3RXUA

Crystal structure of trypsin complexed with benzamide (f05 and a06, cocktail experiment)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxuA02
1QBNA 2ZF0H 2Y80A 4WH8A 2RG3A 2ESTE 1DSUA 3URCA 2ZI2H 1ABJH 1GMHF 1MMJN 1P8VC 1YPHC 4A1XA 1EKBB 3TH3H 1FZZA 2BY6X 2XTTB 3FP8E 3STIA 3U8RH 1AWFH 1PYTC 3BG8A 1ZR0A 2H1UA 1IQEA 2ZU4A 2H5CA 3R0FA 2BDCA 1UCYH 2B9LA 2Y5HA 4X0WU 1TMUH 4K2YA 3A8CA 3TGKE 2ZNKH 2W3IA 6GCHG 3FANA 1BTUA 4BAQB 1BRUP 1J15A 1AVWA 2AH4X 3BIUH 1UMAH 4MNVA 4VGCB 3O8DA 3KQCA 3SI4H 5C1XA 1PPHE 1ZHMA 4ABGA 1QBOA 2BD8A 2ALPA 1BHXF 5EW2H 3UUZA 4MPVA 3ZZ5A 6CHAC 4U01A 1A0HB 4JZDH 1ELEE 2QAAA 1BBRH 1S85A 2BDBA 3N7OA 2ZTZA 1GMCF 3ZVGA 4CHAC 1U6QA 3KCGH 3SHAH 2YNBA 3KQBA 2FLBH 3Q77A 3EGKH 1ZJDA 5SGAE 3OY5U 1IQGA 2ZDNA 1SSXA 2CF8H 2XWAA 1GJ7B 4DY7B 1CBWC 3LC3A 2ULLA 1HJAC 1LVOA 4AB9A 3ELAH 2Y6TA 1N1LA 4D76A 1AE8H 3BEIB 1OWEA 3SJOA 3QK1A 1SGPE 3SQHE 2C3SA 1PPBH 1T8LA 3P8NA 1O5BB 1JBUH 3GCNA 1TRYA 3PMAB 1QGFA 3L33A 4FUIA 3T27A 2IJOB 1P2OA 1QY6A 3GOVB 2BHGA 1KXCA 3VB6A 1QQUA 2Y7ZA 3OY6U 3A84A 3LKWA 3S0NA 1P11E 1C1UH 3M37A 1LQDB 3GY3A 4TPYA 2ZDMA 3NCLA 1CA8B 3ZV9A 1ZTJA 2PGBB 1EPTB 3LH3A 1JIMA 2F91A 1GPZA 2C93B 5DP8A 1SQAA 3QDZB 2VJ1A 4FUJA 1C2HA 3TNTA 3RXHA 1BRBE 1UTMA 1BMLA 1UVTH 1O2TA 1ZHRA 1BITA 3KHVA 3PWCA 2FWWA 3O8BA 2ZHDA 4FU7A 3M3VA 3UPEA 3MTYA 1HAIH 4WMDA 1SGQE 1XUIA 3UFAA 2QF3A 1LKAA 2PKAA 4DG4A 1Y5BT 1AWHB 3VB7A 3QN7A 3RM2H 1AVXA 3M3SA 1O36A 2HLCA 1XX9A 4X8UH 2PV9B 4DCDA 4MQAA 2VWNA 2FOCA 4UEHH 2CV3A 4GSOA 3LGWA 1D3TB 1C2JA 3HPTB 1HV7A 3V12A 3BTME 5I25A 5GDSH 2V0BA 1PFXC 1O3OA 3CENA 4A6LA 2H6MA 2ASUB 2NU1E 4WWYA 5C2ZA 1IQKA 3A7VA 2G4UA 4ASHA 1NRSH 1ZLRA 3SU3A 5EPNA 1GBLA 4E7RG 5EXNA 5A0BA 2VGCB 1QR3E 1Z8JB 2R2MB 1O37A 4I8GA 1C5XB 1TMBH 1JXPA 1GBCA 1GMDF 2BQWB 3RXRA 2CMYA 2R2WU 1W0ZU 4BTIB 1W2KH 2UWLA 4NGAH 1T7CA 3HGNA 4D9QA 5EW1H 1PPZA 3MH6A 1T8MA 1UTQA 1XUHA 1W11U 2ZDKA 3GYLB 3RXFA 3RXJA 1A3BH 1GVZA 4YM9A 3GISB 1TA6A 1ZSLA 1G30B 3K6ZA 3QGNB 3RXOA 1UCYE 2CHAB 2G5VA 1W3CA 2PSXA 4AORA 1Q31A 2OC1A 4ABHA 1IQLA 5J4QA 2SFAA 3PLPA 3DHKH 7GCHG 3ENSB 1BJVA 1BQYA 1O3LA 2C90B 4ZKSU 1FXYA 4MPXA 1FNIA 1YP9A 1E36B 3TNSA 2C8YB 3RLYH 3UNSA 2XC5A 1C2FA 5FPSA 1QL9A 2PSYA 4SGAE 2ZFPH 3GCTG 2Y82A 1K1IA 2TGDA 3AAUA 2BLWA 1BRAA 1HAYB 2B7DH 1EATA 1S5SA 4DW2U 2BLOA 2XBWA 5FXLA 2FOMB 2GDEH 4MDSA 1O3MA 1BBRE 3TJOA 5CE1A 1EAWA 2Z9LA 5FCKA 1QIXB 3RU4T 4AG2A 3SV2H 3CP7A 4YOIA 3IG6B 2BY8X 4ABFA 5HM9A 1G3DA 3PMJA 3P8OA 5FHTA 2VH6A 2VIWA 2AFQB 1VITF 1BTXA 2OINA 2ZPQA 3DD2H 1C5OH 1G3CA 5JDUB 2P3UB 5GIBA 4WY3A 5A8ZA 5TCAA 1SLXB 4UDWH 1EP6A 1BJUA 3KF2A 4OGXA 3U8TH 4X1PU 4JCNA 3T28A 1TNKA 3P8FA 2Z3CA 1BTZA 2ZFTA 1AHTH 3BTHE 1GI6A 2XW9A 3KQDA 2VU8E 1BTPA 3BTDE 4D7FA 4B2CA 1TGTA 1FLEE 2Z3EA 1BDAA 1GG6C 1HIAA 1ABIH 1O31A 1SGEE 4IW4E 2AIPA 2QXHA 1UTKA 1YYY1 3D23A 2A31A 4B73A 1TX6A 1Z6EA 4BAOB 1TIOA 5GXPA 1ANDA 4UD9H 2A0QB 5F8TA 5E8EH 1O5AB 2WUBA 2JETC 3GYMA 3PROA 3V13A 4UFGH 1BMMH 1L2EA 3A7YA 1UTOA 4X6NA 1TPAE 4FU9A 2FDAA 1P02A 1ZYOA 2FTLE 3TJVA 4BTTB 1EJMA 1O3GA 4NWLA 2G55A 1WQVH 2IOTA 3RXTA 3D49H 1ARCA 2Z94A 2I6QA 1O3BA 3A8AA 1BZXE 1GBBA 1V3XA 1FY1A 2JH6D 1AE5A 1HXEH 4K1SA 1AFQB 1O3PB 1MTUA 1P9UA 1T8NA 3UIRA 2BD7A 3H7OA 3VB5A 1IHTH 2FS8A 1C4U2 1M9UA 3A87A 1CA0B 1N8OC 5EODA 4NZQA 4Y0ZE 2BMGB 5GCHF 1ANEA 1QL7A 2WPMS 2EI8A 3NWUA 1GJDB 3E90B 2P95A 3UWJH 2G4TA 4X6MA 5GJ4B 1VGCC 3A8DA 3NPSA 5IYTA 1O32A 2XCNA 1QCPA 1PPEE 1L1JA 1JIRA 5GPIB 2R0LA 4HGCA 4AFSA 2H5DA 1GCTB 1PPCE 4DT7B 1GGDC 1ID5H 2F9NA 2GKVE 2O9QA 5EG4A 3BG4B 1E0FD 2J9NA 1THRH 3A7WA 1O33A 1EB2A 1J16A 2P3TB 1WCZA 3KIDU 2ZPRA 2BB4A 1K1LA 2O8LA 2Y5FA 3GICB 4WF8A 4ZHLU 1DWDH 1HDTH 1V2RT 2KAIB 4BTUB 2FS9A 1LVMA 1MZAA 2FOEA 2GCHF 1OYQA 2QV1A 2HNTF 1MUEB 1XUGA 4CRAA 2O8TA 4X8VH 1F5KU 1DDJA 2P8OC 2J92A 1WSSH 1TRNA 1P57B 3TPIZ 1P04A 5DP4A 2Q1JA 3WY8A 4O97A 2VVUA 4XE4A 4YT7H 1OPHB 1LMWB 3F9FA 3KQEA 1AKSA 2VVVA 1DPOA 1D3QB 3U98H 1FY5A 1GBFA 1GBJA 4ZKRU 1GMHG 2J4IA 3EQ0H 1AVGH 2VNTA 4TYDA 2FI3E 1YPGH 2XBXA 1TB6H 1KTSB 2BD4A 1KTTB 2JH0D 1CHGA 2TPIZ 2XCFA 1HAVB 1KSNA 1ZSJA 1GBEA 4K60A 1XUJA 5H4IB 4INHA 2UUJB 1S83A 5A8XA 2GCTC 2VH0A 1SR5C 3MYWA 3PTNA 4I32A 1H9IE 3P17H 1C5QA 3T25A 3TH2H 3SV9A 1QB1A 3MOCA 1AI8H 3UOPA 4MNWA 4OS2A 1OP2A 3NXPA 1SGDE 2RA0A 1TYNA 2BD9A 3M61U 2FEQH 2OXSA 2BZ6H 4Y7BA 3STJA 2NU3E 1XUKA 3CS0A 3GDUA 5I46H 4RSPA 1GMCG 1A5GH 1O34A 1FI8A 4YLQH 3W95A 2G00A 2VIVA 4JZEH 4NFEA 1Y3UA 1WBGB 2FTMA 1GHWH 1QJ7B 2I6SA 4I8KA 3K9XB 1YPMH 8GCHF 1FN6A 1CBWB 1C2MA 3U1IB 4FUFA 1NT1A 1C1VH 3GY7A 3TJNA 4YT6H 2SGDE 2HNTC 2ANWA 3ZZCA 2BTCE 3ATKA 2VB0A 1XXFA 3ODDA 3V0XA 2LNCA 2SNVA 1LKBA 1F92A 4OGYA 1Y3YA 1C1QA 2OC7A 1YPEH 1SC8U 2ZQ1A 4UFDH 1O5CB 5FPYA 2XYAA 1IAUA 3MU0A 2R3YA 5DJ7A 1QB9A 1DY8A 1YLCA 3ZV8A 1NROH 2GZ9A 2ILNA 1P3EA 4Y7AA 1PQ7A 1SLWB 1CHOF 1WUNH 2BD5A 1W7XH 3L6PA 1S81A 2OQUA 5E2OA 3ZZ4A 4LK4A 2QF0A 2ZP0H 2GP9B 4ZKNU 4A7IB 4IC5A 5E0GA 1GBAA 1MKWH 2A5IA 1TX8A 2QXGA 2VINA 3HGPA 2PR3A 1Y3VA 4FUHA 5EQRA 2BX3A 2H9EH 1YCPM 1YF4A 3PB1E 1HJ8A 2FOHA 1V6DA 3IWMA 4YTAA 4ZH8A 4NG9H 1WOFA 4IBLH 3E0NB 1P10A 1PPGE 1ELVA 3E1XB 1F5LA 2A4QA 5FBEA 4A92A 3L3TA 1NS3A 3E0PB 4GCHF 1HGTH 5DP6A 1FV9A 2EEKA 4ISNA 1PJPA 3RXGA 1INCA 1JWTA 3KEEA 5C1YA 2F9VA 2FOFA 3O8CA 1AD8H 3BN9A 1CT0E 2FX6A 1QB6A 3RXIA 5A8YA 2BOHB 2BQ6B 3TIUA 4CRGA 1SGRE 1KIGH 1F7ZA 3M3TA 3LT3A 1DITH 5CHAB 2UUYA 1K1OA 3UNRA 1YC0A 2P93A 3ESTA 2AGGX 1YBWA 3W94A 1YM0A 2F9OA 1J17T 4CR5A 2P59A 1T32A 1P2KA 1MCVA 5EOKA 1MKXK 3AW1A 1WU1A 1C5VA 1BMNH 2ZEBA 1ELBA 2ZCKP 3NZIA 2SGFE 4X2VA 2AEIH 3K65B 1Z1JA 2A5KA 5ESBA 2XWBI 4NIVA 1EUFA 1GHYH 5EGMA 1V2OT 5EPYA 4AYVB 2STBE 1GBMA 1SG8B 3ATLA 3RM0H 1KXEA 3SQEE 2ZDAH 1GMDG 3VGCB 1O5DH 3I78A 1QRZA 3BEUA 3M7UA 2EA3A 1EAXA 5T6DA 2FP7B 1HXFH 1IQHA 1MTNC 1TWXB 1PQAA 3KGPA 3PM3A 1N6YA 4X1RU 4AB8A 1A1RA 5JBBS 1ZMLA 8ESTE 1K28D 1KLTA 1ACBE 2XC4A 5FBIA 3HKIB 3QLPH 1WV7H 2IN2A 2TRMA 1CGHA 2AMDA 1QJ1B 4DIIH 1NRRH 3PYHA 1BB0B 1L1NA 3OU0A 1ZGIA 2V3OH 1GJ4H 1HAOH 3QZRA 1PQ8A 1LHGH 5C5OA 1O2PA 1TOCB 3MO9A 1O2VA 1ANCA 1P2NA 1DICA 2Q6FA 1S0RA 4CRBA 4HTCH 5JBCS 2OBOA 3MNBA 5C5NA 4I8LA 1TPSA 1FUJA 4OS7A 2BLVA 3SZNA 2FYRA 2WPKS 2FOGA 3ITIA 2R3UA 1FY4A 5K0HA 1C1TA 1E34B 1QQ4A 4DOQA 4ABJA 2BY7X 2BDHA 1GI4A 2ZCHP 3A81A 1HNEE 3F6UH 3RXCA 3V7TA 1H8IH 1RXPA 1UTNA 4JYUH 3HKJB 5L30H 2CJIA 1AB9B 5T6GA 7ESTE 2Z7FE 2V6NA 2BVRH 3BEFB 5J4SA 1QBVH 3RU4E 3RXLA 1RIWC 1GJCB 2ZU5A 5L2YH 1V2MT 2GVFA 2OD3B 1AN1E 1BCUH 4DURA 2BX4A 4NFFA 4KKDA 3RXQA 2SNWA 1DWBH 2VVCA 2DE9A 4BNRA 1ELTA 1BRCE 1QRWA 2VWMA 3H7TA 4KELA 3P6ZB 3PO1B 3FAOA 5JPMH 1OWKA 5EQQA 5DO4H 2NU4E 3A7XA 1B0EA 1GDQA 1A2CH 1O2JA 5FX5A 1QTFA 3EA9A 5B6OA 2ZPSA 2ZWLH 1GG6B 3LC5A 1ZHPA 2XC0A 1ZPBA 1MTVA 1K22H 3B8JA 1YPKH 3MMGA 1LQEA 4TWYA 1O3EA 1SGCA 3FZZA 4U2WA 1J8AA 1O2ZA 1ZZZA 1QURH 2YOLA 1A7SA 2ZFFH 3LOXA 1RFNA 1CQQA 2AMPA 3B23B 2FXRA 3ATWA 1DANH 1AGJA 2HALA 3F1SB 3Q3KA 3RXKA 4YOGA 1NFWA 1FIWA 1MQ6A 1THSH 3NUMA 1OYTH 1MU8B 1C1SA 4NA7A 1EZUC 2FOAA 3QO6A 2FESH 1TE0A 4FUDA 4H6SB 1D6RA 1UVPA 4IN1A 1O3NA 2ZZUH 1CU1A 1YLDA 1DSTA 1V2TT 3P8GA 2ZGXH 1H4WA 2PKAB 4VGCC 4UONA 1G3EA 1P06A 3VXFH 1RTKA 3D65E 3BSQA 1UK4A 3ZVFA 2B5TB 1HB0B 1TLDA 1X7AC 4PROA 1EXFA 2H9HA 3T26A 4AFUA 2R9PA 1WYKA 1C1OA 1GHXH 1NY22 4AGKA 5HXFA 1F0SA 1ELAA 3A86A 1TNIA 4CR9A 4K8BA 1DY9A 5F6MA 1IQFA 4HI3A 1EZXC 1NZQH 1Y5UT 1YCPH 1Z6JH 5C67A 3BTFE 2BDIA 3FP7E 3UNQA 3SV6A 1UHBA 1LPZB 2BLQA 3MNXA 1SGTA 4CREA 5JB8S 1NU9A 1EZQA 2ZGCA 4OS1A 2WYGA 4BAHB 1O2SA 3HK3B 4XBCA 9ESTA 3TGJE 4GAWA 1MQ5A 4FUEA 4IS5A 3SOSA 5IDKA 2GMTB 1CGJE 3ATMA 1D9IA 4WMEA 2PTNA 2A32A 1UK3A 2D8WA 1HAHH 1D4PB 4Y8ZA 2CGAA 3BF6H 1PPFE 1VJAU 1WTHD 1RJXB 1O2UA 4WMFA 5LPRA 2ZG0H 3RDZA 3BIVH 3T29A 5AHGH 4RN6A 3RXSA 4H4FA 3BTEE 2GCHG 1W8BH 3RXUA 1A5HA 1DVAH 4YO9A 4F49A 1K21H 1S82A 1ZSKA 1HJ9A 3BTWE 2Y5GA 1JOUB 1EPTC 4THNH 2ZKSA 4MPWA 1BTHH 1C1NA 2C8ZB 5FPTA 2EC9H 4X6PA 2ZCLP 2ODQA 1O3DA 2D26C 2PKSB 1SOZA 1K1PA 2A4GA 3BTKE 3M5LA 4JMYA 5JYIA 3PTBA 4IC6A 2HOBA 3M5OA 4ZROA 3SUDA 4YOJA 2A1DB 1NRNH 2FM2A 1GI5A 3SNBA 3UQOA 2A7HA 1J14A 2HPQH 1A3EH 3M36A 3MFJA 2CF9H 3K2UA 2D2DA 3GCHB 4ZXXH 4AFZA 1Y3WA 3S69A 1NN6A 1DFPA 1L4DA 1AUJA 3UR6A 1K1NA 1HFDA 1GVLA 3ZVDA 3RC4A 5JB9S 2J95A 5DK1A 3UY9A 3RMNH 1LHDH 2P16A 3SU6A 2ZFRH 1FONA 2FPZA 4GLYA 3RXAA 4Z6AH 1MU6B 3Q00A 1C1RA 3ZZAA 1FY3A 1C5MD 2A5AA 2ANKH 3LU9B 1NC6A 1QJ6B 3UREA 2UUKB 3E8LA 1QL8A 2V3HH 2GX4A 4QT8C 1ZTLA 2FMJA 3ZZ8A 1GJBB 1O2QA 1EB1H 4B2BA 3SU1A 3MH4A 2AGIX 2VGCC 3GY4A 1L4ZA 1OWHA 3FVFB 3RP2A 1O0DH 3B9FH 1HIAB 2C8XB 2VWOA 3ZYDA 2F9BH 4NIYA 2TBSA 2XRCA 1YPLH 1O2IA 1ANBA 2BY5X 1UCYK 3SW2B 1P9SA 1A0LA 3ZYEA 2C8WB 4JZIA 3MHWU 4WJG2 2OTVA 8GCHG 3T62A 1OWIA 1F0RA 2PW8H 4NA8A 3PLKA 2QIQA 3U8OH 2DUCA 1DWCH 2CHAC 2EI6A 3QWCH 1S6FA 1BTWA 1OP8A 3E6PH 4K3JA 2BXTH 4NA9H 2TIOA 1QNJA 2FO9A 4RKJB 5AVDA 5TJXA 1C9TA 1NRPH 3MI4A 2AS9A 3MO3A 4AZ2B 1C2LA 3GCTF 4ESTE 1QA0A 2FX4A 1BBRK 1O2LA 2HGTH 2GZ7A 1E37B 1DM4B 3SJIA 1TAWA 3C27B 4CH8B 3MU8A 2ZC9H 1C4V2 1O5EH 4Y0YE 5E2PA 1CHOG 1LCYA 2F9PA 5HM2A 1OS8A 3DT0H 2FZZA 2WPHS 1TBRH 1TGBA 3SJKA 4FUCA 1F0TA 2WPIS 3UOUA 4D7GA 2OUAA 4WXIA 2Z9KA 5EQSA 1ETTH 2EI7A 3SHCH 2Z6BD 5ABWA 3MU5A 4NCYA 2FI5E 1OX1A 3GDSA 2ZFSA 1DLEA 1V2KT 3VEQB 1TPOA 1V2ST 1HAZB 1RD3B 1B0FA 3F68H 4GCHG 4WXVA 4Y8YA 1ZGVA 2JH5D 7KMEH 4K5ZA 1VR1H 2HVXA 1ZJKA 1TMTH 1CVWH 3K6YA 3SNDA 4XSKU 1NFYA 3FZDA 1O2RA 4UE7H 2D1JA 1BTYA 1GL0E 3GDVA 4YESB 1QHRB 2A7CA 5EU8A 5CMXH 1KXBA 1C5SA 4MLFB 2PUXB 5F03A 1XKBC 1H1BA 3SV8A 3TITA 4CBNA 1A0JA 2G5NA 1P05A 1V2QT 2J2UA 1S6HA 1EQ9A 3PMBB 3NK8A 3TK6A 4IGDA 1G37A 4X1QU 1ETSH 4I8JA 1BUIA 1Z7KA 3QZQA 5AFYH 5LPFA 3SGAE 2G52A 2ZHEH 2PUQH 5FAHA 2W7SA 2GT8A 2QN5T 2NU2E 3AASA 1EAIA 2BD3A 1GJAB 2Z3DA 1H9HE 4E06H 3BV9B 2RCEA 1SGNE 6CHAB 1XVMA 3PLBA 3SV7A 3GY8A 2W3KA 1EAUA 3SJ9A 2QYIA 2F3CE 1O30A 3A8BA 1SPJA 4U32A 4CHAB 4CRDA 1OSSA 4B2AA 1EZSC 1AKSB 1TNJA 1EJAA 3RXMA 1SLVB 2LPRA 3MNCA 1BMAA 2HRVA 4F4OC 3ZZ6A 3OTJE 4GPGA 2Y81A 1YPJH 4GHQA 1HJAB 3HK6B 4GUXA 2BVSH 2BDYA 5DPAA 1DX5M 3Q3YA 4AFQA 3CS7A 1JMOH 2XBYA 1P3CA 1NTPA 1KXFA 3A80A 1P0SH 2FOBA 1CA0C 3ZVCA 3RXDA 2ZU3A 3ATIA 1GJ8B 2QXJA 1LPKB 1KDQA 2BVXH 1AFEH 4Y10E 1QA7A 4X8SH 4Q2KA 3PV4A 5JBAS 1IQJA 2O8MA 4O3UA 1TNLA 1E35B 2ZHQH 1GCDA 1THPB 2GGVB 1TFXA 4AG1A 1WTGH 1DUEA 2JKHA 3LGVA 4ABIA 1UVUH 3E3TA 4FVDA 1EJNA 1TONA 1UVSH 1HCGA 2ZGBH 1KYNA 3LH1A 1GCTC 2GV6A 1RS0A 3TGIE 1XMNB 4YLUA 1UO6A 2ZTYA 2ZTXA 2OP9A 2BQ7B 3BG4C 2QCYA 2BZAA 2WPJS 3LGIA 1O2YA 5FCRA 3BTTE 1PQ5A 1V2VT 3QX5H 3JZ2B 4E7NA 1MAXA 2F9UA 1VCPA 3G01A 3RC5A 1GHAF 3ZZ9A 1ZOMA 2Y7XA 4JYVH 2ZGHA 1JRSA 1SQOA 1TGSZ 2ZQ2A 3SU4A 4ABBA 1BHXB 1Q3XA 1NM6A 1P2MA 2BOKA 3QTVH 4ABEA 3O8RA 5LPEA 1O39A 4O9VA 4INKA 4B1TA 3EE0B 4XBBA 1AUTC 8LPRA 1AZZA 1TBQH 3DUXH 5BRRE 2BXUH 1Y8TA 2ZGJA 3VPKA 1P2QA 4JZFH 5HYOA 1O2XA 3DFJA 3MH7A 1O3KA 3P95A 1YPHE 4DVAU 2K1QA 4YZUA 3EDXB 3PMHB 2ZIQH 4B74A 2J34A 2AGEX 4KGAA 2Z9IA 2VIOA 1TQ0B 1ELDE 3M5NA 4LXBH 3GY2A 1GHBF 1G9IE 2ZHWH 2TGTA 2VIDA 1O3HA 1SBWA 3M35A 1VJ9U 5JBTA 1T8OA 3C1KA 2ZU2A 3LIWA 4U30A 1V2LT 4H6TA 4I31A 4OS4A 3SNCA 3SU2A 1ZPZA 4NZLA 3LJOA 2GD4B 6ESTA 1OKXA 3RU4D 3ZVBA 4JK5A 1P12E 3SU5A 1W13U 3LGTA 1DLKB 2ZDVH 3U1JB 1D3DB 4GHTA 4ABAA 1XUFA 1Y5AT 2ANMH 1FDPA 5C20A 1SVPA 1JRTA 1ZMJA 2W7UA 1EPTA 1A5IA 3SGBE 4LZ1H 1NRQH 1C5LH 1QRXA 2UUFB 5G4BA 5DP5A 4FVBA 2BYAX 2XBVA 4FU8A 1ZPCA 3DA9B 4X8TH 1C9PA 3LPRA 1ESBA 3JZ1B 4IN2A 1UTLM 2SGAA 2Z9GA 5E0JA 5A09A 1FAXA 4K69A 1G2MA 3LGUA 4Q7ZA 3ZZDA 1DS2E 1C2IA 2V35A 1GI1A 2ANYA 1Z8IB 2HPPH 2ZO3H 2Q6GA 3SU0A 2HWLB 1VITG 1FIZA 1BOQA 1HPGA 3TJUA 1CO7E 4AN7A 2VIPA 1UVOA 1UTJA 3BTGE 4MNYA 2ZECA 5K7RA 2ZDLA 4Y6DA 2WINI 5DKMA 4NSYA 2SGPE 4O03A 2A7JA 2GV7A 1SLUB 1HYLA 1FMGA 1AO5A 1O2HA 1SHYA 4AOQA 1NESE 3A7TA 4TY6A 1VCWA 1C2GA 2TGPZ 4Y76A 5DP9A 1EOJA 1MBMA 1TQ7B 1RGQA 5L2ZH 1GI7B 3M7TA 1BT7A 3SO3A 1EP5A 1MAYA 1LVBA 3T5FH 5F8XA 2XXLA 1V2PT 3ODFA 5EXMA 5A0AE 1SI5H 1FPHH 2JETB 3UWIA 1A46H 2THFB 4Q80A 1SFQB 1TNGA 1V2NT 2WPLS 2OBQA 4Y71A 5CHAC 2XNIA 1Z71A 3SUGA 1O2KA 3FP6E 4CBOA 2ODPA 6GCHF 1GJ5H 4LOYH 4XBDA 3RMLH 4X1SU 1RTLA 1DXPA 1Y59T 1O2NA 4ZAEA 4A1TA 1C1PA 1AY6H 3FFGA 2PFEA 1CGIE 1IQMA 1GBKA 1TA2A 3TK9A 4FXGH 1VITH 5AF9H 1MD8A 4WVPE 3A7ZA 2C4FH 2A2QH 1O2WA 3P70B 1P2JA 1GDUA 1N8OB 1XM1A 4GVUA 3VGCC 2ZU1A 4E05H 5GCHG 2OC8A 1D6WA 4BANB 1VGCB 1GDNA 5DG6A 4AGJA 2PWXA 4AYYB 1C2EA 3M7QA 2A4RA 2BD2A 2FODA 4DGJA 3URDA 1GVKB 3OYPA 2J38A 1DUAA 4OS5A 3ZZ7A 1Z8RA 4ISOA 4XOJA 1WAYB 1UJ1A 3Q76A 1HRTH 4ISHH 1CE5A 1SGIB 3BTQE 1GGDB 1S0QA 1T31A 2O8UA 1NU7B 4KTCA 2G8TA 2WV4A 3I77A 1O3AA 4A1VA 5LGOA 1IOEA 3UR9A 3R3GB 4ZHMU 3ZVAA 1C1WH 3ZZ3A 2PHBA 2VIQA 4X2WA 3EA7A 1T4UH 4WH6A 4X6OA 2YNAA 2DE8A 3A85A 1FAKH 1BA8B 4CRFA 3AW0A 3GY5A 3KL6A 4TPIZ 3SN8A 1OOKB 1W0YH 5LH8A 1ARBA 1GI2A 2FYQA 2QC2A 4I33A 1ZRKA 2PTCE 1KY9A 1W12U 4KP0A 1ESTA 3NKKA 1H8DH 1BIOA 4TWWA 3S9BA 1XVOA 2G51A 4DJZB 2P8OB 4MG3A 1Q2WA 4KTUA 1AB9C 2VWLA 3MNSA 1DWEH 1MKXH 3Q3XA 4AX9H 1UHBB 1S84A 2PGQB 3RC6A 1OP0A 2R0KA 2IPHA 1DE7H 5FX6A 1TNHA 1C5ZB 3OX7U 1A4WH 1C5PA 3U69H 8KME2 4X2XA 1G36A 3RXEA 1HLTH 1EX3A 4LZ4B 3PWBA 1TALA 3PO1C 4HZHA 1LVYA 3EAJA 1DXWA 1O38A 1G3BA 1E38B 4O3TA 3AVZA 3GCOA 1SQTA 1OXGA 1MKWK 2NWNA 1P01A 1Z8GA 1W7GH 4A5TS 1V2JT 2PLXA 3E91A 1SMFE 2QXIA 3RMOH 4FUGA 3RLWH 2B8OH 1HAGE 3LONA 1CSOE 2GCTB 3A83A 1EASA 3A89A 4XFQA 3MU4A 4D8NA 1XKAC 1FN8A 1MTWA 5C1UA 3RXBA 1AMHA 1G2LA 4Y79A 1ZTKA 2SGQE 5ESTE 1C2DA 4H42U 1ETRH 1LHFH 4TY7A 2OCVB 2BDGA 1DOJA 4B71A 1SL3A 5GWZA 3E16B 1W10U 2GDDA 5DP7A 3F9GA 1HAPH 1SHHB 4MNXA 3IITA 2FLRH 1IQIA 1FPCH 3MH5A 1N6XA 5F8ZA 1AQ7A 1SOTA 1SB1H 3GY6A 1C4Y2 3SUFA 3T2NA 1MTSA 4HFPB 1GI9B 2OC0A 1NPMA 1GJ6A 2F83A 2WYJA 4Z0KA 4BOHA 4B75A 1GBHA 4Q7YA 2KAIA 1KXAA 1GJ9B 2W26A 1V2UT 1P09A 3RXVA 3TU7H 3U9AH 3VFEA 7GCHF 1F5RA 1GL1A 3S7KB 3TVJB 2W5EA 1F2SE 7LPRA 1LTOA 1UK2A 1HUTH 4K1EA 5ETXA 1VZQH 1GBDA 1MD7A 1NO9H 5AFZH 1V2WT 1W14U 4JZ1A 1LDTT 1C5WB 1SGFG 1IQNA 2RDLA 3SBKA 1O3IA 3V3MA 1L0ZA 1AU8A 1RTFB 1LO6A 1MH0A 1LHEH 2CN0H 3KN2A 3AAVA 3QGJA 3MWIU 2GMTC 3OSYA 1D3PB 4CH2B 1Z1IA 3EA8A 4ISLA 5T6FA 4DIHH 1J9CH 1KLJH 3QUMP 3RUOA 3MO6A 1MBQA 1ZMNA 4ZXYH 4SGBE 1O3CA 1EOLA 2RA3A 1TOMH 4B76A 4J2YB 2OQ5A 4FUBA 1O2MA 2AMQA 4ZMAH 5L6NH 1GHZA 2STAE 1HAVA 2WUCA 2FI4E 2ZHFH 1KXDA 3SGQE 1SFIA 4NSVA 1OWDA 1TABE 1LPGB 1O5GH 2AIQA 4KTSA 3UQVA 2M5TA 2P3FH 3SI3H 1GHAG 1ZRBA 2B0FA 1GWAA 1SGFA 3P92A 4JK6A 3QTOH 1RRKA 1Y3XA 5T3HA 5DGJA 1K1JA 4R8TB 1C5NH 3LDXH 2BDAA 3EYDA 1HBTH 1TRMA 3SUEA 2G81E 1ELCA 2FIRH 3KNXA 3LJJA 4RKOB 2PKSC 1GBTA 4NIXA 4IMQA 3VB4A 5E0HA 4Y8XA 3SNAA 3S7HB 1AZ8A 3SORA 4ZKOU 3GCHC 1O2OA 1XXDA 3UTUH 4BXWA 1CT2E 1P2IA 1LHCH 1MZDA 2WV5A 9LPRA 1L1GA 4X2YA 1CT4E 4Q7XA 3RXPA 5DP3A 3TK5A 3MU1A 5PTPA 3A82A 1GHBG 1T4VH 1TPPA 2P94A 4ABDA 4MPUA 1MTNB 2BY9X 1K1MA 3RMMH 1O35A 2TGAA 1FQ3A 4I7YH 4I8HA 5A2MH 4D9RA 1C1MA 5TCCA 2OLGA 1AFQC 4CRCA 2UWPA 3ZVEA 1UTPA 1HAXB 3A88A 1OWJA 4IMZA 1O5FH 4UFFH 1K9OE 3TLOA 1ELFA 4X1NU 5A0CA 4UFEH 1NFXA 5C3NA 3SJ8A 4BXSA 3SNEA 1O3JA 1VCQA 2ALVA 3VB3A 3VXEH 5HGGA 2CXVA 2H9TH 1TBZH 2GZ8A 2QGRA 5EXLA 1C5YB 1O2GH 1FJSA 2GT7A 4XDEA 4JYTA 1C2KA 2ODYB 4BAKB 1C5TA 1P03A 3D62A 2BM2A 2UWOA 2ZFQH 1KLIH 1B5GH 4NWKA 2A4OA 1SGYE 1TX7A 2QA9E 4MVNA 1ORFA 1IHSH 2HNTE 1F0UA 1MCTA 1B7XB 1ESAA 1WQSA 3TH4H 1TGNA 1A61H 1DT2A 1GBIA 4INLA 2O8WA 1O3FA 2A45B 4Y11E 1RIWB 1C5RA 1NFUA 3H5CB 3F9HA 1K2I1 4ZUHA 2SGEE 3HATH 1ELGA 1PYTD 2H2ZA 2AERH 1GHVH 2QY0B 1YGCH 1GI3A 4K8YA 3DFLA 1C5UA 1YCPK 2AYWA 2Z9JA 3M5MA 1TGCA 4M7GA 1GI0A 3S9CA 1FY8E 2ZA5A 4J1YA 4ISIH 2NU0E 2Q6DA 4OS6A 4ZHAA 1GI8B 1KDQB 2GTBA 5HMAA 4K1TA 3S9AA 1H9LB 6LPRA 3F9EA 4NIWA 5BPEA 1YKTA 2J94A 2A2XH 1QFKH 4R0IA 4BAMB 3I29A 3ZZBA 3LGYA 1AIXH 4MTBA 1G32B
chains in the Genus database with same CATH superfamily
1QBNA 2ZF0H 2Y80A 4WH8A 2RG3A 2ESTE 3H09A 3SYJA 1DSUA 3URCA 2ZI2H 1ABJH 4XD7D 1GMHF 1MMJN 1P8VC 1YPHC 4A1XA 1EKBB 5EJLA 1FZZA 2BY6X 2XTTB 3FP8E 3STIA 3TH3H 1AWFH 1PYTC 3U8RH 3BG8A 1ZR0A 2H1UA 1IQEA 2ZU4A 2H5CA 3R0FA 2BDCA 1UCYH 2B9LA 2Y5HA 4X0WU 1TMUH 4K2YA 3A8CA 3TGKE 2ZNKH 2W3IA 6GCHG 3F2FA 3FANA 1BTUA 4BAQB 1BRUP 1J15A 1AVWA 2AH4X 3BIUH 1UMAH 4MNVA 4VGCB 3O8DA 3KQCA 3SI4H 5C1XA 1PPHE 1ZHMA 4ABGA 1QBOA 2BD8A 2ALPA 1BHXF 5EW2H 3UUZA 4MPVA 3ZZ5A 6CHAC 4U01A 1A0HB 4JZDH 1ELEE 2QAAA 1BBRH 1S85A 2BDBA 3N7OA 2ZTZA 1GMCF 3ZVGA 4CHAC 1U6QA 3KCGH 3SHAH 2YNBA 3KQBA 2FLBH 2J98B 3Q77A 3EGKH 1ZJDA 5SGAE 3OY5U 2L6OA 1IQGA 2ZDNA 1SSXA 2CF8H 2XWAA 1GJ7B 4DY7B 1CBWC 3LC3A 1NBMD 2ULLA 1HJAC 1LVOA 1S6LA 4AB9A 5C94A 3ELAH 2Y6TA 1N1LA 4D76A 1AE8H 3BEIB 1OWEA 3SJOA 3QK1A 1SGPE 3SQHE 2C3SA 1PPBH 2VBCA 1T8LA 3P8NA 1O5BB 1JBUH 3GCNA 1TRYA 3PMAB 1QGFA 3L33A 4FUIA 3T27A 2IJOB 1P2OA 1QY6A 3GOVB 2BHGA 1KXCA 3VB6A 1QQUA 2Y7ZA 3OY6U 3A84A 3LKWA 5DN6D 3S0NA 1P11E 1C1UH 1W0JD 3M37A 1LQDB 3GY3A 4TPYA 2ZDMA 3NCLA 1CA8B 3ZV9A 1ZTJA 2PGBB 1EPTB 3LH3A 1JIMA 2F91A 1GPZA 2C93B 5DP8A 1SQAA 3QDZB 2VJ1A 4FUJA 1C2HA 3TNTA 3RXHA 1BRBE 1UTMA 1BMLA 1UVTH 1O2TA 1ZHRA 1BITA 3KHVA 2F43B 3PWCA 2FWWA 4RT0A 3O8BA 2ZHDA 4FU7A 3M3VA 3UPEA 3MTYA 1HAIH 4WMDA 1SGQE 1XUIA 5CHBA 1H8HD 3UFAA 2QF3A 1LKAA 2PKAA 4DG4A 1Y5BT 1AWHB 3VB7A 3QN7A 3RM2H 1AVXA 3M3SA 1O36A 2HLCA 1XX9A 4X8UH 2PV9B 4DCDA 4MQAA 2VWNA 5KEDA 2FOCA 4UEHH 2CV3A 4GSOA 3LGWA 1D3TB 1C2JA 3HPTB 1HV7A 3V12A 3BTME 5I25A 5GDSH 2V0BA 1PFXC 1O3OA 3CENA 4A6LA 2H6MA 2ASUB 2NU1E 4WWYA 5C2ZA 1IQKA 3A7VA 2G4UA 4ASHA 1NRSH 1ZLRA 2CK3D 3SU3A 5EPNA 1GBLA 4E7RG 5EXNA 5A0BA 2VGCB 1QR3E 1Z8JB 2R2MB 1O37A 4I8GA 1C5XB 1TMBH 2QF5A 1JXPA 1COWD 1GBCA 1GMDF 2BQWB 3RXRA 2CMYA 2R2WU 2IJD1 3SZEA 1W0ZU 5B6LA 4BTIB 1W2KH 2UWLA 1K0HA 4NGAH 1T7CA 3HGNA 4D9QA 5EW1H 1PPZA 3MH6A 1T8MA 1UTQA 1XUHA 1W11U 2ZDKA 3GYLB 3RXFA 3RXJA 1A3BH 1GVZA 4YM9A 5HIZA 3GISB 1TA6A 1ZSLA 1G30B 3K6ZA 3QGNB 3RXOA 1UCYE 2CHAB 1UW7A 1W3CA 2G5VA 2PSXA 1Q31A 2OC1A 4ABHA 1IQLA 4AORA 5J4QA 2SFAA 3PLPA 3DHKH 7GCHG 3ENSB 1BJVA 1BQYA 1O3LA 2C90B 4ZKSU 5HIYA 4F55A 1FXYA 4MPXA 1FNIA 1YP9A 1E36B 3TNSA 2C8YB 3RLYH 3UNSA 2XC5A 1C2FA 5FPSA 1QL9A 2PSYA 4SGAE 2ZFPH 3GCTG 3PV2A 2Y82A 1K1IA 2TGDA 3AAUA 2BLWA 1BRAA 1HAYB 2B7DH 1EATA 1S5SA 4DW2U 2BLOA 2XBWA 5FXLA 2FOMB 2GDEH 4MDSA 1O3MA 1BBRE 2IPQX 3TJOA 5CE1A 1EAWA 2HLDD 2Z9LA 5FCKA 1QIXB 3RU4T 4AG2A 3SV2H 3CP7A 4YOIA 3IG6B 2BY8X 4ABFA 5C0UA 5HM9A 1G3DA 3PMJA 3WWFA 3P8OA 5FHTA 2VH6A 2VIWA 2AFQB 1VITF 1BTXA 2OINA 2ZPQA 4ACBA 3DD2H 1C5OH 1G3CA 5JDUB 2P3UB 1H8ED 5GIBA 4WY3A 5A8ZA 5TCAA 1SLXB 4UDWH 1EP6A 1BJUA 3KF2A 4OGXA 3U8TH 4X1PU 4JCNA 3T28A 1TNKA 3P8FA 2Z3CA 1BTZA 2ZFTA 1AHTH 3BTHE 2WPDD 1GI6A 2XW9A 3KQDA 2VU8E 1BTPA 3BTDE 4D7FA 4B2CA 1TGTA 1FLEE 2Z3EA 1BDAA 1GG6C 1HIAA 1ABIH 1QZ8A 1O31A 1SGEE 4AC9A 4IW4E 2AIPA 2QXHA 1UTKA 1YYY1 3D23A 2A31A 3WWBA 4B73A 1TX6A 1Z6EA 4BAOB 1TIOA 5GXPA 1ANDA 4UD9H 2A0QB 5F8TA 5E8EH 1O5AB 2WUBA 2JETC 3GYMA 3PROA 3V13A 4UFGH 1BMMH 1L2EA 3A7YA 1UTOA 4X6NA 1TPAE 4FU9A 2FDAA 1P02A 1ZYOA 2FTLE 2WHXA 3TJVA 4BTTB 1EJMA 1O3GA 4NWLA 2G55A 1WQVH 2IOTA 3RXTA 3D49H 1ARCA 2Z94A 2I6QA 1O3BA 3A8AA 1BZXE 1GBBA 1V3XA 5FL7D 1FY1A 2JH6D 1AE5A 1HXEH 4K1SA 1AFQB 1O3PB 1MTUA 1P9UA 1T8NA 3UIRA 2BD7A 4I86A 3H7OA 3VB5A 1IHTH 2FS8A 1C4U2 1VKYA 1M9UA 2V7QD 3A87A 1CA0B 1N8OC 5EODA 4NZQA 4Y0ZE 2BMGB 5GCHF 1ANEA 1QL7A 2WPMS 2EI8A 3NWUA 1GJDB 3E90B 2P95A 3UWJH 2G4TA 4X6MA 5GJ4B 1VGCC 3A8DA 3NPSA 5IYTA 1O32A 2XCNA 1QCPA 1PPEE 1L1JA 1JIRA 3KYFA 5GPIB 2R0LA 4HGCA 4AFSA 2H5DA 4TT3D 1GCTB 1PPCE 4DT7B 1GGDC 1ID5H 2F9NA 2GKVE 2O9QA 3MQKC 5EG4A 3BG4B 1E0FD 2J9NA 1THRH 3A7WA 1O33A 1EB2A 1J16A 2P3TB 1WCZA 3KIDU 2XNDD 2ZPRA 2BB4A 1E1RD 1K1LA 2O8LA 2Y5FA 3GICB 4WF8A 4ZHLU 1DWDH 1HDTH 1V2RT 2KAIB 4BTUB 2FS9A 1LVMA 1MZAA 2FOEA 2GCHF 1OYQA 2QV1A 2HNTF 1MUEB 1XUGA 4CRAA 2O8TA 4X8VH 1F5KU 1DDJA 2P8OC 2J92A 1WSSH 1TRNA 1P57B 3TPIZ 1P04A 5DP4A 2Q1JA 5CDFE 3WY8A 4O97A 2VVUA 4XE4A 4YT7H 1OPHB 1LMWB 3F9FA 3KQEA 1AKSA 2VVVA 1DPOA 1D3QB 3U98H 1FY5A 1GBFA 1GBJA 4ZKRU 1GMHG 2J4IA 3EQ0H 1AVGH 2VNTA 4TYDA 2FI3E 1YPGH 2XBXA 1TB6H 5KGOA 1KTSB 2BD4A 1KTTB 2JH0D 1CHGA 2TPIZ 2XCFA 1HAVB 1KSNA 4P00A 1ZSJA 1GBEA 4K60A 1XUJA 5H4IB 4INHA 2UUJB 4DT4A 1S83A 5A8XA 2GCTC 2VH0A 1SR5C 3MYWA 3PTNA 4I32A 1H9IE 3P17H 1C5QA 3T25A 3TH2H 3SV9A 1QB1A 3MOCA 1AI8H 3UOPA 4MNWA 4OS2A 1OP2A 3NXPA 1SGDE 2RA0A 1TYNA 2BD9A 3M61U 2FEQH 2OXSA 2BZ6H 4Y7BA 3STJA 2NU3E 3DCLA 3F0PA 2RFKC 1XUKA 1YWUA 3CS0A 3GDUA 5I46H 4RSPA 1GMCG 1A5GH 1O34A 3F3BA 1FI8A 4YLQH 3W95A 2G00A 2VIVA 4JZEH 4NFEA 1Y3UA 1WBGB 2FTMA 1GHWH 1QJ7B 2I6SA 4I8KA 5C0TA 3K9XB 1YPMH 8GCHF 1FN6A 1CBWB 1C2MA 3U1IB 4FUFA 1NT1A 1C1VH 3GY7A 3TJNA 1YLNA 4YT6H 2SGDE 2HNTC 2ANWA 3ZZCA 2BTCE 3ATKA 2VB0A 1XXFA 3ODDA 3V0XA 2LNCA 2SNVA 1LKBA 1F92A 4OGYA 1Y3YA 1C1QA 2OC7A 1YPEH 1SC8U 2ZQ1A 4UFDH 1O5CB 5FPYA 2XYAA 1IAUA 3MU0A 2R3YA 5DJ7A 1QB9A 1DY8A 4YXWD 1YLCA 3ZV8A 1NROH 2GZ9A 2ILNA 2JJ1D 1P3EA 4Y7AA 4ACAA 1FX0B 1PQ7A 1SLWB 1CHOF 1WUNH 2BD5A 1W7XH 3L6PA 1S81A 2OQUA 5E2OA 3ZZ4A 4LK4A 2QF0A 2ZP0H 2GP9B 4ZKNU 4A7IB 4IC5A 5E0GA 1GBAA 1MKWH 2A5IA 1TX8A 2QXGA 2VINA 3HGPA 2PR3A 1Y3VA 4FUHA 5EQRA 2BX3A 2H9EH 1YCPM 1YF4A 3PB1E 1HJ8A 3OAAD 2FOHA 1V6DA 3IWMA 4YTAA 4ZH8A 4NG9H 1WOFA 4IBLH 3E0NB 1P10A 1PPGE 1ELVA 3E1XB 1F5LA 2J5UA 2A4QA 5FBEA 4A92A 3L3TA 1NS3A 3E0PB 4GCHF 1HGTH 5DP6A 1FV9A 3PRBA 2EEKA 4ISNA 1PJPA 3FKSD 3RXGA 1INCA 1JWTA 3KEEA 5C1YA 2F9VA 2FOFA 3O8CA 1AD8H 3BN9A 1CT0E 1WXRA 2FX6A 5GNDA 1QB6A 3RXIA 5F53A 5A8YA 2BOHB 2BQ6B 3TIUA 4CRGA 1SGRE 1KIGH 1F7ZA 3M3TA 3LT3A 1DITH 5CHAB 2UUYA 1K1OA 3UNRA 1YC0A 2P93A 3ESTA 2AGGX 3FO8D 1YBWA 3W94A 1YM0A 2F9OA 1J17T 4CR5A 2P59A 1T32A 1P2KA 1MCVA 5EOKA 1MKXK 3AW1A 1WU1A 1C5VA 1BMNH 2ZEBA 1ELBA 2ZCKP 3NZIA 2SGFE 2YMSD 4X2VA 2AEIH 3K65B 1Z1JA 2A5KA 5ESBA 2XWBI 4NIVA 1EUFA 1GHYH 5EGMA 1V2OT 5EPYA 4AYVB 2OK5A 2STBE 1GBMA 1SG8B 3ATLA 3RM0H 1KXEA 3SQEE 2ZDAH 1GMDG 3VGCB 1O5DH 3I78A 1QRZA 3BEUA 3M7UA 2EA3A 1EAXA 5T6DA 2FP7B 1HXFH 1IQHA 1MTNC 1TWXB 1PQAA 3KGPA 3PM3A 1N6YA 4X1RU 4AB8A 1A1RA 5JBBS 1ZMLA 8ESTE 1K28D 1KLTA 1ACBE 2XC4A 5FBIA 3HKIB 3QLPH 1WV7H 3VG8A 2IN2A 2TRMA 1CGHA 2AMDA 1QJ1B 4DIIH 1NRRH 1KMHB 3PYHA 1BB0B 1L1NA 3OU0A 1ZGIA 2V3OH 1GJ4H 1HAOH 3QZRA 1PQ8A 2YMSC 1LHGH 1SKYE 5C5OA 1O2PA 1TOCB 3MO9A 1O2VA 1ANCA 1P2NA 1DICA 2Q6FA 1S0RA 4CRBA 4HTCH 5JBCS 2OBOA 3MNBA 5C5NA 4I8LA 1TPSA 1FUJA 4OS7A 2BLVA 3SZNA 2FYRA 4XRNA 2WPKS 2FOGA 3ITIA 2R3UA 1FY4A 5K0HA 2K0QA 1C1TA 1E34B 1QQ4A 4DOQA 4ABJA 2BY7X 2BDHA 1GI4A 2ZCHP 3A81A 1HNEE 3F6UH 3RXCA 3V7TA 1H8IH 1RXPA 1UTNA 4JYUH 3FN8A 3HKJB 5L30H 2CJIA 1AB9B 5T6GA 7ESTE 2Z7FE 2V6NA 2BVRH 3BEFB 5J4SA 1QBVH 3RU4E 3RXLA 1RIWC 1GJCB 2ZU5A 5L2YH 1V2MT 2GVFA 2OD3B 1AN1E 1BCUH 4DURA 2BX4A 4NFFA 4KKDA 4M9FA 3RXQA 2SNWA 1DWBH 2VVCA 2DE9A 4BNRA 1ELTA 1BRCE 1QRWA 2VWMA 3H7TA 4KELA 3P6ZB 3PO1B 3FAOA 5JPMH 1OWKA 5EQQA 5DO4H 2NU4E 3A7XA 1B0EA 1GDQA 1A2CH 1O2JA 5FX5A 1QTFA 3EA9A 5B6OA 2ZPSA 2ZWLH 1GG6B 3LC5A 1ZHPA 2XC0A 1ZPBA 1MTVA 2F4LA 1K22H 3B8JA 1YPKH 3MMGA 1LQEA 2AHME 4TWYA 3UAIC 1O3EA 1SGCA 3FZZA 4U2WA 1J8AA 1O2ZA 1ZZZA 1QURH 2YOLA 1A7SA 1BMFD 2ZFFH 3LOXA 1RFNA 1CQQA 2AMPA 3B23B 2FXRA 3ATWA 1DANH 1AGJA 2HALA 3F1SB 3Q3KA 3RXKA 4YOGA 1NFWA 1FIWA 1MQ6A 1MABB 1THSH 3NUMA 1OYTH 1MU8B 1C1SA 4NA7A 1EZUC 2FOAA 3QO6A 2FESH 1TE0A 4FUDA 3F2GA 4H6SB 1D6RA 1UVPA 4IN1A 1O3NA 2ZZUH 1CU1A 1YLDA 1DSTA 1V2TT 4FETA 3P8GA 2ZGXH 1H4WA 2PKAB 4VGCC 4UONA 1G3EA 1P06A 3VXFH 1RTKA 3D65E 3BSQA 1UK4A 3ZVFA 2B5TB 1HB0B 1TLDA 1X7AC 4PROA 1EXFA 2H9HA 3T26A 4AFUA 2R9PA 1WYKA 1C1OA 1GHXH 3U28C 1NY22 4AGKA 2LELA 5HXFA 1F0SA 1ELAA 3A86A 1TNIA 4CR9A 2RDEA 4K8BA 1DY9A 5F6MA 1IQFA 4HI3A 1EZXC 1NZQH 1Y5UT 1YCPH 1Z6JH 5C67A 3BTFE 2BDIA 3FP7E 3UNQA 3SV6A 1UHBA 1LPZB 2BLQA 3MNXA 1SGTA 4CREA 5JB8S 1NU9A 1EZQA 2ZGCA 4OS1A 2WYGA 4BAHB 1O2SA 3HK3B 4XBCA 9ESTA 3TGJE 4GAWA 1MQ5A 4FUEA 4IS5A 3SOSA 5IDKA 2GMTB 1CGJE 3ATMA 1D9IA 3F0OA 4WMEA 2PTNA 2A32A 1UK3A 2D8WA 1HAHH 1D4PB 3ZIAD 4Y8ZA 2CGAA 3BF6H 1PPFE 1VJAU 1WTHD 1RJXB 1O2UA 4WMFA 5LPRA 2ZG0H 3RDZA 3BIVH 3T29A 5AHGH 4RN6A 3RXSA 4H4FA 3BTEE 2GCHG 1W8BH 3RXUA 1A5HA 1DVAH 4YO9A 4F49A 1K21H 1S82A 1ZSKA 1HJ9A 3BTWE 2Y5GA 1JOUB 1EPTC 4THNH 2ZKSA 4MPWA 1BTHH 1C1NA 2WSSD 2C8ZB 5FPTA 2EC9H 4X6PA 2ZCLP 2ODQA 1O3DA 2D26C 2PKSB 1SOZA 1K1PA 2A4GA 3BTKE 3M5LA 4JMYA 5JYIA 3PTBA 4IC6A 2HOBA 3M5OA 4ZROA 3SUDA 2KM0A 4YOJA 2A1DB 2QE7D 1NRNH 2FM2A 1GI5A 3SNBA 3UQOA 2A7HA 1J14A 2HPQH 1A3EH 3M36A 3MFJA 2CF9H 3K2UA 2D2DA 3GCHB 4ZXXH 4AFZA 1Y3WA 3S69A 1NN6A 1DFPA 1L4DA 1AUJA 3UR6A 1K1NA 3N99A 1HFDA 1GVLA 3OE7D 3ZVDA 3RC4A 5JB9S 2J95A 5DK1A 3UY9A 3RMNH 1LHDH 2P16A 1WDIA 3SU6A 2KZ4A 2ZFRH 1FONA 2FPZA 4GLYA 3RXAA 4Z6AH 1MU6B 3Q00A 1C1RA 3ZZAA 1FY3A 1C5MD 2A5AA 2ANKH 3LU9B 1NC6A 1QJ6B 3UREA 2UUKB 3E8LA 1QL8A 2V3HH 2GX4A 4QT8C 1ZTLA 2FMJA 3ZZ8A 1GJBB 1O2QA 1EB1H 4B2BA 3SU1A 3MH4A 2AGIX 2VGCC 3GY4A 1L4ZA 1OWHA 3FVFB 3RP2A 1O0DH 3B9FH 1HIAB 2C8XB 2VWOA 2PP6A 4OM9A 3ZYDA 2F9BH 4NIYA 2TBSA 2XRCA 1YPLH 1O2IA 1ANBA 2BY5X 1UCYK 3SW2B 4Z1MD 1P9SA 1A0LA 3ZYEA 2C8WB 3KQ5A 3MHWU 4JZIA 4WJG2 2OTVA 8GCHG 3PV5A 3T62A 1OWIA 1F0RA 2PW8H 4NA8A 3PLKA 2QIQA 3U8OH 2DUCA 1DWCH 2CHAC 2EI6A 3QWCH 1S6FA 1BTWA 1OP8A 3E6PH 3OEHD 4K3JA 2BXTH 4NA9H 2TIOA 1QNJA 2FO9A 4RKJB 5AVDA 5TJXA 1C9TA 1NRPH 3NRLA 3MI4A 2AS9A 3MO3A 4AZ2B 1C2LA 2L74A 3GCTF 4ESTE 1QA0A 2FX4A 1BBRK 1O2LA 2HGTH 2GZ7A 1E37B 1DM4B 3SJIA 1TAWA 3C27B 4CH8B 3MU8A 2ZC9H 1C4V2 1O5EH 4Y0YE 5KECA 5E2PA 1CHOG 1LCYA 2F9PA 5HM2A 1OS8A 3DT0H 2FZZA 2WPHS 1TBRH 1TGBA 3SJKA 4FUCA 1F0TA 2WPIS 4Q4LA 3UOUA 4D7GA 2OUAA 4WXIA 2Z9KA 5EQSA 1ETTH 2EI7A 3SHCH 2Z6BD 5ABWA 3MU5A 2GJGA 4NCYA 2FI5E 1OX1A 3GDSA 2ZFSA 1DLEA 1V2KT 3VEQB 2KCAA 1TPOA 1V2ST 1HAZB 1RD3B 1B0FA 3F68H 4GCHG 4WXVA 2JIZD 4Y8YA 1ZGVA 2JH5D 7KMEH 4K5ZA 1VR1H 1W0KD 2HVXA 1ZJKA 1TMTH 1CVWH 2EQNA 3K6YA 3SNDA 4RT1A 4XSKU 1NFYA 3FZDA 1O2RA 4UE7H 2KR7A 2D1JA 1BTYA 1GL0E 3GDVA 4YESB 1QHRB 2A7CA 5EU8A 5CMXH 1KXBA 1C5SA 4MLFB 2PUXB 5F03A 1XKBC 1H1BA 3SV8A 3TITA 4CBNA 1A0JA 2G5NA 1P05A 1V2QT 2J2UA 1S6HA 1EQ9A 3PMBB 3NK8A 3TK6A 4IGDA 1G37A 4X1QU 1ETSH 4I8JA 1BUIA 1Z7KA 3QZQA 5AFYH 5LPFA 3SGAE 2G52A 2ZHEH 2PUQH 5FAHA 2W7SA 2GT8A 2QN5T 2NU2E 3AASA 1EAIA 2BD3A 1GJAB 2Z3DA 1H9HE 4E06H 3BV9B 2RCEA 1SGNE 6CHAB 1XVMA 3PLBA 3SV7A 3GY8A 2W3KA 1EAUA 3SJ9A 2QYIA 2F3CE 1O30A 3A8BA 1SPJA 4U32A 4CHAB 4CRDA 1OSSA 1EFRD 4B2AA 2KCPA 1EZSC 1AKSB 1TNJA 1EJAA 5IK2D 3RXMA 1SLVB 2LPRA 3MNCA 1BMAA 2HRVA 4F4OC 3ZZ6A 3OTJE 4GPGA 2Y81A 1YPJH 4GHQA 1HJAB 3HK6B 4GUXA 2BVSH 2BDYA 5DPAA 1DX5M 3Q3YA 4AFQA 3CS7A 2YMSB 4B6FA 1JMOH 2XBYA 1P3CA 1NTPA 1KXFA 3A80A 1P0SH 2FOBA 1CA0C 3ZVCA 3RXDA 2ZU3A 3ATIA 1GJ8B 2QXJA 1LPKB 1KDQA 2BVXH 1AFEH 4Y10E 1QA7A 4X8SH 4Q2KA 3PV4A 5JBAS 1IQJA 2O8MA 4O3UA 1TNLA 1E35B 2ZHQH 1GCDA 1THPB 2GGVB 1TFXA 4AG1A 1WTGH 1DUEA 2JKHA 3LGVA 4ABIA 1UVUH 3E3TA 4FVDA 1EJNA 1TONA 1UVSH 1HCGA 2ZGBH 1KYNA 3LH1A 1GCTC 2GV6A 1RS0A 3TGIE 1XMNB 4YLUA 1UO6A 2ZTYA 2ZTXA 2OP9A 2BQ7B 3PRDA 1YY3A 3BG4C 2QCYA 2BZAA 2WPJS 3LGIA 1O2YA 5FCRA 3BTTE 1PQ5A 1V2VT 3QX5H 3JZ2B 4E7NA 1MAXA 2F9UA 2M2AA 2JDID 1VCPA 3G01A 3RC5A 5EIYA 1GHAF 3ZZ9A 1ZOMA 2Y7XA 4JYVH 2ZGHA 1JRSA 1SQOA 1TGSZ 2ZQ2A 3SU4A 4ABBA 1BHXB 1Q3XA 2XOKD 1NM6A 2LP6A 1P2MA 2BOKA 3QTVH 4ABEA 3O8RA 5LPEA 1O39A 4O9VA 4INKA 4B1TA 3EE0B 4XBBA 1E79D 1AUTC 8LPRA 1AZZA 1TBQH 3DUXH 2WV9A 5BRRE 2BXUH 1Y8TA 2ZGJA 3VPKA 1P2QA 4JZFH 5HYOA 1O2XA 2J98A 3DFJA 3MH7A 1O3KA 3P95A 1YPHE 4DVAU 2K1QA 4YZUA 3EDXB 3PMHB 2ZIQH 4B74A 2J34A 2AGEX 4KGAA 2Z9IA 3N7DA 4F48B 2VIOA 1TQ0B 1ELDE 3M5NA 4LXBH 3GY2A 1GHBF 1G9IE 2ZHWH 2TGTA 2VIDA 1O3HA 1SBWA 3M35A 1VJ9U 5JBTA 1T8OA 3C1KA 2ZU2A 3LIWA 4U30A 1V2LT 3OEED 4H6TA 4I31A 4Q63A 4OS4A 3SNCA 3SU2A 1ZPZA 4NZLA 3LJOA 2GD4B 6ESTA 1OKXA 2WZQA 3RU4D 3ZVBA 4JK5A 1P12E 3SU5A 1W13U 3LGTA 1DLKB 2ZDVH 3U1JB 1D3DB 4GHTA 4ABAA 1XUFA 1Y5AT 2ANMH 1FDPA 5C20A 1SVPA 1JRTA 1ZMJA 2W7UA 1EPTA 1A5IA 3SGBE 4LZ1H 1NRQH 1C5LH 1QRXA 2UUFB 5G4BA 5EJ1A 5DP5A 4FVBA 2BYAX 2W6ID 4ASUD 2XBVA 4FU8A 1ZPCA 3DA9B 4X8TH 1C9PA 3LPRA 1ESBA 3JZ1B 4IN2A 1UTLM 2SGAA 2Z9GA 5E0JA 5A09A 1FAXA 4K69A 1G2MA 3EE7A 3LGUA 4Q7ZA 3ZZDA 1DS2E 1C2IA 2V35A 1GI1A 2ANYA 1Z8IB 2HPPH 2ZO3H 2Q6GA 3SU0A 2HWLB 1VITG 1FIZA 1BOQA 1HPGA 3TJUA 1CO7E 4AN7A 2VIPA 1UVOA 1UTJA 3BTGE 4MNYA 2ZECA 5K7RA 2ZDLA 4Y6DA 2WINI 5DKMA 4NSYA 2SGPE 4O03A 1NBME 2A7JA 2GV7A 1SLUB 1HYLA 1FMGA 1AO5A 3OTPA 1O2HA 3AK5A 1SHYA 4AOQA 1NESE 3A7TA 4TY6A 1VCWA 1C2GA 2TGPZ 4Y76A 5DP9A 1EOJA 1MBMA 1TQ7B 1RGQA 5L2ZH 1GI7B 3M7TA 1BT7A 3SO3A 1EP5A 1MAYA 1LVBA 3T5FH 5F8XA 2XXLA 1V2PT 5EJZA 3ODFA 5EXMA 5A0AE 1SI5H 1FPHH 2JETB 3UWIA 1A46H 2THFB 4Q80A 1SFQB 1TNGA 1V2NT 2WPLS 2OBQA 4Y71A 5CHAC 2XNIA 1Z71A 3SUGA 1O2KA 4HG6A 3FP6E 4CBOA 2ODPA 6GCHF 1GJ5H 4LOYH 4XBDA 3RMLH 2KFWA 4X1SU 1RTLA 1DXPA 1Y59T 1O2NA 4ZAEA 4A1TA 1C1PA 1AY6H 3FFGA 2PFEA 1CGIE 1IQMA 1GBKA 1TA2A 3TK9A 4FXGH 1VITH 4RI0A 5AF9H 1MD8A 4WVPE 3A7ZA 2C4FH 2A2QH 1O2WA 3P70B 1P2JA 1GDUA 1N8OB 1XM1A 4GVUA 3VGCC 2ZU1A 4E05H 5GCHG 2OC8A 1D6WA 4BANB 1VGCB 1GDNA 5DG6A 4AGJA 2PWXA 4AYYB 1C2EA 3M7QA 2A4RA 2BD2A 2FODA 4DGJA 3URDA 1GVKB 3OYPA 2J38A 1DUAA 4OS5A 3ZZ7A 1Z8RA 4ISOA 2W6JD 4XOJA 1WAYB 1UJ1A 3Q76A 1HRTH 4ISHH 1CE5A 1SGIB 3BTQE 3UB0A 1GGDB 1S0QA 1T31A 2O8UA 1NU7B 4KTCA 2G8TA 2WV4A 3I77A 1O3AA 4A1VA 5T1VA 5LGOA 1IOEA 3UR9A 3R3GB 4TSFD 4ZHMU 1C1WH 3ZVAA 3ZZ3A 2PHBA 2VIQA 4X2WA 3GS9A 3EA7A 1T4UH 4WH6A 4X6OA 2YNAA 2DE8A 3A85A 1FAKH 1BA8B 4CRFA 3AW0A 3GY5A 3KL6A 4TPIZ 3SN8A 1OOKB 1W0YH 2QF4A 5LH8A 1ARBA 1GI2A 2FYQA 2QC2A 4I33A 1ZRKA 2PTCE 1KY9A 1W12U 4KP0A 1ESTA 3NKKA 1H8DH 1BIOA 4TWWA 3S9BA 1XVOA 2G51A 4DJZB 3KYGA 2P8OB 4MG3A 1Q2WA 4KTUA 1AB9C 2KCYA 2VWLA 3MNSA 1DWEH 1MKXH 3Q3XA 2HVYB 4AX9H 1UHBB 1S84A 2PGQB 3RC6A 1OP0A 2R0KA 2IPHA 1DE7H 5FX6A 1TNHA 1C5ZB 3OX7U 1A4WH 1C5PA 3U69H 8KME2 4X2XA 1G36A 3RXEA 1HLTH 1EX3A 4LZ4B 3PWBA 1TALA 3PO1C 4HZHA 1LVYA 3EAJA 1DXWA 1O38A 1G3BA 1E38B 4O3TA 3AVZA 3GCOA 1SQTA 1OXGA 1MKWK 2NWNA 1P01A 1Z8GA 1W7GH 4A5TS 1V2JT 2PLXA 3E91A 1SMFE 2QXIA 3RMOH 4FUGA 3RLWH 2B8OH 1HAGE 3LONA 1CSOE 2GCTB 3A83A 1EASA 3A89A 4XFQA 3MU4A 4D8NA 1XKAC 1FN8A 1MTWA 5C1UA 3RXBA 1AMHA 1G2LA 4Y79A 1ZTKA 2SGQE 5ESTE 1C2DA 4H42U 1ETRH 1LHFH 4TY7A 2OCVB 2BDGA 3N7EA 1DOJA 4B71A 2K8IA 1SL3A 5GWZA 3E16B 1W10U 2GDDA 5DP7A 3F9GA 1HAPH 1SHHB 4MNXA 3IITA 2FLRH 1IQIA 1FPCH 3MH5A 1N6XA 5F8ZA 1AQ7A 1SOTA 1SB1H 3GY6A 1C4Y2 2JJ2D 3SUFA 3T2NA 1MTSA 4HFPB 1GI9B 2OC0A 1NPMA 1GJ6A 2F83A 2WYJA 4Z0KA 4BOHA 4B75A 1GBHA 4Q7YA 2KAIA 1KXAA 1GJ9B 2W26A 1V2UT 1P09A 3RXVA 3TU7H 3U9AH 3VFEA 7GCHF 1F5RA 1GL1A 3S7KB 3TVJB 2W5EA 1F2SE 7LPRA 1LTOA 1UK2A 1HUTH 4K1EA 5ETXA 1VZQH 1GBDA 1MD7A 1NO9H 5AFZH 1V2WT 1W14U 4JZ1A 1LDTT 1C5WB 1SGFG 1IQNA 2RDLA 3SBKA 1O3IA 3V3MA 1L0ZA 1AU8A 1RTFB 1LO6A 1MH0A 1LHEH 2CN0H 3KN2A 3AAVA 3QGJA 3DSPA 3MWIU 2GMTC 3OSYA 1D3PB 4CH2B 1Z1IA 3EA8A 1OHHD 2KX4A 4ISLA 5T6FA 4DIHH 1J9CH 1KLJH 3QUMP 3RUOA 3MO6A 1MBQA 1ZMNA 4ZXYH 4SGBE 1O3CA 1EOLA 1SQRA 2RA3A 1TOMH 4B76A 4J2YB 2OQ5A 4FUBA 1O2MA 2AMQA 4ZMAH 5L6NH 1GHZA 2STAE 1HAVA 2WUCA 2FI4E 2ZHFH 1KXDA 3SGQE 1E1QD 1SFIA 4NSVA 1OWDA 1TABE 1LPGB 1O5GH 2KCOA 2AIQA 4KTSA 3UQVA 2M5TA 2P3FH 3SI3H 1GHAG 1ZRBA 2B0FA 1GWAA 1SGFA 3P92A 4JK6A 3QTOH 1RRKA 1Y3XA 5T3HA 5DGJA 1K1JA 4R8TB 1C5NH 3LDXH 2BDAA 3EYDA 1HBTH 4FOUC 1TRMA 3SUEA 2G81E 1ELCA 2FIRH 3KNXA 3LJJA 4RKOB 2PKSC 1GBTA 4NIXA 4IMQA 3VB4A 5E0HA 4Y8XA 5HKKD 3SNAA 3S7HB 4B6EA 1AZ8A 3SORA 4ZKOU 3GCHC 1O2OA 1XXDA 3UTUH 4BXWA 1CT2E 1P2IA 1LHCH 1MZDA 2WV5A 9LPRA 1L1GA 4X2YA 1CT4E 4Q7XA 3RXPA 5DP3A 3TK5A 3MU1A 5PTPA 3A82A 1GHBG 1T4VH 1TPPA 2P94A 4ABDA 4MPUA 1MTNB 2BY9X 1K1MA 3RMMH 1O35A 2TGAA 1FQ3A 2EY4C 4I7YH 4I8HA 3W1EA 5A2MH 4D9RA 1C1MA 3DSGA 5TCCA 2OLGA 1AFQC 4CRCA 2UWPA 3ZVEA 1UTPA 1HAXB 3A88A 1OWJA 4IMZA 2J97A 1O5FH 4UFFH 1K9OE 3DSOA 3TLOA 1ELFA 4X1NU 5A0CA 4UFEH 1NFXA 5C3NA 3SJ8A 4BXSA 3SNEA 1O3JA 1VCQA 2ALVA 3VB3A 3VXEH 5HGGA 3FOAA 2CXVA 2H9TH 1TBZH 2GZ8A 2QGRA 5EXLA 1C5YB 1O2GH 1FJSA 2GT7A 4XDEA 4JYTA 1C2KA 2ODYB 3CNRA 3F2HA 4BAKB 1C5TA 1P03A 3D62A 2BM2A 2UWOA 2ZFQH 1KLIH 1B5GH 4NWKA 2A4OA 1SGYE 1TX7A 2QA9E 4MVNA 1ORFA 1IHSH 2HNTE 1F0UA 1MCTA 1B7XB 1ESAA 1WQSA 3TH4H 1TGNA 1A61H 1DT2A 1GBIA 4INLA 2O8WA 1O3FA 2A45B 4Y11E 1RIWB 5DSFA 1C5RA 1NFUA 3H5CB 3F9HA 1K2I1 4ZUHA 2SGEE 3HATH 1ELGA 1PYTD 2H2ZA 2AERH 1GHVH 2QY0B 1YGCH 1GI3A 4K8YA 4P02A 3DFLA 1C5UA 1YCPK 2AYWA 2Z9JA 3M5MA 4ZCNA 1TGCA 4M7GA 1GI0A 3S9CA 1FY8E 2ZA5A 3OFND 4J1YA 4ISIH 2NU0E 2Q6DA 4OS6A 4ZHAA 1GI8B 1KDQB 2GTBA 5HMAA 4K1TA 3S9AA 1H9LB 6LPRA 3F9EA 4NIWA 5BPEA 1YKTA 2J94A 2A2XH 1QFKH 5C17A 4R0IA 4BAMB 3I29A 2V3MA 3ZZBA 3LGYA 1AIXH 3WW7A 4MTBA 1G32B
chains in the Genus database with same CATH topology
1QBNA 2ZF0H 2Y80A 4WH8A 2RG3A 2ESTE 1DSUA 3URCA 2ZI2H 1ABJH 1GMHF 1MMJN 1P8VC 1YPHC 4A1XA 1EKBB 3TH3H 1FZZA 2BY6X 2XTTB 3FP8E 3STIA 3U8RH 1AWFH 1PYTC 3BG8A 1ZR0A 2H1UA 1IQEA 2ZU4A 2H5CA 3R0FA 2BDCA 1UCYH 2B9LA 2Y5HA 4X0WU 1TMUH 4K2YA 3A8CA 3TGKE 2ZNKH 2W3IA 6GCHG 3FANA 1BTUA 4BAQB 1BRUP 1J15A 1AVWA 2AH4X 3BIUH 1UMAH 4MNVA 4VGCB 3O8DA 3KQCA 3SI4H 5C1XA 1PPHE 1ZHMA 4ABGA 1QBOA 2BD8A 2ALPA 1BHXF 5EW2H 3UUZA 4MPVA 3ZZ5A 6CHAC 4U01A 1A0HB 4JZDH 1ELEE 2QAAA 1BBRH 1S85A 2BDBA 3N7OA 2ZTZA 1GMCF 3ZVGA 4CHAC 1U6QA 3KCGH 3SHAH 2YNBA 3KQBA 2FLBH 3Q77A 3EGKH 1ZJDA 5SGAE 3OY5U 1IQGA 2ZDNA 1SSXA 2CF8H 2XWAA 1GJ7B 4DY7B 1CBWC 3LC3A 2ULLA 1HJAC 1LVOA 4AB9A 3ELAH 2Y6TA 1N1LA 4D76A 1AE8H 3BEIB 1OWEA 3SJOA 3QK1A 1SGPE 3SQHE 2C3SA 1PPBH 1T8LA 3P8NA 1O5BB 1JBUH 3GCNA 1TRYA 3PMAB 1QGFA 3L33A 4FUIA 3T27A 2IJOB 1P2OA 1QY6A 3GOVB 2BHGA 1KXCA 3VB6A 1QQUA 2Y7ZA 3OY6U 3A84A 3LKWA 3S0NA 1P11E 1C1UH 3M37A 1LQDB 3GY3A 4TPYA 2ZDMA 3NCLA 1CA8B 3ZV9A 1ZTJA 2PGBB 1EPTB 3LH3A 1JIMA 2F91A 1GPZA 2C93B 5DP8A 1SQAA 3QDZB 2VJ1A 4FUJA 1C2HA 3TNTA 3RXHA 1BRBE 1UTMA 1BMLA 1UVTH 1O2TA 1ZHRA 1BITA 3KHVA 3PWCA 2FWWA 3O8BA 2ZHDA 4FU7A 3M3VA 3UPEA 3MTYA 1HAIH 4WMDA 1SGQE 1XUIA 3UFAA 2QF3A 1LKAA 2PKAA 4DG4A 1Y5BT 1AWHB 3VB7A 3QN7A 3RM2H 1AVXA 3M3SA 1O36A 2HLCA 1XX9A 4X8UH 2PV9B 4DCDA 4MQAA 2VWNA 2FOCA 4UEHH 2CV3A 4GSOA 3LGWA 1D3TB 1C2JA 3HPTB 1HV7A 3V12A 3BTME 5I25A 5GDSH 2V0BA 1PFXC 1O3OA 3CENA 4A6LA 2H6MA 2ASUB 2NU1E 4WWYA 5C2ZA 1IQKA 3A7VA 2G4UA 4ASHA 1NRSH 1ZLRA 3SU3A 5EPNA 1GBLA 4E7RG 5EXNA 5A0BA 2VGCB 1QR3E 1Z8JB 2R2MB 1O37A 4I8GA 1C5XB 1TMBH 1JXPA 1GBCA 1GMDF 2BQWB 3RXRA 2CMYA 2R2WU 1W0ZU 4BTIB 1W2KH 2UWLA 4NGAH 1T7CA 3HGNA 4D9QA 5EW1H 1PPZA 3MH6A 1T8MA 1UTQA 1XUHA 1W11U 2ZDKA 3GYLB 3RXFA 3RXJA 1A3BH 1GVZA 4YM9A 3GISB 1TA6A 1ZSLA 1G30B 3K6ZA 3QGNB 3RXOA 1UCYE 2CHAB 2G5VA 1W3CA 2PSXA 4AORA 1Q31A 2OC1A 4ABHA 1IQLA 5J4QA 2SFAA 3PLPA 3DHKH 7GCHG 3ENSB 1BJVA 1BQYA 1O3LA 2C90B 4ZKSU 1FXYA 4MPXA 1FNIA 1YP9A 1E36B 3TNSA 2C8YB 3RLYH 3UNSA 2XC5A 1C2FA 5FPSA 1QL9A 2PSYA 4SGAE 2ZFPH 3GCTG 2Y82A 1K1IA 2TGDA 3AAUA 2BLWA 1BRAA 1HAYB 2B7DH 1EATA 1S5SA 4DW2U 2BLOA 2XBWA 5FXLA 2FOMB 2GDEH 4MDSA 1O3MA 1BBRE 3TJOA 5CE1A 1EAWA 2Z9LA 5FCKA 1QIXB 3RU4T 4AG2A 3SV2H 3CP7A 4YOIA 3IG6B 2BY8X 4ABFA 5HM9A 1G3DA 3PMJA 3P8OA 5FHTA 2VH6A 2VIWA 2AFQB 1VITF 1BTXA 2OINA 2ZPQA 3DD2H 1C5OH 1G3CA 5JDUB 2P3UB 5GIBA 4WY3A 5A8ZA 5TCAA 1SLXB 4UDWH 1EP6A 1BJUA 3KF2A 4OGXA 3U8TH 4X1PU 4JCNA 3T28A 1TNKA 3P8FA 2Z3CA 1BTZA 2ZFTA 1AHTH 3BTHE 1GI6A 2XW9A 3KQDA 2VU8E 1BTPA 3BTDE 4D7FA 4B2CA 1TGTA 1FLEE 2Z3EA 1BDAA 1GG6C 1HIAA 1ABIH 1O31A 1SGEE 4IW4E 2AIPA 2QXHA 1UTKA 1YYY1 3D23A 2A31A 4B73A 1TX6A 1Z6EA 4BAOB 1TIOA 5GXPA 1ANDA 4UD9H 2A0QB 5F8TA 5E8EH 1O5AB 2WUBA 2JETC 3GYMA 3PROA 3V13A 4UFGH 1BMMH 1L2EA 3A7YA 1UTOA 4X6NA 1TPAE 4FU9A 2FDAA 1P02A 1ZYOA 2FTLE 3TJVA 4BTTB 1EJMA 1O3GA 4NWLA 2G55A 1WQVH 2IOTA 3RXTA 3D49H 1ARCA 2Z94A 2I6QA 1O3BA 3A8AA 1BZXE 1GBBA 1V3XA 1FY1A 2JH6D 1AE5A 1HXEH 4K1SA 1AFQB 1O3PB 1MTUA 1P9UA 1T8NA 3UIRA 2BD7A 3H7OA 3VB5A 1IHTH 2FS8A 1C4U2 1M9UA 3A87A 1CA0B 1N8OC 5EODA 4NZQA 4Y0ZE 2BMGB 5GCHF 1ANEA 1QL7A 2WPMS 2EI8A 3NWUA 1GJDB 3E90B 2P95A 3UWJH 2G4TA 4X6MA 5GJ4B 1VGCC 3A8DA 3NPSA 5IYTA 1O32A 2XCNA 1QCPA 1PPEE 1L1JA 1JIRA 5GPIB 2R0LA 4HGCA 4AFSA 2H5DA 1GCTB 1PPCE 4DT7B 1GGDC 1ID5H 2F9NA 2GKVE 2O9QA 5EG4A 3BG4B 1E0FD 2J9NA 1THRH 3A7WA 1O33A 1EB2A 1J16A 2P3TB 1WCZA 3KIDU 2ZPRA 2BB4A 1K1LA 2O8LA 2Y5FA 3GICB 4WF8A 4ZHLU 1DWDH 1HDTH 1V2RT 2KAIB 4BTUB 2FS9A 1LVMA 1MZAA 2FOEA 2GCHF 1OYQA 2QV1A 2HNTF 1MUEB 1XUGA 4CRAA 2O8TA 4X8VH 1F5KU 1DDJA 2P8OC 2J92A 1WSSH 1TRNA 1P57B 3TPIZ 1P04A 5DP4A 2Q1JA 3WY8A 4O97A 2VVUA 4XE4A 4YT7H 1OPHB 1LMWB 3F9FA 3KQEA 1AKSA 2VVVA 1DPOA 1D3QB 3U98H 1FY5A 1GBFA 1GBJA 4ZKRU 1GMHG 2J4IA 3EQ0H 1AVGH 2VNTA 4TYDA 2FI3E 1YPGH 2XBXA 1TB6H 1KTSB 2BD4A 1KTTB 2JH0D 1CHGA 2TPIZ 2XCFA 1HAVB 1KSNA 1ZSJA 1GBEA 4K60A 1XUJA 5H4IB 4INHA 2UUJB 1S83A 5A8XA 2GCTC 2VH0A 1SR5C 3MYWA 3PTNA 4I32A 1H9IE 3P17H 1C5QA 3T25A 3TH2H 3SV9A 1QB1A 3MOCA 1AI8H 3UOPA 4MNWA 4OS2A 1OP2A 3NXPA 1SGDE 2RA0A 1TYNA 2BD9A 3M61U 2FEQH 2OXSA 2BZ6H 4Y7BA 3STJA 2NU3E 1XUKA 3CS0A 3GDUA 5I46H 4RSPA 1GMCG 1A5GH 1O34A 1FI8A 4YLQH 3W95A 2G00A 2VIVA 4JZEH 4NFEA 1Y3UA 1WBGB 2FTMA 1GHWH 1QJ7B 2I6SA 4I8KA 3K9XB 1YPMH 8GCHF 1FN6A 1CBWB 1C2MA 3U1IB 4FUFA 1NT1A 1C1VH 3GY7A 3TJNA 4YT6H 2SGDE 2HNTC 2ANWA 3ZZCA 2BTCE 3ATKA 2VB0A 1XXFA 3ODDA 3V0XA 2LNCA 2SNVA 1LKBA 1F92A 4OGYA 1Y3YA 1C1QA 2OC7A 1YPEH 1SC8U 2ZQ1A 4UFDH 1O5CB 5FPYA 2XYAA 1IAUA 3MU0A 2R3YA 5DJ7A 1QB9A 1DY8A 1YLCA 3ZV8A 1NROH 2GZ9A 2ILNA 1P3EA 4Y7AA 1PQ7A 1SLWB 1CHOF 1WUNH 2BD5A 1W7XH 3L6PA 1S81A 2OQUA 5E2OA 3ZZ4A 4LK4A 2QF0A 2ZP0H 2GP9B 4ZKNU 4A7IB 4IC5A 5E0GA 1GBAA 1MKWH 2A5IA 1TX8A 2QXGA 2VINA 3HGPA 2PR3A 1Y3VA 4FUHA 5EQRA 2BX3A 2H9EH 1YCPM 1YF4A 3PB1E 1HJ8A 2FOHA 1V6DA 3IWMA 4YTAA 4ZH8A 4NG9H 1WOFA 4IBLH 3E0NB 1P10A 1PPGE 1ELVA 3E1XB 1F5LA 2A4QA 5FBEA 4A92A 3L3TA 1NS3A 3E0PB 4GCHF 1HGTH 5DP6A 1FV9A 2EEKA 4ISNA 1PJPA 3RXGA 1INCA 1JWTA 3KEEA 5C1YA 2F9VA 2FOFA 3O8CA 1AD8H 3BN9A 1CT0E 2FX6A 1QB6A 3RXIA 5A8YA 2BOHB 2BQ6B 3TIUA 4CRGA 1SGRE 1KIGH 1F7ZA 3M3TA 3LT3A 1DITH 5CHAB 2UUYA 1K1OA 3UNRA 1YC0A 2P93A 3ESTA 2AGGX 1YBWA 3W94A 1YM0A 2F9OA 1J17T 4CR5A 2P59A 1T32A 1P2KA 1MCVA 5EOKA 1MKXK 3AW1A 1WU1A 1C5VA 1BMNH 2ZEBA 1ELBA 2ZCKP 3NZIA 2SGFE 4X2VA 2AEIH 3K65B 1Z1JA 2A5KA 5ESBA 2XWBI 4NIVA 1EUFA 1GHYH 5EGMA 1V2OT 5EPYA 4AYVB 2STBE 1GBMA 1SG8B 3ATLA 3RM0H 1KXEA 3SQEE 2ZDAH 1GMDG 3VGCB 1O5DH 3I78A 1QRZA 3BEUA 3M7UA 2EA3A 1EAXA 5T6DA 2FP7B 1HXFH 1IQHA 1MTNC 1TWXB 1PQAA 3KGPA 3PM3A 1N6YA 4X1RU 4AB8A 1A1RA 5JBBS 1ZMLA 8ESTE 1K28D 1KLTA 1ACBE 2XC4A 5FBIA 3HKIB 3QLPH 1WV7H 2IN2A 2TRMA 1CGHA 2AMDA 1QJ1B 4DIIH 1NRRH 3PYHA 1BB0B 1L1NA 3OU0A 1ZGIA 2V3OH 1GJ4H 1HAOH 3QZRA 1PQ8A 1LHGH 5C5OA 1O2PA 1TOCB 3MO9A 1O2VA 1ANCA 1P2NA 1DICA 2Q6FA 1S0RA 4CRBA 4HTCH 5JBCS 2OBOA 3MNBA 5C5NA 4I8LA 1TPSA 1FUJA 4OS7A 2BLVA 3SZNA 2FYRA 2WPKS 2FOGA 3ITIA 2R3UA 1FY4A 5K0HA 1C1TA 1E34B 1QQ4A 4DOQA 4ABJA 2BY7X 2BDHA 1GI4A 2ZCHP 3A81A 1HNEE 3F6UH 3RXCA 3V7TA 1H8IH 1RXPA 1UTNA 4JYUH 3HKJB 5L30H 2CJIA 1AB9B 5T6GA 7ESTE 2Z7FE 2V6NA 2BVRH 3BEFB 5J4SA 1QBVH 3RU4E 3RXLA 1RIWC 1GJCB 2ZU5A 5L2YH 1V2MT 2GVFA 2OD3B 1AN1E 1BCUH 4DURA 2BX4A 4NFFA 4KKDA 3RXQA 2SNWA 1DWBH 2VVCA 2DE9A 4BNRA 1ELTA 1BRCE 1QRWA 2VWMA 3H7TA 4KELA 3P6ZB 3PO1B 3FAOA 5JPMH 1OWKA 5EQQA 5DO4H 2NU4E 3A7XA 1B0EA 1GDQA 1A2CH 1O2JA 5FX5A 1QTFA 3EA9A 5B6OA 2ZPSA 2ZWLH 1GG6B 3LC5A 1ZHPA 2XC0A 1ZPBA 1MTVA 1K22H 3B8JA 1YPKH 3MMGA 1LQEA 4TWYA 1O3EA 1SGCA 3FZZA 4U2WA 1J8AA 1O2ZA 1ZZZA 1QURH 2YOLA 1A7SA 2ZFFH 3LOXA 1RFNA 1CQQA 2AMPA 3B23B 2FXRA 3ATWA 1DANH 1AGJA 2HALA 3F1SB 3Q3KA 3RXKA 4YOGA 1NFWA 1FIWA 1MQ6A 1THSH 3NUMA 1OYTH 1MU8B 1C1SA 4NA7A 1EZUC 2FOAA 3QO6A 2FESH 1TE0A 4FUDA 4H6SB 1D6RA 1UVPA 4IN1A 1O3NA 2ZZUH 1CU1A 1YLDA 1DSTA 1V2TT 3P8GA 2ZGXH 1H4WA 2PKAB 4VGCC 4UONA 1G3EA 1P06A 3VXFH 1RTKA 3D65E 3BSQA 1UK4A 3ZVFA 2B5TB 1HB0B 1TLDA 1X7AC 4PROA 1EXFA 2H9HA 3T26A 4AFUA 2R9PA 1WYKA 1C1OA 1GHXH 1NY22 4AGKA 5HXFA 1F0SA 1ELAA 3A86A 1TNIA 4CR9A 4K8BA 1DY9A 5F6MA 1IQFA 4HI3A 1EZXC 1NZQH 1Y5UT 1YCPH 1Z6JH 5C67A 3BTFE 2BDIA 3FP7E 3UNQA 3SV6A 1UHBA 1LPZB 2BLQA 3MNXA 1SGTA 4CREA 5JB8S 1NU9A 1EZQA 2ZGCA 4OS1A 2WYGA 4BAHB 1O2SA 3HK3B 4XBCA 9ESTA 3TGJE 4GAWA 1MQ5A 4FUEA 4IS5A 3SOSA 5IDKA 2GMTB 1CGJE 3ATMA 1D9IA 4WMEA 2PTNA 2A32A 1UK3A 2D8WA 1HAHH 1D4PB 4Y8ZA 2CGAA 3BF6H 1PPFE 1VJAU 1WTHD 1RJXB 1O2UA 4WMFA 5LPRA 2ZG0H 3RDZA 3BIVH 3T29A 5AHGH 4RN6A 3RXSA 4H4FA 3BTEE 2GCHG 1W8BH 3RXUA 1A5HA 1DVAH 4YO9A 4F49A 1K21H 1S82A 1ZSKA 1HJ9A 3BTWE 2Y5GA 1JOUB 1EPTC 4THNH 2ZKSA 4MPWA 1BTHH 1C1NA 2C8ZB 5FPTA 2EC9H 4X6PA 2ZCLP 2ODQA 1O3DA 2D26C 2PKSB 1SOZA 1K1PA 2A4GA 3BTKE 3M5LA 4JMYA 5JYIA 3PTBA 4IC6A 2HOBA 3M5OA 4ZROA 3SUDA 4YOJA 2A1DB 1NRNH 2FM2A 1GI5A 3SNBA 3UQOA 2A7HA 1J14A 2HPQH 1A3EH 3M36A 3MFJA 2CF9H 3K2UA 2D2DA 3GCHB 4ZXXH