A 3FZDA 3FOAA 4YM9A 5A8YA 1VGCC 1ELGA 1GBTA 3UFAA 3BTKE 3DD2H 4TYDA 1K1JA 1OWHA 3UNQA 3TNTA 3BTTE 5K0HA 2VNTA 2FMJA 2FI3E 1C2IA 1J17T 1P02A 1E35B 1GJBB 2AYWA 4X8UH 3MU5A 1GBFA 1BHXB 5AFYH 1DLEA 2PHBA 1PYTD 1YPEH 4GLYA 1BTHH 7ESTE 2FYQA 3HPTB 3LT3A 1GDUA 2ZCLP 3SU4A 2QGRA 2PLXA 1DXPA 1LQEA 5C0UA 3BIVH 3SNDA 3GDSA 1D3TB 2RCEA 2ZPSA 1H9HE 1J15A 1LO6A 1KXEA 2BM2A 1QRZA 3D49H 2FOFA 1P2KA 4LK4A 1YLNA 3SYJA 1MU6B 1HJ8A 5CMXH 2FTMA 3AVZA 3TU7H 1S85A 1RGQA 3EDXB 3PLPA 1HAXB 1ZTJA 2JETC 3NRLA 3T2NA 4K69A 1C2EA 1VCPA 2H9HA 4AFSA 1EAIA 1QQUA 1TGSZ 3TVJB 3FN8A 2WSSD 4TY7A 2KFWA 4ISHH 5C1YA 1W13U 1KMHB 1OP8A 2UWPA 4WXVA 2A7JA 1AQ7A 3H09A 1OSSA 1YWUA 2P95A 1MUEB 2FS9A 1DITH 2R3YA 2EC9H 2WINI 2XYAA 1THRH 3SU1A 2CHAC 4LXBH 3QTVH 3SORA 4YT6H 2SNVA 2SGEE 1GDQA 2WHXA 2GT8A 4OM9A 4X8SH 3AW0A 1W7XH 3H7TA 1GI5A 4ABGA 1DOJA 1GJ7B 2W7SA 4IW4E 9ESTA 4DIHH 1IQHA 4ACAA 2OD3B 4ZROA 1X7AC 1F92A 2XWAA 5L30H 3S69A 5EJZA 3BTQE 5C17A 2BVSH 1GJ9B 3Q00A 3LGTA 3SNBA 1XX9A 3S9BA 1FAXA 3STJA 4ZKRU 2BDHA 1FNIA 5EGMA 2GDDA 3P95A 4Z1MD 1O3JA 2B7DH 3VB6A 5JB9S 1NM6A 1CSOE 1UO6A 3LGWA 1E38B 3DHKH 2ANYA 4YLUA 1BRAA 2V0BA 5K7RA 1C5WB 2FTLE 1DSUA 3PROA 1Y59T 3EE0B 1ETRH 2Q6GA 4NZQA 4ZCNA 1YM0A 5GCHF 1DE7H 1ZGIA 1C1MA 2FLBH 2PW8H 1DUEA 4BNRA 5E0JA 4YT7H 1O2IA 1KDQA 1NRNH 1UCYH 2GVFA 3M61U 1K2I1 1TABE 2ZIQH 4X6NA 2GCTB 3MO3A 2OC0A 1LKBA 1TX7A 3A88A 4J1YA 2ZFRH 2ZC9H 1FMGA 1VZQH 3ITIA 2O8TA 5BPEA 3ZZBA 1DVAH 1HNEE 2I6SA 8KME2 1P57B 3K6YA 2JJ1D 3OY6U 3BTEE 3TJUA 1Y3UA 4ACBA 1HBTH 3F0PA 1PPEE 1A3BH 4NFFA 1ZGVA 2QY0B 1S0RA 1GDNA 1VJAU 4WH6A 5GXPA 1ZZZA 1EB2A 4IMQA 2UWLA 2H5DA 3ZZ5A 2KM0A 4U32A 2ZF0H 1JIRA 4H6TA 1SC8U 1SR5C 4FXGH 3SNEA 5DJ7A 1UTJA 1XXFA 4X6MA 5C94A 3HGPA 3B8JA 4A1XA 4ISLA 1MQ6A 2F9OA 1HDTH 4JZFH 5B6LA 3MTYA 1T32A 2ZG0H 2XRCA 4JZ1A 1BTZA 2R9PA 1GHAG 3WWBA 3PWCA 1TWXB 1XMNB 3W94A 1SSXA 1O37A 2RA3A 3PRDA 4MPUA 1WCZA 3U1JB 1MTWA 1AVGH 1J14A 5EQRA 1B5GH 4IGDA 1RTFB 1V2PT 2Y82A 1GI9B 3E16B 1HUTH 1GI4A 1AKSA 2XC0A 3T62A 1E0FD 4D7GA 2ZFPH 4J2YB 3BN9A 1ZYOA 3MNXA 1ID5H 2D8WA 1BQYA 2VGCB 1G37A 2QE7D 1IHTH 2ZDAH 1D9IA 1G2LA 1H4WA 4B6EA 3SUDA 1JBUH 2VIVA 3UUZA 5LPRA 1G2MA 3MQKC 5EPNA 4AB9A 1XUJA 2ANKH 1YCPM 1EPTA 1DUAA 1SPJA 2HNTF 3MU0A 1QRWA 1TMUH 1QA0A 3MH6A 2XC5A 4D76A 2BXTH 1P05A 4RT0A 2GMTC 3P17H 1O33A 1MMJN 2OLGA 3MNBA 2R2WU 4CR9A 1S5SA 2BMGB 2ASUB 4ASUD 2R3UA 5A09A 1FN6A 3P8GA 2VH0A 1QTFA 3E3TA 5EJ1A 3ATWA 3H7OA 3VFEA 1HXEH 1W3CA 2BOHB 3BG4C 5T6GA 1HAIH 1MU8B 3A7VA 1HJAC 1PYTC 1IQKA 1WOFA 3BEUA 5JB8S 4KTUA 3EGKH 4XDEA 3RMLH 2G8TA 5C2ZA 1T8MA 1HAPH 4B6FA 3S0NA 1GWAA 1A46H 4WH8A 3RDZA 2PSYA 1PQ8A 2R0LA 3VXFH 1IHSH 1UW7A 1W10U 3PV4A 4BTTB 1QZ8A 1F2SE 2L74A 1SHYA 1TPOA 4ZUHA 2ZHFH 1W14U 4X2WA 1FN8A 2C93B 3PMHB 2BQWB 1EUFA 3U8OH 1PPGE 1A5IA 1AN1E 2W5EA 3RM0H 4JYUH 2TGDA 3SJOA 1AFQB 1BCUH 1TOCB 1XXDA 2IOTA 1QA7A 1VJ9U 1GHXH 1P04A 4AX9H 4DY7B 1GHWH 1EZXC 5B6OA 1SOTA 1C5PA 1DWEH 1KY9A 2HLDD 1OWEA 1P2OA 1N1LA 2JH6D 4Q2KA 4Y8ZA 4JMYA 1KXBA 2A4GA 2JIZD 2ZNKH 1QR3E 2AHME 2VWOA 3RXIA 2FOMB 1FPHH 4FUIA 3GY5A 1YKTA 2THFB 2VIQA 3EAJA 1C1SA 3SNCA 1K1MA 1SFQB 4YO9A 2ZEBA 1HIAA 1GVZA 1AVXA 2FWWA 2H6MA 3ZVEA 5DP6A 1BJUA 2PTCE 2V3OH 4ZKNU 3U9AH 3ATMA 3P8NA 2UUKB 1A61H 1ELVA 1SGDE 3UNSA 1OXGA 3TITA 1HYLA 1ZPCA 4X1NU 4Y10E 3SV2H 1MD8A 1LVMA 2EEKA 2HWLB 2NWNA 3SV7A 3WW7A 1C1PA 3HKIB 7GCHG 1OKXA 2F3CE 5FXLA 1TRNA 5IDKA 4XD7D 2BD2A 5J4SA 1IOEA 2Y80A 1MKXH 3SJ8A 2P94A 2Y6TA 5IK2D 2SGAA 1P10A 1J16A 1GJAB 4B75A 5T1VA 1SLXB 2AMQA 5BRRE 4OS7A 1O2OA 6GCHG 1ZHRA 1AWFH 1HLTH 3PLBA 3ZZ6A 3AW1A 1GI7B 4JK6A 3GYMA 1O3FA 3A7ZA 3P8OA 2A32A 1AUTC 1HAZB 2VWNA 4XBDA 1THPB 1SGIB 2KCAA 2KAIB 2H2ZA 1O34A 2AMPA 1UVPA 5KEDA 5EXMA 3FZZA 2Z3DA 2ZHQH 1DSTA 2J4IA 3A89A 2NU4E 1O3EA 1MTVA 3UOUA 1TNGA 2CHAB 1HAGE 5HKKD 4JYVH 3RXVA 1QHRB 2C3SA 4F48B 4ZHLU 1O5AB 3LGUA 2QXJA 1T4UH 1YPLH 1XUIA 3SOSA 4B1TA 5EU8A 1ZSKA 1TAWA 4ISNA 1SL3A 3F1SB 4THNH 2GZ9A 3A7TA 2QF3A 1L4DA 1GVKB 5E0HA 1N8OB 2CN0H 5SGAE 3RC5A 3UOPA 2ZTXA 4NIXA 2AS9A 1AMHA 2D26C 4JCNA 1Z8GA 1Z8JB 3GY2A 4CREA 4B76A 3M5NA 2JKHA 3FFGA 1QBOA 3O8DA 2KX4A 4ABJA 1OPHB 5LPEA 4NSVA 3VB3A 1GI3A 1HJAB 1CA0B 1YYY1 4X6OA 3SGBE 2BVXH 2QC2A 2BD7A 2Y7ZA 2YMSB 3BTME 3SU2A 1PPFE 3G01A 3M3TA 2Y5HA 4I86A 2RA0A 1MTSA 2ZFFH 3SUGA 3E0PB 5F53A 4I33A 3UR6A 1FONA 1GMDG 1GMHG 2YMSD 3EA9A 1BTPA 3ZYDA 4YOIA 3Q3XA 1K1PA 3PO1C 1NRQH 4MTBA 1QB6A 1W0KD 2QIQA 4WVPE 4Y0ZE 2A2XH 3B23B 4DG4A 1HIAB 2G5NA 2QN5T 1QURH 1A5HA 4M7GA 3FP7E 2D2DA 5EJLA 1P0SH 1Z8RA 1UJ1A 3O8RA 1G32B 1TX6A 6CHAB 5EXLA 2VIWA 2WYJA 2V3MA 1YPGH 4O3UA 5C0TA 1F7ZA 4H6SB 2WPHS 1K28D 2ODQA 2VWMA 2J98A 1L4ZA 2RG3A 1O3LA 5EODA 2ALPA 4GUXA 2QCYA 4AOQA 4Y11E 1DY9A 1SKYE 4SGBE 1V2UT 3QDZB 2YNAA 4DCDA 1KXCA 2QF5A 2V6NA 1EJNA 1PPBH 2W7UA 4VGCB 9LPRA 2P16A 3A80A 2O8LA 4GCHG 4AYYB 1C5TA 3E6PH 1S83A 4DJZB 4GSOA 1EXFA 4RKOB 1L1NA 4JZIA 3RMMH 4B71A 2IJD1 5GCHG 5FCRA 1XUKA 1FUJA 2ALVA 4HGCA 3DSOA 2OTVA 4FUBA 1QY6A 1GBEA 1ZPZA 1Z6EA 4IC6A 1GBAA 3F2FA 4GPGA 2A7HA 1C4U2 1KSNA 2FYRA 3M36A 4ISIH 2ZDVH 3OFND 1HAVA 4KTSA 4ABEA 4WMDA 4X1RU 1ZRKA 4RT1A 2GCHF 1O2JA 3U1IB 1F5RA 4MPVA 1L1GA 3BTDE 1D3QB 2BY6X 3PTBA 5FBEA 2Z9IA 2VH6A 1YPHE 4A6LA 1AB9B 2C8YB 2J34A 5FHTA 2FX4A 1P12E 2Z9JA 1JRSA 2OQUA 1HRTH 1YPKH 3CNRA 4B2AA 1HAYB 3QK1A 3FP8E 1O2RA 4AFZA 4D9QA 2JDID 1EPTB 3UPEA 1SQAA 2K8IA 1TNHA 5CHAB 4ZXYH 1GJ5H 8GCHG 1K1IA 1ESTA 1UVOA 1S84A 5F8XA 1MABB 1V2TT 4IS5A 1W11U 4O03A 3QGNB 3RXUA 4NG9H 1WBGB 1CT0E 2OINA 1V2LT 4Z0KA 2ZU1A 1A1RA 3TPIZ 1MKWK 1TA2A 2PGQB 3BG4B 2Z3CA 4OS5A 2BX3A 4GVUA 1YCPH 3F0OA 4R0IA 2Y81A 2Y5GA 3A8AA 1HAVB 5DP8A 4DW2U 4FU7A 2ZHEH 2A4QA 5A0BA 2LP6A 3O8CA 1HPGA 1MH0A 1G3CA 1C2JA 4TPYA 1OWIA 3V0XA 4FUCA 1GBKA 1U6QA 3TK6A 3KQ5A 3MO9A 2D1JA 3SV8A 2PKAA 2P93A 1UTOA 2EI7A 2Z9GA 2C4FH 4B2CA 5C5OA 1G36A 2P59A 3U69H 5CHBA 2XNIA 1RJXB 1C5VA 4E7NA 2WV5A 3MI4A 1O3IA 1Z8IB 1TA6A 3KN2A 1ELFA 1E37B 2AEIH 5F03A 3M35A 3F9GA 3F68H 1L0ZA 2VJ1A 1B7XB 1B0FA 4K5ZA 2DE9A 1Y3YA 2UUFB 1NFXA 1GMHF 1P8VC 1ZTKA 2FZZA 4DOQA 4A1TA 1QIXB 2HALA 1YCPK 2A4RA 4NFEA 6LPRA 1GCTB 3M3VA 4BAHB 3FAOA 1GBMA 1SGQE 5JBTA 1SGNE 4AGKA 4X2XA 5EPYA 1RD3B 2Z9LA 3N7DA 2H1UA 5AHGH 3RLWH 4H42U 1Y5BT 1N6YA 2QXGA 1FPCH 4HG6A 1QJ1B 4X1QU 4Y7BA 1BRUP 1EATA 1EJAA 1H8IH 1MCVA 4R8TB 2A2QH 1XVMA 1O2HA 2ZZUH 3LC3A 1ZMNA 3RM2H 1O39A 1QCPA 4NGAH 1ZSLA 3NKKA 3P6ZB 3T5FH 1DM4B 2G81E 4DVAU 4LZ1H 1F5KU 3I78A 3GDVA 4CBNA 1MZDA 4I8KA 2OQ5A 1GPZA 3GDUA 2ZCHP 4TWYA 1G3BA 4Z6AH 1RTLA 3GCHC 3Q3KA 2BDAA 1O5GH 1P9SA 3UB0A 2Z3EA 4OGXA 2GJGA 5L6NH 4UFFH 4CHAC 4FUEA 4ABIA 1ABIH 4RI0A 3RC4A 3URCA 2TIOA 2ZP0H 1C5XB 2CMYA 3ODDA 1E1RD 2CJIA 3E91A 3L3TA 3U8RH 1SHHB 1RIWC 2ZPRA 4I7YH 5HM2A 4ZKOU 4MNXA 3TGJE 2JH5D 2PFEA 1AUJA 5PTPA 1SGEE 4Y71A 2ZPQA 1XM1A 1EFRD 2H9TH 1D3PB 1GCDA 2CGAA 2F4LA 5TCCA 5A8ZA 3DT0H 1T4VH 1O2SA 6GCHF 1BZXE 2SGFE 1GL0E 3E8LA 1FY1A 1KLJH 2R0KA 1Y3VA 1D3DB 2Q6FA 1C4Y2 3GY3A 5HXFA 2A45B 3DCLA 4U30A 1RS0A 1DY8A 2WZQA 2PUXB 2BLOA 2BDIA 3URDA 1GGDC 1G3EA 4XE4A 5ESBA 4A5TS 7GCHF 5LH8A 2BOKA 1FIWA 3S7HB 1SI5H 2BDCA 3OYPA 1SGYE 3NK8A 3DFLA 5DP5A 1HAOH 1ANBA 3JZ2B 4NZLA 3TH3H 3ESTA 1AY6H 1MKWH 3V7TA 4DGJA 4AG1A 4KGAA 4YESB 2EQNA 2YNBA 3UR9A 1VITG 3ZZ3A 1SG8B 5E2PA 1CU1A 1JWTA 4UFEH 4BANB 1GJDB 4YTAA 1ZMJA 1O2KA 1EPTC 2FX6A 3MFJA 2FDAA 1QBVH 3SW2B 1YPMH 3RXJA 3KQDA 2LELA 4GAWA 2PKSB 3NZIA 2HGTH 3RMNH 3RXRA 3TJNA 3M3SA 1NBME 3KYGA 1PQ7A 1H9LB 1O30A 1FQ3A 2VU8E 1BT7A 1TOMH 3QLPH 4CRBA 1TALA 4K1EA 2VBCA 1M9UA 3A85A 1C1QA 4ZXXH 2GZ7A 1YF4A 4MG3A 3ENSB 1WSSH 1C1VH 3A8DA 1H1BA 3O8BA 4AORA 4Y79A 1C5SA 3L6PA 1C5NH 3RU4T 1C2KA 1P2MA 3RLYH 4Q80A 2BHGA 3BTFE 1W0ZU 2A7CA 4NA8A 3V12A 2O8UA 3E1XB 1ZR0A 3ATLA 3QO6A 2ZFTA 4XOJA 3AAVA 1AFEH 1UTQA 3T28A 4CRGA 2QF4A 3LH1A 1A5GH 6CHAC 3EE7A 4XBBA 1V2ST 1FY3A 1P2NA 2XCNA 1LKAA 2OBOA 4TPIZ 1TNLA 1O2QA 1MTUA 1SQOA 1BMNH 2AFQB 2G5VA 3NUMA 4M9FA 3CP7A 1BDAA 1QJ7B 2CF8H 5F8TA 1WXRA 1S81A 1V2NT 1T8LA 5DSFA 4DT7B 5JBBS 3GCOA 3RU4D 2VVUA 3S9CA 4F55A 1FLEE 2K0QA 3A7YA 1Q3XA 4NWKA 1C5YB 4ABDA 5DKMA 4WXIA 4Y7AA 1Y3XA 2WPJS 3M37A 3QWCH 2ZDMA 4U01A 2RDLA 1WV7H 2BX4A 2Z94A 3ZV9A 2TBSA 1F0TA 4RN6A 1E36B 2JETB 3OX7U 4X0WU 1C5MD 2ZTZA 3ZZDA 4ZHMU 1MKXK 2BY7X 1HFDA 1VITH 7KMEH 3D65E 1NS3A 4AZ2B 1TPAE 1DLKB 1GJCB 1AO5A 4NCYA 1P9UA 1ELBA 1TYNA 2FO9A 4ESTE 1GHVH 3QGJA 1AE5A 1DWBH 2HRVA 1YLDA 2V35A 3RXTA 1HB0B 5EQSA 5GWZA 2DE8A 1AE8H 1SLUB 3RXDA 8GCHF 1DICA 5GNDA 1GHAF 1OS8A 3MH7A 2EA3A 1V6DA 2WPMS 1UTLM 3GY8A 4ABFA 2K1QA 5TCAA 1NU7B 1MAYA 1C1TA 3MU1A 3UQOA 2FOGA 3RP2A 1XUGA 1O0DH 2J38A 1TMTH 3F2GA 1FIZA 4X2YA 1QL7A 4A1VA 2P3FH 1ELAA 2R2MB 1A4WH 2PR3A 4QT8C 3EA7A 1GBBA 5KGOA 4U2WA 2F9VA 3U8TH 2BD5A 2FM2A 3SNAA 1FZZA 1NO9H 1TBRH 1CO7E 1K0HA 5E0GA 1MD7A 3UIRA 4NIWA 1C1NA 1TIOA 1C1UH 1O2VA 2CF9H 1J9CH 3KL6A 3LC5A
chains in the Genus database with same CATH topology
1LVBA 1VCQA 3SV6A 3LGVA 2ZQ2A 2CXVA 2H9EH 5FPYA 4KELA 1FJSA 1EQ9A 3M7QA 8LPRA 2BTCE 4DIIH 1JIMA 1LMWB 3TH2H 1ANEA 3KQEA 2ZGCA 1KIGH 1TNIA 3SBKA 2ILNA 2B5TB 2GMTB 3LGIA 1CT4E 1BRCE 3LIWA 3I77A 4CH8B 1W8BH 3SJIA 1GHZA 1OWJA 1T8OA 5HYOA 3UWJH 1YLCA 1S82A 1IQIA 1HCGA 3BEFB 1TPPA 2ZTYA 1ZRBA 1BBRH 1HV7A 1GBCA 1UCYE 1GCTC 1IQLA 3HGNA 1KXDA 1RXPA 1NRRH 3ZV8A 1EOJA 1PJPA 2G51A 4TY6A 1KLIH 1C2LA 5FPTA 3LJOA 1EZUC 3BEIB 3ZVAA 4INKA 1SQTA 1NTPA 3A86A 3LDXH 1YPHC 1MBQA 2WPLS 1FXYA 5FAHA 2BD9A 1RRKA 3RXBA 4CRFA 3P92A 4KKDA 4X1PU 1OX1A 4AFUA 4INHA 1GHYH 3QX5H 2J95A 1O3CA 4Y6DA 4INLA 2XXLA 1XUFA 1VR1H 3MNCA 1O3OA 1LCYA 1AWHB 3M5MA 3DUXH 1GBHA 1P2JA 3RUOA 1UTNA 4FUDA 1BTWA 4DURA 2GV6A 2P8OB 1O31A 2OC7A 3LJJA 3CENA 1EP6A 4IN1A 4Q7ZA 2ZU4A 1QJ6B 2HLCA 4A7IB 1YC0A 3A81A 3GICB 2F9NA 1N6XA 4ISOA 2VIDA 1BMLA 2QV1A 5G4BA 1EJMA 1LQDB 3ZVBA 1F0RA 1O2YA 1Z1IA 2FXRA 4MPXA 3RXOA 1BMAA 3ZZ8A 5T6FA 2B9LA 4CHAB 8ESTE 1GBDA 5HGGA 3MO6A 1UTMA 1JMOH 1Y5AT 3UTUH 1GJ8B 4Y8XA 1THSH 4MNVA 3TGKE 3MHWU 4YOGA 3SUEA 3SUFA 3SV9A 4K60A 1BIOA 2PTNA 4JZEH 4WY3A 5LPFA 3I29A 4WF8A 1GHBG 4O9VA 3AASA 2J9NA 3EA8A 3D23A 3QZRA 4FUHA 2BDBA 3E90B 1AFQC 1NU9A 3TNSA 1MCTA 1V2QT 2XWBI 2O8WA 1OWKA 2FOHA 5A0AE 2ZU2A 2GTBA 1NRSH 3ATKA 1OWDA 4ZAEA 1EASA 1GBJA 1MBMA 2SNWA 1CA0C 1Z6JH 2PV9B 3FP6E 1GMCF 1D4PB 2NU2E 2OC8A 1ZMLA 1C1RA 1XKBC 3M7UA 3PMJA 3TJOA 5DPAA 3NXPA 2W26A 2WUBA 2AGGX 4KTCA 1DFPA 3BIUH 3A83A 1K1NA 5C5NA 1AHTH 1NY22 1QNJA 4XBCA 1CT2E 3RXPA 1WTGH 2B8OH 1SGCA 1Y5UT 3MH4A 4X6PA 2OXSA 5FCKA 2SFAA 3NPSA 3RMOH 1RFNA 3UREA 3TLOA 4MVNA 3T25A 1H9IE 1O2GH 2ESTE 1ELTA 4ASHA 1LVOA 2AGEX 2BB4A 1LHGH 2HPPH 3GISB 1WQVH 3GY6A 2FOEA 1C5ZB 1QBNA 3QN7A 3TK9A 4D9RA 1MQ5A 3BV9B 5DG6A 4K8BA 3DFJA 3SQHE 5JPMH 3SO3A 3HATH 1GI8B 5FX6A 1AZ8A 1EX3A 1SVPA 1DX5M 1SFIA 1UHBB 4FUGA 1W12U 4O97A 2ANMH 2XW9A 2BY9X 1BBRK 5L2YH 3A84A 3GY4A 3ZZAA 4E05H 4MPWA 3U98H 4MNWA 3ZZCA 4E7RG 2QF0A 2HOBA 5GPIB 1A0JA 3RXQA 4WJG2 4FUFA 1O2WA 5FPSA 1GJ6A 1GBIA 1K22H 1SLVB 1C2HA 1G3DA 2FPZA 1NROH 1XKAC 1O36A 1D6WA 1PQAA 1C5LH 1O2LA 1OOKB 1ELEE 1TRMA 3F6UH 1CBWB 3A82A 3M7TA 4B73A 2A0QB 2IPHA 1TGCA 1KTTB 1A0LA 4JZDH 3N7OA 1V2WT 3F9EA 4FVDA 5FX5A 1FV9A 1GG6B 1AB9C 1GGDB 4AN7A 2AGIX 2B0FA 1UTPA 3FANA 4MQAA 4AB8A 1BOQA 1EZSC 2NU0E 2OP9A 1GI1A 3P8FA 3SU6A 1FY8E 2GX4A 3Q77A 5EW2H 3SJ9A 1CHOG 1SGFA 2FESH 1QRXA 1L1JA 1MTNB 2VVCA 4WMEA 1VCWA 1O38A 3MYWA 1MZAA 3BG8A 1UVUH 1C5RA 2Z9KA 1PPHE 4VGCC 2VGCC 3K2UA 1A3EH 1CHOF 1O3MA 4LZ4B 1TBZH 1ELDE 4O3TA 1NFWA 2M5TA 3T26A 3PB1E 1NC6A 1ANDA 1N8OC 2IN2A 2FS8A 2ZGXH 3K65B 1BMMH 1S6HA 3A8BA 3EYDA 2HNTE 2O8MA 2YOLA 2F83A 1PFXC 1EB1H 1QGFA 3PO1B 1O2XA 2ODYB 3MH5A 1BHXF 3SHCH 3HK3B 3P70B 3A8CA 1CE5A 1IQJA 1JRTA 3OTJE 1PPZA 2BD8A 1QB9A 5DO4H 1S0QA 1UTKA 5C67A 3RXHA 1ZLRA 3ZVCA 2I6QA 1KLTA 4UONA 3TH4H 1AGJA 3ATIA 1INCA 3STIA 1P01A 3L33A 3M5OA 1A7SA 3R3GB 2OUAA 2FOBA 1GJ4H 2QAAA 3RC6A 2VWLA 4KP0A 5GIBA 3KQBA 2A4OA 3ZVGA 2DUCA 5F6MA 2SGPE 1V2OT 4K1TA 1HJ9A 2ZKSA 5ETXA 3IG6B 1F0UA 4IC5A 1DDJA 6ESTA 1Z7KA 5A2MH 3PLKA 4Q7XA 4Y8YA 4IN2A 4Y0YE 3RXGA 4MNYA 5A8XA 1P3CA 3PTNA 5EQQA 1WQSA 5EW1H 2A31A 1WTHD 1TQ7B 1IQFA 4TWWA 3RXLA 4OGYA 1OYTH 1IQEA 2QYIA 4HI3A 3LH3A 3RXSA 1AD8H 1F5LA 1IQNA 2LPRA 2EI8A 1PQ5A 3SN8A 1DWCH 4UFDH 2BD3A 2BDGA 1TLDA 1ELCA 5C3NA 1C5QA 1ABJH 3C27B 1YGCH 5I25A 1XUHA 1SMFE 3VXEH 1E34B 1HXFH 1V3XA 1UCYK 1O3KA 2VVVA 4WMFA 1AZZA 2ZQ1A 1D6RA 4LOYH 4OS4A 3MU4A 4X8VH 1C9TA 2BZAA 5C1XA 1VGCB 3FVFB 4F49A 1TRYA 5TJXA 3PWBA 4BAQB 1ACBE 3Q3YA 1K1OA 2ZWLH 1NT1A 2AERH 2A1DB 1TMBH 1IQGA 4RKJB 2C8ZB 1EAUA 2XCFA 1T31A 2ZDNA 1AIXH 3KCGH 4BXWA 4BOHA 1W2KH 3LPRA 1GL1A 1O3BA 4UEHH 3UNRA 1SOZA 5L2ZH 3RXKA 1ARCA 4FUJA 5DP7A 4F4OC 4BAOB 1ZJDA 2OBQA 4ABHA 3W95A 1O5FH 3SJKA 1O2PA 3UQVA 2TGTA 4Y76A 3H5CB 3KHVA 1O2NA 3S7KB 3KGPA 1LHDH 1P06A 1SGTA 2ODPA 2HNTC 1DWDH 4OS6A 2F9PA 1O32A 2XBWA 7LPRA 1P3EA 2ZI2H 1C2MA 1KXAA 2KAIA 1LTOA 5CHAC 1OP2A 1SBWA 1TX8A 2PKSC 1RTKA 1W0YH 4I8LA 2ULLA 3A7XA 1FY5A 3SHAH 1GVLA 1UK4A 4OS1A 2XC4A 5JYIA 1NPMA 2P8OC 2J94A 2ZGBH 1EOLA 1C5OH 4UDWH 4ABAA 1NFUA 2XBVA 3MU8A 1V2JT 3DA9B 4JYTA 1OP0A 1JXPA 4I8HA 1O2UA 3KF2A 2XBYA 2P3TB 3LOXA 3RXFA 1C2FA 2TPIZ 1ETSH 1LPKB 1LHFH 1OYQA 2GZ8A 1KDQB 3D62A 4NIYA 3HK6B 1AVWA 1KXFA 2PUQH 2SGQE 5HMAA 2AMDA 2OC1A 1V2VT 1ANCA 1O3HA 3ZZ7A 3MNSA 1LHCH 5FBIA 1O5CB 3QTOH 2VIPA 1DPOA 3LGYA 1EP5A 5DP9A 1VITF 1QL9A 1TPSA 1UK2A 1ARBA 3NCLA 4IBLH 2O9QA 4CRDA 1O3PB 1LHEH 1Y8TA 2VIOA 4B2BA 1O5BB 2BVRH 4HTCH 4AYVB 2A5AA 3ZVFA 3K9XB 1ZJKA 2SGDE 1YBWA 5EG4A 2WPIS 3TIUA 2LNCA 1P03A 3RXEA 3VB5A 5C20A 1UMAH 2Z6BD 2F91A 5AVDA 4ABBA 3GCNA 2BY8X 3AAUA 2ZHWH 3BF6H 2BDYA 1C1OA 2QXIA 3TJVA 1SLWB 3VGCB 1TGNA 3M5LA 2W3IA 1F0SA 1B0EA 4AGJA 2FOCA 1O5EH 3ZYEA 1A0HB 4CRCA 1DS2E 3LONA 4K3JA 1GI6A 2BQ7B 3GCTG 1C1WH 5IYTA 5E8EH 1ZSJA 1GI0A 3OY5U 1C9PA 5AFZH 3T29A 2CV3A 2PKAB 2IJOB 1TE0A 4X1SU 5CE1A 2STAE 1UVTH 5T3HA 1L2EA 3ZZ9A 1EAWA 4BAMB 1TQ0B 2GT7A 3RXMA 4B74A 3LU9B 2ZFQH 1O3NA 2TGPZ 4I8GA 1QFKH 4GHQA 1CGJE 4BTIB 3BTHE 1GMCG 2NU3E 4K8YA 2VB0A 4NSYA 2WPKS 4I32A 1TBQH 1PPCE 4NA7A 3IITA 3A7WA 4HFPB 1O3DA 1C5UA 2P3UB 2BXUH 2ZHDA 2JH0D 1CA8B 5ABWA 4MDSA 3PYHA 5T6DA 1W7GH 2C8XB 2FI5E 4BXSA 2V3HH 3RU4E 1V2MT 4BAKB 2TGAA 1EAXA 1CVWH 1O3GA 1GHBF 2J92A 1DANH 1IAUA 4JK5A 2A5IA 1BBRE 3CS0A 4HZHA 1NRPH 1Z1JA 1CHGA 2GKVE 2HPQH 2Y7XA 1MTNC 1GG6C 1AI8H 1BTYA 2BYAX 3VPKA 2TRMA 2WYGA 1BB0B 5JDUB 4UE7H 1BTXA 2C90B 4A92A 1BUIA 2ZGHA 1AKSB 5LGOA 2STBE 2HVXA 1O2MA 1GBLA 3GOVB 1TFXA 1V2KT 1T7CA 1IQMA 1LDTT 1GI2A 1WU1A 4AG2A 1QQ4A 1QL8A 2XTTB 2J2UA 1TNKA 1SGFG 5A0CA 1SGRE 2BQ6B 1P2QA 3TK5A 1P09A 2FIRH 5E2OA 2FOAA 4WWYA 4UD9H 3CS7A 1YPJH 4FU8A 1LPGB 3ODFA 2QXHA 1K21H 1P2IA 1TB6H 1TGTA 4CBOA 1DXWA 4YLQH 2ZU3A 3MWIU 1O2TA 3A87A 3QZQA 1ZTLA 1O5DH 2UWOA 1S6FA 3IWMA 5DP3A 3F9HA 2FEQH 2A5KA 3C1KA 1O2ZA 3KEEA 2ZDKA 2Q6DA 2ZFSA 1CGHA 1V2RT 3SU3A 4XFQA 3R0FA 1HAHH 3ELAH 1NFYA 1DT2A 3HKJB 4PROA 4CH2B 3SQEE 1ETTH 2GV7A 1A2CH 3WY8A 2W3KA 1EZQA 3B9FH 1UVSH 2OCVB 3RXCA 2C8WB 2ZCKP 3E0NB 4ZKSU 3VB7A 3K6ZA 2EI6A 1Q2WA 3SU0A 2G4TA 2PSXA 3V13A 1ZOMA 3LKWA 1FI8A 4RSPA 3VGCC 2ZU5A 2AIPA 2ANWA 1CBWC 1WUNH 4ZMAH 1O3AA 2G4UA 3V3MA 4D8NA 4MLFB 4E06H 1LPZB 4GHTA 1C2DA 1ESBA 1XVOA 5EXNA 1NN6A 5EOKA 1UHBA 2F9UA 1K9OE 2GCHG 1WYKA 2GD4B 5ESTE 3GCHB 5JBCS 5HM9A 2VINA 3SU5A 1TONA 4I8JA 2ZA5A 1BRBE 2GCTC 2BLWA 3S9AA 4X8TH 1SB1H 4XSKU 1NZQH 4YZUA 3EQ0H 4BTUB 1SGPE 1ZHMA 1BTUA 3JZ1B 2Y5FA 2PGBB 4K2YA 1H8DH 1YP9A 5AF9H 4GCHF 1T8NA 3VB4A 3KIDU 2BZ6H 2Z7FE 3SZNA 1TNJA 1EKBB 1FAKH 1UK3A 2G52A 3VEQB 2BLQA 4I31A 4IMZA 1WAYB 3PMAB 2FP7B 2BLVA 4AFQA 1J8AA 3OSYA 2FI4E 5DK1A 3PMBB 1KYNA 4K1SA 1GMDF 5DGJA 3BTWE 3PM3A 3SGAE 3UY9A 1AU8A 1RIWB 1JOUB 1FY4A 2FODA 4NIVA 4UFGH 3GY7A 1C4V2 3MMGA 3KNXA 3SI3H 1BJVA 3BSQA 1MAXA 3F9FA 1LVYA 2G00A 3OU0A 4YOJA 2ZGJA 4OS2A 3NWUA 1NESE 2BD4A 4NWLA 4Q7YA 1FDPA 2ZDLA 1CGIE 2UUYA 1ZPBA 2GP9B 2UUJB 2NU1E 4SGAE 2BY5X 5F8ZA 4ZHAA 3KQCA 3SI4H 1CQQA 1ORFA 3T27A 4H4FA 4X2VA 1K1LA 2XBXA 2WUCA 2ZECA 1KTSB 1HGTH 2AH4X 4D7FA 2QA9E 5DP4A 1QB1A 2G55A 1Z71A 2GGVB 1Y3WA 3QUMP 2PWXA 5H4IB 5C1UA 4FU9A 2AIQA 3Q76A 2H5CA 2ZO3H 1BITA 1BA8B 2Q1JA 3MOCA 5GDSH 1C2GA 1O35A 1P11E 1G9IE 3ZZ4A 2FLRH 1ZHPA 4NA9H 5GJ4B 3GCTF 5JBAS 2WV4A 1ESAA 3GYLB 2GDEH 3ZVDA 3UWIA 5I46H 4FVBA 4CRAA 4ZH8A 5J4QA 3RXAA 1TGBA 3BTGE 3TGIE 1G30B 1Q31A 2F9BH 3SGQE 4CR5A 3FZDA 4YM9A 5A8YA 1VGCC 1ELGA 1GBTA 3UFAA 3BTKE 3DD2H 4TYDA 1K1JA 1OWHA 3UNQA 3TNTA 3BTTE 5K0HA 2VNTA 2FMJA 1P02A 1C2IA 1J17T 2FI3E 1E35B 1GJBB 2AYWA 4X8UH 3MU5A 1GBFA 1BHXB 5AFYH 1DLEA 2PHBA 1PYTD 1YPEH 4GLYA 1BTHH 7ESTE 2FYQA 3HPTB 3LT3A 1GDUA 2ZCLP 3SU4A 2QGRA 2PLXA 1DXPA 1LQEA 3BIVH 3SNDA 3GDSA 1D3TB 2RCEA 2ZPSA 1H9HE 1J15A 1LO6A 1KXEA 2BM2A 1QRZA 3D49H 2FOFA 1P2KA 4LK4A 1MU6B 1HJ8A 5CMXH 2FTMA 3AVZA 3TU7H 1S85A 1RGQA 3EDXB 3PLPA 1HAXB 1ZTJA 2JETC 3T2NA 4K69A 1C2EA 1VCPA 2H9HA 4AFSA 1EAIA 1QQUA 1TGSZ 3TVJB 4TY7A 4ISHH 5C1YA 1W13U 1OP8A 2UWPA 4WXVA