3RXUA

Crystal structure of trypsin complexed with benzamide (f05 and a06, cocktail experiment)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxuA02
3BIUH 2P8OC 1C1UH 3BEIB 1T8LA 2QC2A 2R2WU 3SHCH 1OOKB 3ZZ5A 1U6QA 6CHAB 1UVOA 5HMAA 2G4UA 2ZCKP 3RXGA 1O3EA 7GCHF 1O5BB 4A92A 2B5TB 1AB9B 7KMEH 3SV9A 3KQEA 1C2JA 1OXGA 3H5CB 3BTTE 2AIPA 1ZPBA 2ZPQA 2Q6DA 1S0RA 2ZDMA 1NRNH 4E05H 3TJVA 2J38A 3H7TA 3MO9A 5A2MH 1XKBC 1DS2E 1O3JA 1P02A 4U32A 1ANCA 1AKSA 1TPAE 1Y59T 1EZUC 2PV9B 1EJMA 3SUEA 2CHAC 3ZZDA 2FM2A 3SHAH 3SV7A 4ABHA 1K1NA 1LPGB 5HM9A 3HGNA 1H8DH 1INCA 1OYQA 1C5VA 1N6XA 4X1SU 2PR3A 4NCYA 3SU3A 1QTFA 4ISNA 1O32A 1SGDE 2FESH 2ZTXA 4Y10E 5GDSH 2FOEA 1UTPA 3DA9B 2OLGA 1OWDA 3UFAA 1LMWB 4BXSA 1SVPA 1S82A 4DJZB 4E7NA 5K7RA 4CH8B 1MU8B 3RXHA 4WVPE 2OUAA 2R3UA 2WUBA 2O9QA 3D65E 3SGAE 1YCPK 1WQVH 1UK3A 5AFYH 5H4IB 5T6DA 1EJNA 2PTNA 2JH5D 1JIMA 1TNIA 4AYYB 2NU1E 3RXBA 1K1PA 1T4UH 2JETC 2FLRH 1AKSB 3QZQA 4IN2A 2AH4X 4YESB 2I6SA 1UTMA 2F9PA 1E38B 1LDTT 3P17H 1JOUB 4B1TA 3P8FA 4XBDA 2ZIQH 4B2CA 2GDEH 2B8OH 4NA8A 3B8JA 1QA0A 2XRCA 4GAWA 4YT6H 4ISOA 3HPTB 3AVZA 4ABGA 2ZFRH 1ESAA 1AMHA 1KLIH 1ZLRA 3ZZAA 5JBCS 2CMYA 2GVFA 1MCTA 2XWAA 2BQ7B 2ZDKA 5TCAA 1LPZB 4JZEH 1BHXB 1AD8H 1YLDA 2Y82A 1H9HE 1K1OA 4B2BA 2GTBA 2BB4A 1V2UT 2SGAA 3E3TA 1JMOH 4B74A 1C5NH 3TK6A 2ZHWH 3SJKA 2J2UA 1YPMH 1P05A 1O2XA 2SFAA 4XBCA 3V13A 2VIDA 5C5OA 2H9HA 2BLQA 1F7ZA 2W7UA 1DLKB 4INKA 1V2PT 2C93B 1LVMA 1N8OB 2BD5A 3QTOH 2C90B 3GDUA 2BZ6H 2ZKSA 2QCYA 3VB4A 1YPEH 4GHTA 3ZVBA 2NU0E 2OC8A 4KKDA 1ID5H 1BTPA 3QWCH 1DWCH 1DDJA 3TJNA 1Y3UA 1RD3B 2H9TH 1IQHA 1LVBA 3BSQA 1Z1JA 3DUXH 5HYOA 1CGHA 1NESE 2FIRH 1D4PB 1GI4A 1TX6A 3LGUA 1V2ST 2H6MA 2BLWA 4XSKU 1FAXA 1BTUA 1Z6EA 4A6LA 3V3MA 1E35B 1GMCG 4HGCA 3A84A 2HPPH 5JBBS 2G5VA 1GDQA 1P12E 1RTKA 3NUMA 1HAGE 4A7IB 5L2ZH 1TALA 5E0GA 3MNXA 1SR5C 1AO5A 4AGJA 3A85A 2PGQB 4ZHLU 1P2JA 3EA9A 1NRPH 1YC0A 1O2UA 2Y6TA 1SSXA 2BD8A 1S85A 5DP6A 4OS6A 3BIVH 1GCTC 2Z9IA 1O5CB 2ZHQH 1C2IA 1O3OA 3K6YA 1EB1H 2WPMS 1P3EA 4UDWH 1TWXB 1WCZA 1GHXH 2QXIA 3BG4C 1G3EA 1O2MA 2QA9E 1OP8A 4VGCC 1ANDA 1GGDC 1K22H 2J94A 4NWLA 2ZNKH 4R0IA 1ZSJA 2TGDA 4OGYA 4Z6AH 1YPKH 2AERH 2OXSA 1GBBA 2BDAA 4FUFA 1D9IA 1MBMA 2BY9X 4K5ZA 1JIRA 1WUNH 1HAHH 3C1KA 4X8TH 1IQMA 3SGBE 5CHAB 1S84A 1C5MD 1ZMNA 1BRBE 2IOTA 3U1IB 1A2CH 1HAVA 4YO9A 3QGNB 1TBZH 3P95A 2D2DA 2BDIA 1OWJA 3MH5A 4WF8A 3LPRA 5IYTA 3SJIA 2ZEBA 4X8VH 4D9RA 5JDUB 1C5QA 5FPYA 1KY9A 3F6UH 2GGVB 2W7SA 6GCHG 1IQGA 2PLXA 2AGEX 4JK5A 2ZTYA 3DD2H 1XXFA 4X6MA 1GI6A 3U8OH 1V2WT 2JH6D 3KEEA 1SQTA 2GZ9A 1AVXA 1BMLA 3SV6A 1NT1A 2GMTB 3LC3A 1ELVA 3GDVA 2XBXA 3GY2A 3EQ0H 2C8YB 1GL1A 3MH6A 1FY5A 1Y3VA 1ELTA 1ANBA 3A8DA 2PFEA 1D3DB 1Q3XA 3R0FA 1O3NA 4YLQH 1TGTA 4Y79A 1Z71A 1G30B 3PM3A 1NRQH 4ABAA 1JRTA 3TK9A 1V2JT 4Y8XA 1P11E 2QXGA 2EI8A 2A4OA 1TA6A 1H9IE 1TPPA 2OINA 1HAVB 2PKSC 2GX4A 2ZGJA 3RMNH 4ABBA 2GV6A 2NU3E 1F0UA 3TJUA 4DURA 2ZFTA 1P2MA 1NFWA 1GVLA 1JBUH 1C1PA 2PUQH 1Y3YA 2QF0A 1UTLM 2CJIA 3S9AA 2SGQE 1SGEE 3OX7U 4GLYA 1O3PB 5A8XA 2ZC9H 1LKBA 1D3PB 4FUHA 4AG1A 1TMTH 4SGBE 4OS5A 1VCWA 3EGKH 2I6QA 1TBQH 1JWTA 1YPLH 1TE0A 2F9VA 4I8LA 2DE8A 1ELAA 1GMCF 4XE4A 1ZRKA 1HIAA 2GV7A 4BAHB 2PSXA 1GVZA 1O3HA 2FTMA 4JZIA 1EPTA 1LO6A 2OC0A 1TYNA 1OWIA 3ZVFA 1Z1IA 3DT0H 5FPTA 2JH0D 2B7DH 3NCLA 1PQ8A 3A86A 2OD3B 1BRAA 4YOGA 1BRUP 1LQDB 1YPJH 1QBVH 1SGTA 2VWLA 1A7SA 1CQQA 1O2TA 2SNWA 1UVPA 3ATLA 3F9FA 2BDHA 3EAJA 1IQJA 2FOCA 1WV7H 1FY8E 1SQAA 1CBWB 5E0JA 4JYTA 2AS9A 1T8NA 5HM2A 1UTOA 1GDNA 3RXLA 4MQAA 4WXVA 3ZZ4A 1NO9H 1HV7A 4ZAEA 4X6OA 1GI1A 1HIAB 3LIWA 1HGTH 2YOLA 1G36A 5ESTE 2QXJA 4UD9H 5FXLA 3MU8A 1W11U 1FJSA 4JK6A 2OQ5A 1EPTB 3A7VA 4Y8ZA 1QURH 4H4FA 6GCHF 4AORA 2G81E 1OWKA 1W8BH 3RXOA 1GPZA 1XKAC 1QQUA 5E8EH 1O36A 3ZZCA 2BMGB 1P3CA 4MLFB 1SGNE 1KXCA 1GI3A 3AW0A 3UOUA 1GHZA 3RMMH 1Z8JB 5C1YA 1EKBB 2O8LA 1B0FA 4U30A 1BMNH 4Q7ZA 4Y8YA 3HGPA 2XW9A 3TH3H 5DJ7A 3RUOA 1K28D 1TGCA 1KDQA 1ELFA 2OC7A 1PYTC 3QN7A 1FY3A 3GCTG 1W2KH 7LPRA 1TX8A 1XMNB 1HAPH 2ZCHP 1TPSA 3KQBA 4TPYA 4NGAH 4GCHG 2FOHA 1WBGB 2HPQH 3RC4A 5AFZH 4HTCH 2P59A 1G2LA 1HJ9A 1QY6A 4RKJB 2VVVA 1SQOA 2IPHA 1Z8GA 2VNTA 3MH7A 1ELGA 2ZU5A 1BJUA 1W13U 4K60A 4NZQA 4CRAA 2Z6BD 2Q6GA 3NK8A 3LC5A 4WJG2 3OYPA 2BX3A 1H9LB 1EAXA 3ELAH 2BOHB 4YTAA 2WV5A 4XDEA 3PYHA 1A5HA 3BV9B 1V2QT 1PJPA 3SGQE 1GL0E 2Z9JA 2XNIA 2AFQB 3PTNA 1DWDH 2FYRA 1GHAG 3W94A 2SNVA 2F9OA 1MKWK 3OU0A 3E91A 3LGIA 2AMQA 1KDQB 1TQ0B 1GMDG 3PMHB 1ZMJA 1SGIB 4JCNA 4AFUA 2UUFB 1UVSH 1CSOE 4JZ1A 1W7XH 4NG9H 9LPRA 3SJOA 5E2PA 1YGCH 2GMTC 1DOJA 2PWXA 5ABWA 5GWZA 1V6DA 2OQUA 3FFGA 5GCHG 4D7GA 3EDXB 5LPFA 3TITA 1F0RA 2C8WB 1T8OA 2Y5FA 1LHGH 2BHGA 1ORFA 4ZHMU 3A8BA 3WY8A 3ZVGA 1BIOA 1PPGE 1Y3XA 2A4RA 2Z3EA 3AAVA 2OC1A 2PUXB 3KIDU 3MNSA 1QA7A 5C2ZA 1Y5AT 4PROA 4WMDA 3RXTA 1SB1H 2VJ1A 4DY7B 5J4SA 2O8TA 2SGDE 4FVBA 3RC6A 3TK5A 1FUJA 3PMAB 1Q31A 1RIWB 1NZQH 2H9EH 3I78A 1H1BA 3QK1A 1HDTH 2ZO3H 1TLDA 3QDZB 3V12A 1YYY1 3UQOA 1O33A 1QQ4A 1V2OT 4XBBA 1GJ5H 3VXEH 2FEQH 1MZAA 1FY1A 2ZF0H 5I46H 3KCGH 2BD7A 4FU9A 3IG6B 1CO7E 1UCYK 2GCHG 2PGBB 3MMGA 2V35A 2BY6X 1GBFA 2D8WA 1BMAA 1X7AC 4K3JA 1EP6A 2XTTB 4YOIA 3FP7E 3RXIA 1O3CA 3TH2H 1GJ8B 5T3HA 3ZZ7A 1O3GA 1EXFA 1T7CA 2FS9A 4GUXA 1W10U 5EG4A 2XWBI 1O2ZA 3GCTF 1CVWH 4LOYH 3O8CA 3SI3H 2ZU3A 1DX5M 1IQLA 3LT3A 3VFEA 3A82A 1ETTH 1O0DH 4THNH 3ZZ6A 4GCHF 1C5SA 3SO3A 1FI8A 1O2OA 2TPIZ 1CBWC 1YM0A 2Z9GA 4FU7A 3PTBA 2BY8X 1F92A 4ABDA 1GG6B 5JYIA 4CH2B 1HJ8A 1Z6JH 1KLTA 6LPRA 1UK2A 3V7TA 1VGCB 1O5GH 1O2PA 2VH0A 3RXAA 2VIPA 1O3KA 3Q3YA 1TNGA 3SN8A 3RU4T 4ISIH 1YF4A 3UQVA 3C27B 3T62A 1EPTC 1LVOA 4BTIB 1GHAF 1P2NA 4ISLA 1GJ6A 1HXFH 1L0ZA 1CE5A 2G5NA 4BTUB 4O9VA 1UTJA 3MFJA 1NRSH 1GMDF 1O2GH 1OPHB 1C5YB 5C20A 1DY9A 4IMQA 1SGFA 3KF2A 1BTHH 1O2NA 2OCVB 5JPMH 3RU4D 3MU5A 1NU9A 3A7XA 1DWEH 5A0CA 1IQNA 1MQ6A 4CRDA 5GCHF 3D23A 1HAIH 3OTJE 3BTWE 3RXPA 2OTVA 3KQCA 3TJOA 3SNCA 1GHBG 5FCRA 4KELA 1QRXA 3MYWA 3QLPH 1F2SE 1HJAC 4AFSA 5HGGA 1MAYA 5F6MA 4NA7A 1NFXA 3TNTA 1C2MA 5IDKA 1SGCA 3RXSA 3EA7A 1DSUA 1LPKB 1TMUH 1ZRBA 1DPOA 1C4U2 2P93A 1C2GA 3F9GA 3NKKA 3BTFE 3G01A 3UREA 1P9SA 1VJ9U 4WMEA 3BTEE 3SQHE 1YCPH 4NFFA 1HUTH 1B5GH 1SGRE 3QO6A 2VIQA 1KLJH 2ZTZA 2OBQA 3RXRA 1ZOMA 2GCHF 1HAZB 1SLXB 1D3TB 1EASA 4LK4A 4E06H 3T27A 1HB0B 1ZYOA 1ELCA 1QFKH 3ZZ8A 3BTDE 4IC6A 1XUFA 4R8TB 5F03A 1L4ZA 3ODDA 1H4WA 1PQAA 4UFFH 2XBVA 4Y76A 1AZ8A 1LHDH 1LVYA 1DICA 1BBRE 1GBCA 4TPIZ 2HNTC 2ANMH 4INLA 2GP9B 1EJAA 1GBIA 3FP8E 1O2JA 1M9UA 2WPIS 2VIOA 2BD2A 3FANA 1V3XA 1Z8RA 1LQEA 4UEHH 5BRRE 3DFJA 3RXCA 3UUZA 4OS1A 2VGCB 1FZZA 3A88A 4CRFA 2J9NA 1O2HA 1CU1A 3VGCB 1DFPA 3M5LA 1KTSB 2QY0B 2STAE 1NTPA 3BN9A 3E16B 5DP3A 1G2MA 4AN7A 1RGQA 4YM9A 4I33A 5A8ZA 3SZNA 1VITG 2BQ6B 3F68H 1GBTA 5LH8A 3TLOA 3M61U 4B75A 2STBE 2BYAX 1NFYA 3UR9A 4FU8A 4CBOA 2H2ZA 1LHFH 2WPKS 1KYNA 2ILNA 1GI9B 2BDYA 4IGDA 3A7ZA 1C1RA 1AQ7A 1KXBA 1O2QA 3LDXH 3LH3A 1O3BA 7ESTE 3GCNA 4M7GA 4TWYA 1PPEE 3CP7A 4Q2KA 3RLYH 1A0JA 2ZHEH 1N1LA 3SUGA 1WTGH 1GBHA 1L4DA 1AVGH 2ZDNA 4I8JA 4BANB 1GHBF 2BDBA 3L6PA 3SNEA 4Q7YA 1XUIA 4JZDH 6CHAC 1TNKA 1C1SA 3ZYDA 2EI6A 4RKOB 2NWNA 1L1JA 3M35A 3BTGE 1W3CA 2GZ7A 4ZKOU 2YNBA 5FAHA 1UVTH 3UIRA 2ANYA 4OS7A 2AGIX 1AB9C 1CA8B 1QIXB 1YPHC 3GICB 3U98H 5DO4H 1KXEA 1FV9A 2XCNA 1ZJDA 1Q2WA 1P9UA 1JRSA 1GG6C 3KNXA 3ZVAA 1C5TA 4A5TS 2FOMB 3GY6A 1AIXH 2V0BA 3K2UA 2CV3A 2VH6A 1TQ7B 2R2MB 3S69A 2ZGXH 1SLWB 3MO3A 1DWBH 2R3YA 2GD4B 4ZXXH 2A0QB 2VIVA 1ZTKA 4Y7AA 2F9BH 3T26A 1YKTA 1KTTB 1IQKA 1VZQH 3GYMA 1BBRK 1N6YA 1SFQB 1HYLA 3ATWA 4AYVB 2VWMA 2ZDLA 1QJ7B 2AEIH 4MTBA 3Q00A 5FX5A 2A2QH 2Y7ZA 1FPCH 2A5IA 4UFGH 4CRCA 1ZR0A 2BY7X 4BNRA 2ANKH 3RLWH 3LGTA 1AFEH 1O3MA 3VB7A 2P95A 3A81A 1HFDA 1P06A 1PQ7A 2Z9LA 1NRRH 1P2KA 3TGJE 4INHA 4X2YA 1PPBH 4UE7H 3P8OA 3LGVA 1XM1A 1ZHRA 8KME2 5EU8A 1FN8A 2PW8H 4AOQA 2FPZA 2W26A 4Y0ZE 1EAIA 1HPGA 1SHHB 1G9IE 2O8WA 1P09A 1OS8A 4B76A 4MPVA 5E2OA 3U1JB 1ARCA 2NU4E 3UWIA 5A0AE 2V3OH 1SLUB 4F49A 1GI5A 1TIOA 3PLKA 1W7GH 2CXVA 3RXJA 1GBMA 3BTME 4I8HA 3URDA 1VITF 2BZAA 4ESTE 3UR6A 1CGIE 4WH8A 1GI7B 2W3IA 2ZQ1A 3MNCA 1CHOG 3RXFA 1FIWA 4A1VA 4DIIH 1C2DA 3SJ8A 2OBOA 2ZA5A 4WWYA 2YNAA 1EX3A 1MD7A 1HAOH 1J9CH 1P8VC 5DPAA 2BD4A 1HXEH 3M5OA 5GJ4B 1NFUA 1P10A 4GVUA 1C1VH 5F8XA 3E0PB 3RC5A 4K1EA 3PLPA 1XUKA 5DP8A 1GHYH 3LGWA 2FOFA 1P03A 3VB6A 2HVXA 1N8OC 4CRGA 3E6PH 1ZTLA 2XYAA 2P8OB 4MNWA 1EOJA 1CGJE 2G00A 1DVAH 1BQYA 5AVDA 5FBEA 3TIUA 3PO1B 1P04A 4D7FA 3UTUH 5JB8S 4O3UA 2KAIA 4NIXA 4LZ1H 1TX7A 1C5UA 1TOMH 1SBWA 5F8ZA 1FQ3A 2BOKA 5J4QA 1HCGA 5L2YH 5EW1H 3UPEA 2G55A 3VGCC 4D9QA 2VVUA 3ODFA 2F91A 3E1XB 3SV8A 4K2YA 5EXLA 2Y7XA 2FI3E 2Q6FA 4O03A 3U8TH 3SNAA 2RCEA 4WXIA 1SL3A 3RXVA 1W12U 1P57B 5C67A 3SUFA 1MKXH 1O30A 1PQ5A 2GZ8A 3RXDA 3O8RA 4X2WA 4MG3A 3FP6E 1ZSLA 3RMLH 1MCVA 1MTNB 4DW2U 1G3BA 1UCYE 2ASUB 1PPCE 2H5CA 1CA0B 4YOJA 3GOVB 1E36B 3A87A 1GBDA 3RMOH 2PSYA 4RN6A 1AWHB 3D49H 4MPUA 4QT8C 1W14U 4TY7A 4ZXYH 1ESTA 2AMPA 3VXFH 3TNSA 2ANWA 2TBSA 1OP0A 2PKAA 3SNDA 1TPOA 4MPXA 1C1WH 2ZHFH 4U01A 1S6FA 1C1TA 5E0HA 1C5XB 1B7XB 2FI4E 4KP0A 2TRMA 1L1GA 3BTHE 5DK1A 2G8TA 5CHAC 3RXQA 1C1NA 1UVUH 4X2XA 3SORA 2QAAA 4DIHH 4K1SA 3DHKH 1O2LA 5FBIA 5DP9A 1TGNA 4IBLH 2QV1A 1SI5H 2JETB 1F5LA 2VVCA 1C2EA 1PPZA 2FLBH 3ZVCA 4E7RG 4B73A 3K9XB 1NPMA 1A1RA 4GSOA 1AY6H 2A5KA 3MTYA 1KSNA 2FS8A 4X0WU 4F4OC 5EOKA 4JMYA 4B2AA 2ALVA 2Z9KA 2HOBA 3AASA 1CHOF 2ZZUH 3KHVA 2HLCA 3PB1E 4I32A 1GBEA 3U69H 3F9EA 2C8ZB 4JYVH 2VINA 1A5GH 4WMFA 3EYDA 4OGXA 1J14A 1Y5BT 2PKAB 1K1IA 1OKXA 2ZWLH 3ATIA 1FLEE 3O8DA 1O2KA 1A46H 4I8GA 2ODPA 2R0KA 2ZCLP 3SW2B 8GCHG 1IQEA 4MNYA 1P01A 3RM0H 5A0BA 1S5SA 2ZECA 2FOAA 1GJAB 2C3SA 4ZMAH 3GISB 3Q76A 4DVAU 3FZDA 1MTSA 1TNLA 4FUGA 1ANEA 1V2MT 1K2I1 2ZPRA 5JBTA 2ODYB 2CN0H 1O2WA 1MTUA 1NROH 4ZKRU 4NIVA 1L2EA 3PLBA 1S83A 2VB0A 3LGYA 1HAYB 2A31A 2J34A 3RXKA 1QB9A 4BTTB 2ULLA 5LGOA 5GPIB 2QIQA 4NA9H 1GMHG 1O3LA 1RRKA 4J1YA 3M3VA 4ZKNU 3GDSA 4TY6A 2TGPZ 3RU4E 3UWJH 4UONA 4JZFH 3R3GB 5EXMA 3U9AH 4X1RU 2V6NA 2ZU2A 3ZZBA 3N7OA 4X1NU 1EZSC 2A4QA 3S0NA 1LHEH 1LCYA 2P94A 1BRCE 1ZHPA 1WAYB 4X1PU 1AGJA 2ZI2H 3T28A 1IAUA 4D8NA 1FMGA 1PFXC 1OSSA 1WQSA 5G4BA 1EAWA 1QB1A 4Q7XA 1MAXA 3BEUA 3FAOA 2XXLA 5EPYA 1EATA 2Q1JA 2UUKB 3TVJB 1IHTH 2WPLS 3ZZ3A 2WPJS 1FDPA 2QGRA 5EW2H 1AUJA 1V2KT 3KL6A 1C9PA 2FO9A 2F3CE 1DXPA 4DG4A 1F5RA 1DXWA 1EP5A 1C5ZB 1NY22 1K1MA 3UNRA 5DKMA 3SU6A 1O31A 1GCTB 3M3SA 1XXDA 3D62A 3GY7A 3BTQE 1PPFE 3UY9A 5EQRA 1OWHA 1O3FA 3BG4B 1G37A 3K65B 2HRVA 3PO1C 4VGCB 1GGDB 1GCDA 2IN2A 5A8YA 3STIA 4NSYA 2O8UA 1ZPZA 3BEFB 1QJ1B 1BCUH 3T5FH 4IW4E 4DOQA 3E0NB 1PYTD 1FONA 2XC4A 3NXPA 2BX4A 1Z7KA 2P16A 3ZVEA 1C5WB 1DANH 4UFEH 5T6GA 1VJAU 1S81A 2BDGA 1ZSKA 3PMBB 3FZZA 3TGIE 3MO6A 5HXFA 1OP2A 4I7YH 1BA8B 1V2TT 4HI3A 1K1JA 2CGAA 1EUFA 3QUMP 8GCHF 4I31A 2BVSH 1FAKH 1A61H 1C4Y2 1L1NA 1TONA 1MTNC 3SU0A 3TPIZ 5FCKA 4OS2A 1C5LH 2AGGX 3NWUA 2ZG0H 1O5EH 1QRZA 2ZFPH 3SI4H 1DT2A 1CA0C 2A5AA 1BTZA 3HATH 2BD9A 2ZDVH 1C5OH 3SOSA 3HK3B 3URCA 3P8GA 1ZMLA 1JXPA 2QXHA 1QL7A 1BHXF 2FXRA 1TRYA 3ZVDA 3MU1A 1UHBA 1MH0A 1ARBA 1EZXC 4X8UH 1GJBB 3T25A 1GMHF 1DE7H 2XC5A 4A1TA 1E37B 2ZP0H 1AUTC 2A7HA 2LPRA 2PKSB 1XUHA 1YCPM 3TU7H 3OY5U 1GWAA 1MTWA 1LKAA 5DP4A 4BOHA 3LONA 2XBYA 3GYLB 4NFEA 3KGPA 4KTCA 2HGTH 4JYUH 4IC5A 3E90B 1IOEA 4FUCA 4DGJA 1UMAH 5GIBA 4RSPA 1SHYA 1KXFA 1J15A 1TB6H 3U8RH 4CBNA 4ISHH 1P0SH 5C1XA 1THSH 1SGQE 2ESTE 3K6ZA 1J17T 2BXUH 3S7HB 2F83A 5DGJA 1RXPA 1QRWA 1QL9A 1OX1A 2ALPA 2ZGBH 1SFIA 3V0XA 1XX9A 3RP2A 1UHBB 1EQ9A 1C5PA 1C2HA 4GPGA 5ETXA 5BPEA 1Z8IB 2H1UA 1GBLA 2VWNA 3QZRA 4AGKA 1V2LT 1YLCA 4U2WA 1QHRB 2PTCE 1S0QA 1D6WA 5C1UA 3M7UA 1ETSH 5L30H 2J92A 3PWCA 2GT8A 4CHAB 1QB6A 2B9LA 4TWWA 3IWMA 4LXBH 3PV4A 3Q3XA 4H42U 5C5NA 3M5MA 3A7WA 3RXMA 1EB2A 2FDAA 3LOXA 2F9UA 3TH4H 4HFPB 1O3DA 2ZHDA 4ZROA 1QBOA 4B71A 3A89A 2QN5T 3UNQA 3TGKE 2VU8E 5EPNA 3CENA 1AE5A 1QCPA 1RIWC 4AG2A 1GBKA 1SG8B 4BAOB 2QF3A 2Z7FE 1VCPA 2UUYA 1YBWA 3VB3A 1HBTH 2WINI 1MMJN 1FIZA 4H6SB 1UO6A 1TFXA 1GDUA 1V2RT 1AE8H 2Z94A 3CS0A 2C4FH 1A0LA 1T32A 3VPKA 4ZUHA 1BUIA 1BT7A 2OP9A 1B0EA 2FOBA 3SJ9A 4SGAE 3SQEE 3GY4A 4H6TA 1TNJA 1XUJA 1C9TA 1AHTH 1UK4A 1HNEE 1TBRH 2GCTB 3ZV8A 5TJXA 5L6NH 2BTCE 2LNCA 1MBQA 1AU8A 1FY4A 1NU7B 2UWPA 1C2LA 2A1DB 2O8MA 2RDLA 1ELBA 4KGAA 3SUDA 1ELDE 1GBJA 3PWBA 2RG3A 3A7TA 2ZFFH 1AFQB 3OY6U 3LKWA 2WYJA 5T6FA 4YT7H 3B9FH 5FX6A 2VWOA 2A45B 5AHGH 2HNTE 3S9CA 1ZGVA 1O2YA 3T2NA 1THPB 8LPRA 1QBNA 1J16A 2RA0A 2UWLA 3ZV9A 1RTLA 1GJDB 4IS5A 3HKJB 1BB0B 2V3HH 3BF6H 4Q80A 1ZPCA 5B6OA 5LPRA 2BLVA 2ZQ2A 1CT4E 1C4V2 3P6ZB 1SGPE 3HKIB 2WV4A 1VGCC 5JBAS 3P92A 1K9OE 2AYWA 5DG6A 4AX9H 1RJXB 1VCQA 1XUGA 1KXDA 5EXNA 3CS7A 3H7OA 1VITH 1C1OA 3GY3A 1RS0A 3IITA 2AIQA 3BG8A 1GI0A 3RM2H 4MNXA 1OWEA 2CF8H 2H5DA 4CRBA 1O39A 4MVNA 3SU5A 1TMBH 2A2XH 1ZZZA 1F0TA 3KQDA 2ZU1A 1VR1H 1O5FH 3L3TA 4O3TA 3GCHB 2HALA 1IQIA 1DUAA 2JKHA 2FP7B 1Y8TA 1DY8A 2HWLB 4DCDA 2FMJA 1FN6A 5LPEA 2EEKA 1BBRH 2XCFA 3MU0A 5EGMA 1D3QB 1DLEA 1UJ1A 4ABIA 1TABE 3M5NA 3AAUA 2Y80A 4CR5A 2W3KA 1PPHE 2R9PA 2WUCA 1NN6A 1TGBA 1C5RA 5K0HA 1XVMA 1AWFH 1YPHE 3QTVH 1WOFA 3DFLA 1BTXA 3UOPA 1ACBE 3JZ2B 4FUIA 1FXYA 3A8CA 3Q77A 1AVWA 1C2KA 4NZLA 1O5DH 1WSSH 2WPHS 2A32A 3T29A 1P2QA 4AFZA 1OYTH 3ZYEA 4AZ2B 2EA3A 4J2YB 3SU4A 2FYQA 3M37A 1ELEE 3B23B 2DUCA 1Y3WA 1C1MA 5EQQA 1WYKA 1HAXB 2Y5GA 1V2VT 3PMJA 2GKVE 1CT2E 2THFB 5FPSA 1FPHH 5TCCA 1MUEB 4FVDA 1ABIH 4FUEA 1SPJA 3MWIU 1ZHMA 2A4GA 4X1QU 2ZGCA 3M7QA 1UTQA 4FUBA 1GI2A 4HZHA 4ZHAA 3A7YA 1O3AA 2WYGA 1G3DA 2FWWA 1KIGH 1ZTJA 4WY3A 3F1SB 1GVKB 2TIOA 1O5AB 2AMDA 2FZZA 6ESTA 2UUJB 1QL8A 4YZUA 5C3NA 1O35A 4Y11E 1TRNA 4NIYA 4CHAC 1A3BH 1BDAA 1T31A 3L33A 2NU2E 4K8BA 1QJ6B 1SC8U 3KN2A 1QR3E 2Z3CA 4FUDA 2VGCC 4TYDA 3I77A 2GT7A 1XVOA 4OS4A 2G52A 4AFQA 4WH6A 1A4WH 5EQSA 2ZPSA 5F8TA 2M5TA 1O2IA 2IJOB 3RXUA 1AZZA 4CREA 1DSTA 1IHSH 1G3CA 3VB5A 2FTLE 3MI4A 2ZU4A 4A1XA 1MKXK 3A80A 1F0SA 2TGAA 4MDSA 4BXWA 1WU1A 1LTOA 1O34A 2G4TA 1K21H 3QX5H 2SGPE 4X8SH 1YPGH 4I8KA 3F9HA 1SLVB 1BJVA 3P8NA 1A3EH 1A0HB 2EI7A 4IMZA 4AB8A 2BDCA 3W95A 1DM4B 1O2SA 1ZGIA 2CHAB 1EOLA 2W5EA 1GJ4H 1O3IA 1THRH 2GCTC 1S6HA 1TNHA 3M36A 3SU1A 3MOCA 1O2VA 5EODA 4ZH8A 2P3UB 3A8AA 5ESBA 8ESTE 1ABJH 1AFQC 2KAIB 1GJCB 2EC9H 4DT7B 4CR9A 1BMMH 1ETRH 5I25A 4ZKSU 3UNSA 1E0FD 3BTKE 1LHCH 2XBWA 4K69A 2A7JA 1TA2A 1NC6A 4X6PA 1YP9A 1K1LA 5GXPA 2BVRH 4NSVA 3STJA 2QYIA 1TGSZ 3M3TA 1TAWA 1AN1E 2FODA 4YLUA 3S9BA 3ATMA 4FUJA 4Z0KA 3ESTA 2F9NA 1NS3A 4AB9A 2HNTF 1SOZA 2XC0A 1SMFE 3A83A 1EAUA 3P70B 1EZQA 4Y71A 1HJAB 1MQ5A 1KXAA 2BQWB 1ESBA 1IQFA 1H8IH 2CF9H 4X2VA 1CHGA 1W0ZU 1A5IA 1O2RA 1UTNA 1AI8H 7GCHG 2BY5X 1BITA 3MU4A 2SGEE 4IN1A 4NIWA 1DITH 4GHQA 3LH1A 3PROA 3RXEA 1D6RA 1MD8A 1SOTA 3M7TA 3NZIA 1O38A 2FX4A 2GDDA 4UFDH 5CMXH 1F5KU 4ABEA 2PHBA 1V2NT 1UTKA 2DE9A 1P2OA 1T4VH 2C8XB 2BM2A 3HK6B 3NPSA 1GBAA 1C1QA 4XOJA 3GY5A 1BOQA 3ENSB 4MNVA 1SGFG 4BAMB 4O97A 2D26C 1MU6B 1J8AA 5AF9H 2G51A 2K1QA 4XFQA 4D76A 1ZJKA 1TRMA 2ODQA 1HLTH 4FXGH 3ITIA 3AW1A 1MKWH 3GCHC 3OSYA 4K1TA 1HRTH 2B0FA 5SGAE 5CE1A 2UWOA 2TGTA 3SV2H 1O37A 2R0LA 3SNBA 4X6NA 5DP5A 1MTVA 4Y0YE 4Y6DA 3LU9B 4BAKB 3GCOA 4KTSA 4ABJA 2J4IA 3JZ1B 1QGFA 1RFNA 3RDZA 2Y81A 1WTHD 1GJ7B 1QNJA 3E8LA 3QGJA 2P3TB 1E34B 1NM6A 2FOGA 2Y5HA 3MNBA 1BTYA 2P3FH 1T8MA 4MPWA 3I29A 1GJ9B 2ZGHA 1TOCB 1BTWA 2J95A 3ZZ9A 1Y5UT 2FX6A 1GHWH 1SGYE 2Z3DA 2VIWA 3MH4A 2BVXH 1BZXE 4ABFA 4BAQB 3MHWU 2BXTH 1FNIA 3GY8A 3SBKA 3SU2A 4KTUA 5A09A 2BD3A 2ZDAH 2A7CA 1W0YH 5PTPA 2SGFE 3FVFB 1MZDA 2D1JA 3Q3KA 4Y7BA 5DP7A 2ZFSA 3LJOA 3VEQB 9ESTA 5FHTA 3EA8A 3S7KB 1RTFB 4K8YA 3O8BA 2FI5E 2RA3A 2ZFQH 1CT0E 1DUEA 1G32B 5JB9S 1UCYH 3ATKA 1P2IA 4NWKA 3LJJA 1GHVH 1C2FA 1GI8B 4ASHA 4LZ4B 2BLOA 3EE0B
chains in the Genus database with same CATH superfamily
3BIUH 2P8OC 1C1UH 3BEIB 1T8LA 2QC2A 2R2WU 3SHCH 1OOKB 3ZZ5A 1U6QA 3UB0A 6CHAB 1UVOA 5HMAA 2G4UA 5CHBA 5CDFE 2ZCKP 3RXGA 1O3EA 7GCHF 1O5BB 4A92A 2B5TB 1AB9B 7KMEH 3SV9A 3KQEA 2L6OA 1C2JA 1OXGA 3H5CB 3BTTE 2AIPA 1ZPBA 2ZPQA 5C0TA 2Q6DA 1S0RA 2ZDMA 1NRNH 2KR7A 3N99A 4E05H 3TJVA 2J38A 3H7TA 3MO9A 5A2MH 1XKBC 1DS2E 1SKYE 1O3JA 1P02A 3F2GA 4U32A 1ANCA 1AKSA 1TPAE 1Y59T 1EZUC 2PV9B 1EJMA 3UAIC 3SUEA 2CHAC 3ZZDA 2FM2A 5HIYA 3SHAH 3SV7A 4ABHA 1K1NA 1LPGB 5HM9A 3HGNA 1H8DH 1INCA 1OYQA 1C5VA 1N6XA 4X1SU 2PR3A 4NCYA 1K0HA 3SU3A 1QTFA 4ISNA 1O32A 1SGDE 2FESH 2ZTXA 4Y10E 5GDSH 2FOEA 1UTPA 3DA9B 3PV5A 2OLGA 1OWDA 3UFAA 1LMWB 4BXSA 1SVPA 1S82A 4DJZB 4E7NA 5K7RA 4CH8B 1MU8B 3RXHA 4WVPE 2OUAA 2R3UA 2WUBA 2O9QA 3D65E 3SGAE 1YCPK 1WQVH 1UK3A 5AFYH 1E1QD 5EJ1A 5H4IB 5T6DA 1EJNA 2PTNA 2JH5D 1JIMA 1TNIA 4AYYB 2NU1E 3RXBA 1K1PA 1T4UH 2JETC 2FLRH 2OK5A 1AKSB 3QZQA 4IN2A 2AH4X 4YESB 2I6SA 1UTMA 2F9PA 1E38B 1LDTT 3P17H 1JOUB 4B1TA 3P8FA 4XBDA 2ZIQH 4B2CA 2GDEH 2B8OH 4NA8A 3B8JA 1QA0A 2XRCA 4GAWA 4YT6H 4ISOA 3HPTB 3AVZA 4ABGA 2ZFRH 1ESAA 1AMHA 1KLIH 1ZLRA 3ZZAA 5JBCS 2CMYA 2GVFA 1MCTA 2XWAA 2BQ7B 2ZDKA 5TCAA 1LPZB 4JZEH 1H8ED 1BHXB 1AD8H 1YLDA 2Y82A 1H9HE 1K1OA 4B2BA 2GTBA 4ZCNA 2BB4A 1V2UT 2SGAA 3E3TA 1JMOH 4B74A 1C5NH 3TK6A 2ZHWH 3SJKA 2J2UA 1YPMH 1P05A 1O2XA 2SFAA 4XBCA 3V13A 2VIDA 5C5OA 4DT4A 4Z1MD 2XOKD 2H9HA 2BLQA 1F7ZA 2W7UA 1DLKB 4INKA 1V2PT 2C93B 1LVMA 1N8OB 2BD5A 3QTOH 2C90B 3GDUA 3DSPA 2BZ6H 2ZKSA 2QCYA 3VB4A 1YPEH 4GHTA 3ZVBA 2W6JD 2NU0E 3MQKC 2EY4C 2OC8A 4KKDA 1ID5H 1BTPA 4F48B 3QWCH 1DWCH 5IK2D 1DDJA 3TJNA 1Y3UA 1RD3B 2H9TH 1IQHA 1LVBA 3BSQA 1Z1JA 3DUXH 5HYOA 1CGHA 1NESE 2FIRH 1D4PB 1GI4A 1TX6A 3LGUA 1V2ST 2H6MA 2BLWA 4XSKU 2KCPA 1FAXA 1BTUA 1Z6EA 4A6LA 3V3MA 1E35B 1GMCG 4HGCA 3A84A 2EQNA 2HPPH 5JBBS 2G5VA 1GDQA 1P12E 1RTKA 3NUMA 1H8HD 1HAGE 4A7IB 5L2ZH 1TALA 5E0GA 3MNXA 5HIZA 1SR5C 1AO5A 4AGJA 3A85A 4RI0A 2PGQB 4ZHLU 1P2JA 3EA9A 1NRPH 1YC0A 1O2UA 2Y6TA 1QZ8A 1SSXA 2BD8A 1S85A 5DP6A 4OS6A 3BIVH 1GCTC 2Z9IA 1O5CB 2ZHQH 1C2IA 1O3OA 3K6YA 1EB1H 2WPMS 1P3EA 4UDWH 1TWXB 1WCZA 1GHXH 2QXIA 3BG4C 1G3EA 1O2MA 2QA9E 1OP8A 4VGCC 1ANDA 1GGDC 1K22H 2J94A 4NWLA 2ZNKH 4R0IA 1ZSJA 2TGDA 4OGYA 4Z6AH 1YPKH 2AERH 2OXSA 1GBBA 2BDAA 4FUFA 1D9IA 1MBMA 2BY9X 4K5ZA 1JIRA 1WUNH 1HAHH 3C1KA 4X8TH 1IQMA 3SGBE 5CHAB 1S84A 1C5MD 1ZMNA 1BRBE 2IOTA 3U1IB 1A2CH 1HAVA 4YO9A 3QGNB 1TBZH 3P95A 2D2DA 2BDIA 1OWJA 3MH5A 4WF8A 3LPRA 5IYTA 3SJIA 2ZEBA 4X8VH 4D9RA 5JDUB 5EJLA 1C5QA 5FPYA 1KY9A 3F6UH 2GGVB 2W7SA 6GCHG 1IQGA 2PLXA 2AGEX 4JK5A 2ZTYA 3DD2H 1XXFA 4X6MA 1GI6A 3U8OH 1V2WT 4ASUD 2JH6D 3KEEA 1SQTA 2GZ9A 1AVXA 3OEHD 1BMLA 3SV6A 1NT1A 2GMTB 3LC3A 1ELVA 3GDVA 2XBXA 3GY2A 3EQ0H 2C8YB 1GL1A 3MH6A 1FY5A 1Y3VA 1ELTA 1ANBA 3A8DA 2PFEA 1D3DB 1Q3XA 3R0FA 1O3NA 4YLQH 1TGTA 4Y79A 1Z71A 1G30B 3PM3A 1NRQH 4ABAA 1JRTA 3TK9A 1V2JT 4Y8XA 2W6ID 1P11E 2QE7D 2QXGA 2EI8A 2A4OA 1TA6A 1H9IE 1TPPA 2OINA 1HAVB 2PKSC 2GX4A 2ZGJA 1OHHD 3RMNH 4ABBA 2GV6A 2NU3E 2WZQA 1F0UA 3TJUA 4AC9A 4DURA 2ZFTA 1P2MA 1NFWA 1GVLA 1JBUH 1C1PA 2PUQH 1Y3YA 2QF0A 1UTLM 2CJIA 3S9AA 2SGQE 1SGEE 3OX7U 4GLYA 1O3PB 5A8XA 2ZC9H 1LKBA 1D3PB 4FUHA 4AG1A 1TMTH 4SGBE 4OS5A 1VCWA 3EGKH 2I6QA 1TBQH 2F43B 1JWTA 1YPLH 1TE0A 2F9VA 4I8LA 2DE8A 1ELAA 1GMCF 4XE4A 2RFKC 1ZRKA 1HIAA 2GV7A 4BAHB 2PSXA 1GVZA 1O3HA 2FTMA 4JZIA 1EPTA 1LO6A 2OC0A 1TYNA 1OWIA 3ZVFA 1Z1IA 3DT0H 5FPTA 2JH0D 2B7DH 3NCLA 1PQ8A 3A86A 2OD3B 1BRAA 2RDEA 4YOGA 1BRUP 1LQDB 1YPJH 1QBVH 1SGTA 2VWLA 1A7SA 1CQQA 1O2TA 2SNWA 1UVPA 3ATLA 4OM9A 1E79D 3F9FA 2BDHA 3EAJA 1IQJA 2FOCA 1WV7H 1FY8E 1SQAA 1CBWB 5E0JA 4JYTA 2AS9A 1T8NA 5HM2A 1UTOA 1GDNA 3RXLA 4MQAA 4WXVA 3ZZ4A 1NO9H 1HV7A 4ZAEA 4X6OA 1GI1A 1HIAB 3LIWA 1HGTH 2YOLA 1G36A 5ESTE 2J5UA 2QXJA 4UD9H 5FXLA 3MU8A 1W11U 1FJSA 4JK6A 2OQ5A 1EPTB 3A7VA 4Y8ZA 1QURH 4H4FA 6GCHF 4AORA 2G81E 1OWKA 1W8BH 3RXOA 1GPZA 3F2HA 1XKAC 1QQUA 5E8EH 1O36A 3ZZCA 2BMGB 1P3CA 4MLFB 1SGNE 1KXCA 1GI3A 3AW0A 3UOUA 1GHZA 3RMMH 1Z8JB 5C1YA 1EKBB 2O8LA 1B0FA 4U30A 1BMNH 4Q7ZA 4Y8YA 3HGPA 2XW9A 3TH3H 5DJ7A 3RUOA 2YMSC 1K28D 1TGCA 1KDQA 1ELFA 2OC7A 1PYTC 3QN7A 1FY3A 3GCTG 1W2KH 7LPRA 1TX8A 1XMNB 1HAPH 2ZCHP 1TPSA 5C94A 3KQBA 4TPYA 4NGAH 4GCHG 2FOHA 1WBGB 2HPQH 3RC4A 5AFZH 4HTCH 2P59A 1G2LA 1HJ9A 3DCLA 1QY6A 4RKJB 2VVVA 1SQOA 2IPHA 1Z8GA 2VNTA 3MH7A 1ELGA 2ZU5A 1BJUA 1W13U 4K60A 4NZQA 4CRAA 2Z6BD 2Q6GA 3NK8A 3LC5A 4WJG2 3OYPA 2BX3A 1H9LB 1EAXA 1YLNA 3ELAH 2BOHB 4YTAA 2WV5A 4XDEA 3PYHA 1A5HA 3BV9B 2QF5A 1V2QT 1PJPA 3SGQE 1GL0E 2Z9JA 2XNIA 2AFQB 3PTNA 1DWDH 2FYRA 1GHAG 3W94A 2SNVA 2F9OA 1MKWK 3OU0A 3E91A 3LGIA 2AMQA 1KDQB 1TQ0B 1GMDG 3PMHB 1ZMJA 1SGIB 4JCNA 4AFUA 2UUFB 1UVSH 1CSOE 4JZ1A 1W7XH 4NG9H 9LPRA 3PRBA 5E2PA 1YGCH 2GMTC 3SJOA 1DOJA 2PWXA 5ABWA 5GWZA 1V6DA 2OQUA 3FFGA 5GCHG 4D7GA 2LP6A 3EDXB 5LPFA 5EJZA 3TITA 1F0RA 3N7EA 2C8WB 1T8OA 2Y5FA 1LHGH 2BHGA 1ORFA 4ZHMU 3A8BA 3WY8A 3ZVGA 1BIOA 1PPGE 1Y3XA 2A4RA 2Z3EA 3AAVA 2OC1A 2PUXB 3KIDU 3MNSA 1QA7A 5C2ZA 1Y5AT 4PROA 4WMDA 3RXTA 1SB1H 2VJ1A 4DY7B 5J4SA 2O8TA 2SGDE 4FVBA 3RC6A 3TK5A 2CK3D 1FUJA 3PRDA 3PMAB 1Q31A 1RIWB 1NZQH 2H9EH 3I78A 1H1BA 3QK1A 1HDTH 2ZO3H 1TLDA 3QDZB 3V12A 1YYY1 3UQOA 1O33A 1QQ4A 1V2OT 4XBBA 1GJ5H 3VXEH 2FEQH 1MZAA 1FY1A 2ZF0H 5I46H 3KCGH 2BD7A 4FU9A 3IG6B 1CO7E 1UCYK 2GCHG 2PGBB 3MMGA 2V35A 2BY6X 1GBFA 2D8WA 1BMAA 1X7AC 4K3JA 1EP6A 2XTTB 4YOIA 3FP7E 3RXIA 1O3CA 3TH2H 1GJ8B 5T3HA 3ZZ7A 1O3GA 1EXFA 1T7CA 2FS9A 3FO8D 4GUXA 1W10U 5EG4A 2XWBI 1O2ZA 3GCTF 1CVWH 4LOYH 3O8CA 3SI3H 2ZU3A 1DX5M 1IQLA 3LT3A 3VFEA 3A82A 1ETTH 1O0DH 4THNH 4F55A 3ZZ6A 4GCHF 1C5SA 3SO3A 1FI8A 1O2OA 2TPIZ 1CBWC 1YM0A 2Z9GA 4FU7A 3PTBA 2BY8X 1WXRA 4TSFD 1F92A 2J97A 1GG6B 4ABDA 4CH2B 5JYIA 1HJ8A 1Z6JH 2KX4A 1KLTA 6LPRA 1UK2A 3V7TA 1VGCB 1O5GH 1O2PA 2VH0A 3RXAA 2VIPA 1O3KA 3Q3YA 1TNGA 3SN8A 3RU4T 4ISIH 1YF4A 2K0QA 2YMSD 3UQVA 3C27B 3T62A 1EPTC 1LVOA 4BTIB 1GHAF 1P2NA 4ISLA 5C17A 1GJ6A 1HXFH 1L0ZA 1CE5A 2G5NA 4BTUB 4O9VA 2QF4A 1UTJA 3MFJA 1NRSH 1GMDF 1O2GH 1OPHB 4RT0A 1NBMD 2GJGA 1C5YB 5C20A 1DY9A 4IMQA 1SGFA 3KF2A 1BTHH 1O2NA 4P02A 2OCVB 5JPMH 3RU4D 3MU5A 1NU9A 3A7XA 1DWEH 5A0CA 1IQNA 1MQ6A 4CRDA 5GCHF 3D23A 1HAIH 3OTJE 3BTWE 3RXPA 2OTVA 3KQCA 3TJOA 3SNCA 1GHBG 5FCRA 4KELA 1QRXA 3MYWA 3QLPH 1F2SE 1HJAC 4AFSA 3OFND 5HGGA 1MAYA 5F6MA 4NA7A 1NFXA 3TNTA 1C2MA 5IDKA 5T1VA 1SGCA 3RXSA 3EA7A 1DSUA 1LPKB 1TMUH 1ZRBA 1DPOA 1C4U2 2KCAA 2P93A 1C2GA 3F9GA 3NKKA 3BTFE 3G01A 3UREA 1P9SA 1VJ9U 4WMEA 3BTEE 3SQHE 1YCPH 4NFFA 1HUTH 1B5GH 1SGRE 3QO6A 2VIQA 2LELA 1KLJH 2ZTZA 2OBQA 3RXRA 1ZOMA 2GCHF 1HAZB 1SLXB 1D3TB 1EASA 4LK4A 4E06H 3T27A 1HB0B 1ZYOA 1ELCA 1QFKH 3ZZ8A 3BTDE 4IC6A 1XUFA 4R8TB 5F03A 1L4ZA 3ODDA 1H4WA 1PQAA 4UFFH 2XBVA 4Y76A 1AZ8A 1LHDH 1LVYA 1DICA 1BBRE 1GBCA 4TPIZ 2HNTC 2ANMH 4INLA 2GP9B 1EJAA 1GBIA 3KYFA 3FP8E 1O2JA 1M9UA 2WPIS 2VIOA 2BD2A 3FANA 1V3XA 1Z8RA 1LQEA 4UEHH 5BRRE 3DFJA 3RXCA 3UUZA 4OS1A 2VGCB 1FZZA 3A88A 4CRFA 2J9NA 1O2HA 1CU1A 3VGCB 1DFPA 3M5LA 1KTSB 2QY0B 2STAE 1NTPA 3BN9A 3E16B 5DP3A 1G2MA 4AN7A 1COWD 1RGQA 4YM9A 4I33A 5A8ZA 3SZNA 1VITG 2BQ6B 3F68H 1GBTA 5LH8A 3TLOA 3M61U 4B75A 2STBE 2BYAX 1NFYA 3UR9A 4FU8A 4CBOA 5GNDA 2H2ZA 1LHFH 2WPKS 1KYNA 2ILNA 4TT3D 1GI9B 2BDYA 4IGDA 3A7ZA 1C1RA 1AQ7A 1KXBA 1O2QA 3LDXH 3LH3A 1O3BA 7ESTE 3GCNA 4M7GA 4TWYA 1PPEE 3CP7A 4Q2KA 3RLYH 1A0JA 2ZHEH 1N1LA 3SUGA 1WTGH 1GBHA 1L4DA 1AVGH 1SQRA 2ZDNA 4I8JA 1GHBF 4BANB 2BDBA 3F0OA 3L6PA 3SNEA 4Q7YA 1XUIA 4JZDH 6CHAC 1TNKA 1C1SA 3ZYDA 2EI6A 4RKOB 2NWNA 1L1JA 3M35A 3BTGE 1W3CA 2GZ7A 4ZKOU 2YNBA 5FAHA 1BMFD 1EFRD 1UVTH 3UIRA 2ANYA 4OS7A 2AGIX 1AB9C 1CA8B 1QIXB 1YPHC 3GICB 3U98H 5DO4H 1KXEA 1FV9A 2WSSD 5DSFA 2XCNA 1ZJDA 1Q2WA 1P9UA 1JRSA 1GG6C 3KNXA 3ZVAA 5HKKD 1C5TA 4A5TS 2FOMB 4B6EA 2WPDD 3GY6A 1AIXH 2V0BA 3K2UA 2CV3A 2VH6A 1TQ7B 2R2MB 3S69A 2ZGXH 1SLWB 3MO3A 1DWBH 2R3YA 2GD4B 4ZXXH 2A0QB 2VIVA 1ZTKA 4Y7AA 2F9BH 3T26A 1YKTA 1KTTB 3W1EA 1IQKA 1VZQH 3GYMA 1BBRK 1N6YA 1SFQB 1HYLA 3ATWA 4AYVB 2VWMA 2ZDLA 1QJ7B 2AEIH 5B6LA 4MTBA 3Q00A 5FX5A 2A2QH 2Y7ZA 1FPCH 2A5IA 4UFGH 4CRCA 1ZR0A 2BY7X 4BNRA 2ANKH 3RLWH 3LGTA 1AFEH 1O3MA 3VB7A 2P95A 3A81A 1HFDA 1P06A 1E1RD 3OEED 4HG6A 1PQ7A 2Z9LA 1NRRH 1P2KA 3TGJE 3U28C 4INHA 4X2YA 1PPBH 4UE7H 3P8OA 3LGVA 1XM1A 1ZHRA 8KME2 5EU8A 1FN8A 2PW8H 4AOQA 2FPZA 2W26A 4Y0ZE 1EAIA 1HPGA 1SHHB 1G9IE 2O8WA 2K8IA 1P09A 1OS8A 4B76A 4MPVA 3N7DA 5E2OA 3U1JB 1ARCA 2NU4E 3UWIA 5A0AE 2V3OH 1SLUB 4F49A 1GI5A 1TIOA 3PLKA 1W7GH 2CXVA 3RXJA 1GBMA 4RT1A 3BTME 4I8HA 3URDA 1VITF 4M9FA 2BZAA 4ESTE 5EIYA 3UR6A 1CGIE 4WH8A 3WWFA 1GI7B 2W3IA 2ZQ1A 3MNCA 1CHOG 3RXFA 1FIWA 4A1VA 2V3MA 4DIIH 2KM0A 2IJD1 1YY3A 1C2DA 3SJ8A 2OBOA 2ZA5A 3F3BA 4WWYA 2YNAA 1EX3A 1MD7A 1HAOH 1J9CH 1P8VC 5DPAA 2BD4A 1HXEH 3M5OA 5GJ4B 1NFUA 1P10A 4GVUA 1C1VH 5F8XA 3E0PB 3RC5A 4K1EA 3PLPA 1XUKA 5DP8A 1GHYH 3LGWA 2FOFA 1P03A 3VB6A 2HVXA 1N8OC 4CRGA 3E6PH 1ZTLA 2XYAA 2P8OB 4MNWA 1EOJA 1CGJE 2G00A 1DVAH 1BQYA 5AVDA 5FBEA 3TIUA 3PO1B 3EE7A 1P04A 4D7FA 3UTUH 5JB8S 4O3UA 2KAIA 4NIXA 4LZ1H 3SYJA 1TX7A 1C5UA 1TOMH 1SBWA 5F8ZA 1FQ3A 2BOKA 5J4QA 1HCGA 5L2YH 5EW1H 3UPEA 2G55A 3VGCC 4D9QA 2VVUA 3ODFA 2F91A 3E1XB 3SV8A 4K2YA 5EXLA 2Y7XA 2FI3E 2Q6FA 4O03A 3U8TH 3SNAA 2RCEA 4WXIA 1SL3A 3RXVA 1W12U 1P57B 5C67A 3SUFA 1MKXH 1O30A 1PQ5A 2GZ8A 3RXDA 3O8RA 4X2WA 4MG3A 3FP6E 1ZSLA 3GS9A 3RMLH 1MCVA 1MTNB 4DW2U 1G3BA 1UCYE 2ASUB 1PPCE 2H5CA 1CA0B 4YOJA 3GOVB 1E36B 3A87A 1GBDA 3RMOH 2PSYA 4RN6A 1AWHB 3D49H 4MPUA 4QT8C 1W14U 4TY7A 4B6FA 4ZXYH 1ESTA 2AMPA 3VXFH 3TNSA 2ANWA 2TBSA 3PV2A 1OP0A 2PKAA 3SNDA 1TPOA 4MPXA 1C1WH 2ZHFH 4U01A 1S6FA 1C1TA 5E0HA 1C5XB 1B7XB 2FI4E 4KP0A 2TRMA 1L1GA 3BTHE 5DK1A 2KCOA 2G8TA 5CHAC 2L74A 3RXQA 1C1NA 1UVUH 4X2XA 3SORA 2QAAA 4DIHH 4K1SA 3DHKH 1O2LA 5FBIA 5DP9A 1TGNA 4IBLH 2QV1A 1SI5H 2JETB 1F5LA 2VVCA 1C2EA 1PPZA 2FLBH 3ZVCA 4E7RG 4B73A 3K9XB 1NPMA 1A1RA 4GSOA 1AY6H 3CNRA 2A5KA 3MTYA 1KSNA 2FS8A 4X0WU 4F4OC 5EOKA 4JMYA 4B2AA 2ALVA 2Z9KA 2HOBA 3AASA 1CHOF 2ZZUH 3KHVA 2HLCA 3PB1E 4I32A 1GBEA 3U69H 3F9EA 2C8ZB 4JYVH 2VINA 1A5GH 4WMFA 3EYDA 4OGXA 1J14A 1Y5BT 2PKAB 1K1IA 1OKXA 2ZWLH 3ATIA 1FLEE 3O8DA 1O2KA 1A46H 4I8GA 2ODPA 2R0KA 5KEDA 2ZCLP 3SW2B 8GCHG 1IQEA 4MNYA 1P01A 2KZ4A 3RM0H 5A0BA 1S5SA 2ZECA 2FOAA 2HLDD 1GJAB 2C3SA 4ZMAH 3GISB 3Q76A 4DVAU 3FZDA 1MTSA 1TNLA 4FUGA 1ANEA 1V2MT 1K2I1 2ZPRA 3FOAA 5JBTA 2ODYB 2CN0H 1O2WA 1MTUA 1NROH 4ZKRU 4NIVA 1L2EA 2J98A 3PLBA 1S83A 1UW7A 2VB0A 3LGYA 2J34A 1HAYB 2A31A 3RXKA 1NBME 1QB9A 4BTTB 2ULLA 5LGOA 5GPIB 2QIQA 4NA9H 1GMHG 1O3LA 1RRKA 4J1YA 3M3VA 4ZKNU 5C0UA 3GDSA 4TY6A 2TGPZ 3RU4E 3UWJH 4UONA 4JZFH 3R3GB 5EXMA 3U9AH 4X1RU 2V6NA 2ZU2A 3ZZBA 3N7OA 4X1NU 3NRLA 1EZSC 2A4QA 3S0NA 1LHEH 1LCYA 2P94A 1BRCE 1ZHPA 1WAYB 4X1PU 1AGJA 2ZI2H 3T28A 1IAUA 4D8NA 1FMGA 1PFXC 1OSSA 3F2FA 1WQSA 5G4BA 1EAWA 2F4LA 1QB1A 4Q7XA 1MAXA 3BEUA 3FAOA 2XXLA 5EPYA 5FL7D 1EATA 2Q1JA 3OE7D 2UUKB 3TVJB 1IHTH 2WPLS 3ZZ3A 2WPJS 1FDPA 2VBCA 1MABB 2QGRA 5EW2H 1AUJA 1V2KT 3KL6A 1C9PA 2IPQX 2FO9A 2F3CE 1DXPA 4DG4A 1F5RA 2XNDD 1DXWA 1EP5A 1C5ZB 1NY22 1K1MA 3UNRA 5DKMA 3SU6A 1O31A 1GCTB 3M3SA 1XXDA 3D62A 3GY7A 3BTQE 1PPFE 3UY9A 5EQRA 1OWHA 1O3FA 3BG4B 1W0JD 1G37A 3K65B 1YWUA 2HRVA 3PO1C 4VGCB 1GGDB 3DSGA 1GCDA 2IN2A 5A8YA 3STIA 4NSYA 2O8UA 1ZPZA 3BEFB 1QJ1B 1BCUH 3T5FH 4IW4E 4DOQA 3E0NB 1PYTD 1FONA 2XC4A 3NXPA 2BX4A 1Z7KA 2P16A 3ZVEA 1C5WB 1DANH 3KQ5A 4UFEH 5T6GA 1VJAU 1S81A 2BDGA 1ZSKA 3PMBB 3FZZA 3TGIE 3MO6A 5HXFA 1OP2A 4I7YH 1BA8B 1V2TT 4HI3A 1K1JA 2CGAA 1EUFA 3QUMP 8GCHF 4I31A 2BVSH 1FAKH 1A61H 1C4Y2 1L1NA 1TONA 1MTNC 3SU0A 3TPIZ 5FCKA 4OS2A 1C5LH 2AGGX 3NWUA 2ZG0H 1O5EH 1QRZA 2ZFPH 3SI4H 1DT2A 1CA0C 2A5AA 1BTZA 3HATH 2BD9A 2ZDVH 1C5OH 3SOSA 3HK3B 3URCA 3P8GA 1ZMLA 1JXPA 2QXHA 3OTPA 1QL7A 1BHXF 2FXRA 1TRYA 3ZVDA 3MU1A 1UHBA 1MH0A 1ARBA 1EZXC 1VKYA 4X8UH 1GJBB 3T25A 1GMHF 1DE7H 2XC5A 4A1TA 1E37B 2ZP0H 1AUTC 2A7HA 2LPRA 2PKSB 1XUHA 1YCPM 3TU7H 3OY5U 1GWAA 1MTWA 1LKAA 5DP4A 4BOHA 3LONA 2XBYA 3GYLB 4NFEA 3KGPA 4KTCA 2HGTH 4JYUH 4IC5A 3E90B 1IOEA 4FUCA 4DGJA 1UMAH 5GIBA 4RSPA 1SHYA 1KXFA 1J15A 1TB6H 3U8RH 4CBNA 4ISHH 1P0SH 5C1XA 1THSH 1SGQE 2ESTE 3K6ZA 1J17T 2BXUH 3SZEA 3S7HB 2F83A 5DGJA 1RXPA 1QRWA 1QL9A 1OX1A 2ALPA 2ZGBH 1SFIA 3V0XA 1XX9A 3RP2A 1UHBB 1EQ9A 1C5PA 1C2HA 4GPGA 5ETXA 5BPEA 1Z8IB 2JIZD 2H1UA 1GBLA 2VWNA 3QZRA 4AGKA 1V2LT 1YLCA 2M2AA 4U2WA 1QHRB 2PTCE 1S0QA 1D6WA 5C1UA 3M7UA 2KFWA 1ETSH 5L30H 2J92A 3PWCA 2GT8A 4CHAB 1QB6A 2B9LA 4TWWA 3IWMA 4LXBH 3PV4A 3Q3XA 4H42U 5C5NA 3M5MA 3A7WA 3RXMA 1EB2A 2FDAA 3LOXA 2F9UA 3TH4H 4HFPB 1O3DA 2ZHDA 4ZROA 1QBOA 4B71A 3A89A 2QN5T 3UNQA 3TGKE 2VU8E 1FX0B 5EPNA 3CENA 1AE5A 1QCPA 1RIWC 4AG2A 1GBKA 1SG8B 4BAOB 2QF3A 2Z7FE 1VCPA 2UUYA 1YBWA 3VB3A 1HBTH 2WINI 3AK5A 1MMJN 1FIZA 4H6SB 3KYGA 1UO6A 1TFXA 4I86A 1GDUA 1V2RT 1AE8H 2Z94A 3CS0A 2C4FH 1A0LA 1T32A 3VPKA 4ZUHA 1BUIA 1BT7A 2OP9A 1B0EA 2FOBA 3SJ9A 4SGAE 3SQEE 3GY4A 4H6TA 1TNJA 1XUJA 1C9TA 1AHTH 1UK4A 1HNEE 1TBRH 2GCTB 3ZV8A 5TJXA 5L6NH 2BTCE 2LNCA 1MBQA 1AU8A 1FY4A 1NU7B 2UWPA 1C2LA 2A1DB 2O8MA 2PP6A 1ELBA 2RDLA 4KGAA 3SUDA 1ELDE 1GBJA 3PWBA 2RG3A 3A7TA 2ZFFH 1AFQB 3DSOA 4Q63A 3OY6U 3LKWA 2WYJA 5KECA 5T6FA 4YT7H 3B9FH 5FX6A 2VWOA 2A45B 5AHGH 2HNTE 3S9CA 1ZGVA 1O2YA 3T2NA 2YMSB 1THPB 8LPRA 1QBNA 1J16A 2RA0A 2UWLA 3ZV9A 1RTLA 1GJDB 4IS5A 3HKJB 1BB0B 2V3HH 3BF6H 4Q80A 1ZPCA 5B6OA 5LPRA 2BLVA 2ZQ2A 1CT4E 1C4V2 2JJ1D 3P6ZB 1SGPE 3HKIB 2WV4A 1VGCC 5JBAS 3P92A 1K9OE 2AYWA 5DG6A 4AX9H 1RJXB 1VCQA 1XUGA 1KXDA 5EXNA 4XRNA 3CS7A 3H7OA 4ACBA 4XD7D 1VITH 1C1OA 3GY3A 1RS0A 3IITA 2AIQA 3BG8A 1GI0A 3RM2H 4MNXA 1OWEA 2CF8H 2AHME 2H5DA 4CRBA 3VG8A 1O39A 4MVNA 3SU5A 1TMBH 2A2XH 1ZZZA 1F0TA 3KQDA 2ZU1A 1S6LA 1VR1H 1O5FH 3L3TA 4O3TA 3GCHB 2HALA 1IQIA 1DUAA 2JKHA 2FP7B 1Y8TA 1W0KD 1DY8A 4FOUC 2HWLB 4DCDA 2FMJA 1FN6A 5LPEA 2EEKA 1BBRH 2XCFA 3MU0A 5EGMA 1D3QB 1DLEA 1UJ1A 4ABIA 1TABE 3M5NA 3AAUA 3WW7A 2Y80A 4CR5A 2W3KA 1PPHE 2R9PA 2WUCA 1NN6A 1TGBA 1C5RA 5K0HA 1XVMA 1AWFH 1YPHE 3QTVH 1WOFA 3DFLA 1BTXA 3UOPA 1ACBE 3JZ2B 4FUIA 4Q4LA 1FXYA 3A8CA 3Q77A 1AVWA 1C2KA 4NZLA 1O5DH 1WSSH 2WPHS 2A32A 3T29A 1P2QA 4AFZA 1OYTH 3ZYEA 4AZ2B 2EA3A 4J2YB 3SU4A 2FYQA 3M37A 1ELEE 3B23B 2DUCA 1Y3WA 1C1MA 5EQQA 1WYKA 1HAXB 2Y5GA 1V2VT 3PMJA 2GKVE 1CT2E 2THFB 5FPSA 1FPHH 5TCCA 1MUEB 4FVDA 1ABIH 4FUEA 1SPJA 3MWIU 1ZHMA 2A4GA 4X1QU 2ZGCA 3M7QA 1UTQA 4FUBA 1GI2A 4HZHA 4ZHAA 2HVYB 3A7YA 1O3AA 4ACAA 2WYGA 1G3DA 2FWWA 1KIGH 1ZTJA 4WY3A 3F1SB 1GVKB 2TIOA 1O5AB 2AMDA 2FZZA 6ESTA 2UUJB 1QL8A 4YZUA 5C3NA 1O35A 1KMHB 4Y11E 1TRNA 5DN6D 4NIYA 4CHAC 1A3BH 1BDAA 1T31A 3L33A 2NU2E 4K8BA 1QJ6B 1SC8U 2JDID 1QR3E 2Z3CA 3KN2A 4FUDA 2VGCC 4TYDA 3WWBA 3I77A 2GT7A 1XVOA 4OS4A 2G52A 4AFQA 4WH6A 1A4WH 5EQSA 2ZPSA 5F8TA 2M5TA 1O2IA 2IJOB 3RXUA 1AZZA 4CREA 1DSTA 1IHSH 1G3CA 3VB5A 2FTLE 3MI4A 2ZU4A 4A1XA 1MKXK 3A80A 1F0SA 2TGAA 4MDSA 4BXWA 1WU1A 1LTOA 1O34A 2G4TA 1K21H 3QX5H 2WV9A 5KGOA 2SGPE 4X8SH 1YPGH 4I8KA 3F9HA 1SLVB 1BJVA 3P8NA 1A3EH 1A0HB 2EI7A 2WHXA 4IMZA 4AB8A 2BDCA 3W95A 1DM4B 1O2SA 1ZGIA 2CHAB 1EOLA 2W5EA 1GJ4H 3H09A 1O3IA 1THRH 2GCTC 1S6HA 1TNHA 3M36A 3SU1A 3MOCA 1O2VA 5EODA 2JJ2D 4ZH8A 2P3UB 3A8AA 5ESBA 8ESTE 1ABJH 3OAAD 1AFQC 2KAIB 1GJCB 2EC9H 4DT7B 4CR9A 1BMMH 4P00A 1ETRH 5I25A 4ZKSU 3UNSA 1E0FD 3BTKE 1LHCH 2XBWA 4K69A 2A7JA 1TA2A 1NC6A 4X6PA 1YP9A 1K1LA 5GXPA 2BVRH 4NSVA 3STJA 2QYIA 1TGSZ 3M3TA 1TAWA 1AN1E 2FODA 4YLUA 3S9BA 3ATMA 4FUJA 4Z0KA 3ESTA 2F9NA 1NS3A 4AB9A 2HNTF 1SOZA 2XC0A 1SMFE 3A83A 1EAUA 3P70B 1EZQA 4Y71A 1HJAB 1MQ5A 1KXAA 2BQWB 1ESBA 1IQFA 1H8IH 2CF9H 3FN8A 4X2VA 1CHGA 1W0ZU 1A5IA 1O2RA 1UTNA 1AI8H 7GCHG 2BY5X 1BITA 3MU4A 2SGEE 4IN1A 4NIWA 1DITH 4GHQA 3LH1A 1WDIA 3PROA 3RXEA 1D6RA 1MD8A 1SOTA 3M7TA 3NZIA 1O38A 2FX4A 2GDDA 4UFDH 5CMXH 1F5KU 5F53A 2PHBA 4ABEA 1V2NT 1UTKA 2DE9A 1P2OA 1T4VH 2C8XB 2KCYA 2BM2A 3HK6B 3NPSA 1GBAA 1C1QA 4XOJA 3GY5A 1BOQA 3ENSB 4MNVA 1SGFG 4BAMB 4O97A 2D26C 1MU6B 1J8AA 5AF9H 2G51A 2K1QA 4XFQA 4D76A 1ZJKA 1TRMA 2ODQA 1HLTH 4FXGH 3ITIA 3AW1A 1MKWH 3GCHC 3OSYA 4K1TA 1HRTH 2B0FA 5SGAE 5CE1A 2UWOA 2TGTA 3SV2H 1O37A 2R0LA 3SNBA 4X6NA 5DP5A 1MTVA 4Y0YE 4Y6DA 3LU9B 4BAKB 3GCOA 4KTSA 4ABJA 2J4IA 3JZ1B 3ZIAD 1QGFA 1RFNA 4FETA 3RDZA 2Y81A 1WTHD 1GJ7B 1QNJA 3E8LA 3QGJA 2P3TB 1E34B 1NM6A 2FOGA 2Y5HA 3MNBA 1BTYA 2P3FH 1T8MA 4MPWA 3I29A 1GJ9B 2ZGHA 1TOCB 1BTWA 2J95A 3ZZ9A 1Y5UT 2FX6A 1GHWH 1SGYE 2Z3DA 3FKSD 2VIWA 3MH4A 2BVXH 1BZXE 4ABFA 4BAQB 3MHWU 2BXTH 1FNIA 3GY8A 3SBKA 3SU2A 4KTUA 2J98B 5A09A 2BD3A 2ZDAH 2A7CA 1W0YH 5PTPA 2V7QD 2SGFE 3FVFB 1MZDA 2D1JA 3Q3KA 4Y7BA 5DP7A 2ZFSA 3LJOA 3VEQB 9ESTA 5FHTA 3EA8A 3S7KB 1RTFB 4K8YA 3O8BA 2FI5E 2RA3A 3F0PA 2ZFQH 1CT0E 1DUEA 4YXWD 1G32B 5JB9S 1UCYH 3ATKA 1P2IA 4NWKA 3LJJA 1GHVH 1C2FA 1GI8B 4ASHA 4LZ4B 2BLOA 3EE0B
chains in the Genus database with same CATH topology
3BIUH 2P8OC 1C1UH 3BEIB 1T8LA 2QC2A 2R2WU 3SHCH 1OOKB 3ZZ5A 1U6QA 6CHAB 1UVOA 5HMAA 2G4UA 2ZCKP 3RXGA 1O3EA 7GCHF 1O5BB 4A92A 2B5TB 1AB9B 7KMEH 3SV9A 3KQEA 1C2JA 1OXGA 3H5CB 3BTTE 2AIPA 1ZPBA 2ZPQA 2Q6DA 1S0RA 2ZDMA 1NRNH 4E05H 3TJVA 2J38A 3H7TA 3MO9A 5A2MH 1XKBC 1DS2E 1O3JA 1P02A 4U32A 1ANCA 1AKSA 1TPAE 1Y59T 1EZUC 2PV9B 1EJMA 3SUEA 2CHAC 3ZZDA 2FM2A 3SHAH 3SV7A 4ABHA 1K1NA 1LPGB 5HM9A 3HGNA 1H8DH 1INCA 1OYQA 1C5VA 1N6XA 4X1SU 2PR3A 4NCYA 3SU3A 1QTFA 4ISNA 1O32A 1SGDE 2FESH 2ZTXA 4Y10E 5GDSH 2FOEA 1UTPA 3DA9B 2OLGA 1OWDA 3UFAA 1LMWB 4BXSA 1SVPA 1S82A 4DJZB 4E7NA 5K7RA 4CH8B 1MU8B 3RXHA 4WVPE 2OUAA 2R3UA 2WUBA 2O9QA 3D65E 3SGAE 1YCPK 1WQVH 1UK3A 5AFYH 5H4IB 5T6DA 1EJNA 2PTNA 2JH5D 1JIMA 1TNIA 4AYYB 2NU1E 3RXBA 1K1PA 1T4UH 2JETC 2FLRH 1AKSB 3QZQA 4IN2A 2AH4X 4YESB 2I6SA 1UTMA 2F9PA 1E38B 1LDTT 3P17H 1JOUB 4B1TA 3P8FA 4XBDA 2ZIQH 4B2CA 2GDEH 2B8OH 4NA8A 3B8JA 1QA0A 2XRCA 4GAWA 4YT6H 4ISOA 3HPTB 3AVZA 4ABGA 2ZFRH 1ESAA 1AMHA 1KLIH 1ZLRA 3ZZAA 5JBCS 2CMYA 2GVFA 1MCTA 2XWAA 2BQ7B 2ZDKA 5TCAA 1LPZB 4JZEH 1BHXB 1AD8H 1YLDA 2Y82A 1H9HE 1K1OA 4B2BA 2GTBA 2BB4A 1V2UT 2SGAA 3E3TA 1JMOH 4B74A 1C5NH 3TK6A 2ZHWH 3SJKA 2J2UA 1YPMH 1P05A 1O2XA 2SFAA 4XBCA 3V13A 2VIDA 5C5OA 2H9HA 2BLQA 1F7ZA 2W7UA 1DLKB 4INKA 1V2PT 2C93B 1LVMA 1N8OB 2BD5A 3QTOH 2C90B 3GDUA 2BZ6H 2ZKSA 2QCYA 3VB4A 1YPEH 4GHTA 3ZVBA 2NU0E 2OC8A 4KKDA 1ID5H 1BTPA 3QWCH 1DWCH 1DDJA 3TJNA 1Y3UA 1RD3B 2H9TH 1IQHA 1LVBA 3BSQA 1Z1JA 3DUXH 5HYOA 1CGHA 1NESE 2FIRH 1D4PB 1GI4A 1TX6A 3LGUA 1V2ST 2H6MA 2BLWA 4XSKU 1FAXA 1BTUA 1Z6EA 4A6LA 3V3MA 1E35B 1GMCG 4HGCA 3A84A 2HPPH 5JBBS 2G5VA 1GDQA 1P12E 1RTKA 3NUMA 1HAGE 4A7IB 5L2ZH 1TALA 5E0GA 3MNXA 1SR5C 1AO5A 4AGJA 3A85A 2PGQB 4ZHLU 1P2JA 3EA9A 1NRPH 1YC0A 1O2UA 2Y6TA 1SSXA 2BD8A 1S85A 5DP6A 4OS6A 3BIVH 1GCTC 2Z9IA 1O5CB 2ZHQH 1C2IA 1O3OA 3K6YA 1EB1H 2WPMS 1P3EA 4UDWH 1TWXB 1WCZA 1GHXH 2QXIA 3BG4C 1G3EA 1O2MA 2QA9E 1OP8A 4VGCC 1ANDA 1GGDC 1K22H 2J94A 4NWLA 2ZNKH 4R0IA 1ZSJA 2TGDA 4OGYA 4Z6AH 1YPKH 2AERH 2OXSA 1GBBA 2BDAA 4FUFA 1D9IA 1MBMA 2BY9X 4K5ZA 1JIRA 1WUNH 1HAHH 3C1KA 4X8TH 1IQMA 3SGBE 5CHAB 1S84A 1C5MD 1ZMNA 1BRBE 2IOTA 3U1IB 1A2CH 1HAVA 4YO9A 3QGNB 1TBZH 3P95A 2D2DA 2BDIA 1OWJA 3MH5A 4WF8A 3LPRA 5IYTA 3SJIA 2ZEBA 4X8VH 4D9RA 5JDUB 1C5QA 5FPYA 1KY9A 3F6UH 2GGVB 2W7SA 6GCHG 1IQGA 2PLXA 2AGEX 4JK5A 2ZTYA 3DD2H 1XXFA 4X6MA 1GI6A 3U8OH 1V2WT 2JH6D 3KEEA 1SQTA 2GZ9A 1AVXA 1BMLA 3SV6A 1NT1A 2GMTB 3LC3A 1ELVA 3GDVA 2XBXA 3GY2A 3EQ0H 2C8YB 1GL1A 3MH6A 1FY5A 1Y3VA 1ELTA 1ANBA 3A8DA 2PFEA 1D3DB 1Q3XA 3R0FA 1O3NA 4YLQH 1TGTA 4Y79A 1Z71A 1G30B 3PM3A 1NRQH 4ABAA 1JRTA 3TK9A 1V2JT 4Y8XA 1P11E 2QXGA 2EI8A 2A4OA 1TA6A 1H9IE 1TPPA 2OINA 1HAVB 2PKSC 2GX4A 2ZGJA 3RMNH 4ABBA 2GV6A 2NU3E 1F0UA 3TJUA 4DURA 2ZFTA 1P2MA 1NFWA 1GVLA 1JBUH 1C1PA 2PUQH 1Y3YA 2QF0A 1UTLM 2CJIA 3S9AA 2SGQE 1SGEE 3OX7U 4GLYA 1O3PB 5A8XA 2ZC9H 1LKBA 1D3PB 4FUHA 4AG1A 1TMTH 4SGBE 4OS5A 1VCWA 3EGKH 2I6QA 1TBQH 1JWTA 1YPLH 1TE0A 2F9VA 4I8LA 2DE8A 1ELAA 1GMCF 4XE4A 1ZRKA 1HIAA 2GV7A 4BAHB 2PSXA 1GVZA 1O3HA 2FTMA 4JZIA 1EPTA 1LO6A 2OC0A 1TYNA 1OWIA 3ZVFA 1Z1IA 3DT0H 5FPTA 2JH0D 2B7DH 3NCLA 1PQ8A 3A86A 2OD3B 1BRAA 4YOGA 1BRUP 1LQDB 1YPJH 1QBVH 1SGTA 2VWLA 1A7SA 1CQQA 1O2TA 2SNWA 1UVPA 3ATLA 3F9FA 2BDHA 3EAJA 1IQJA 2FOCA 1WV7H 1FY8E 1SQAA 1CBWB 5E0JA 4JYTA 2AS9A 1T8NA 5HM2A 1UTOA 1GDNA 3RXLA 4MQAA 4WXVA 3ZZ4A 1NO9H 1HV7A 4ZAEA 4X6OA 1GI1A 1HIAB 3LIWA 1HGTH 2YOLA 1G36A 5ESTE 2QXJA 4UD9H 5FXLA 3MU8A 1W11U 1FJSA 4JK6A 2OQ5A 1EPTB 3A7VA 4Y8ZA 1QURH 4H4FA 6GCHF 4AORA 2G81E 1OWKA 1W8BH 3RXOA 1GPZA 1XKAC 1QQUA 5E8EH 1O36A 3ZZCA 2BMGB 1P3CA 4MLFB 1SGNE 1KXCA 1GI3A 3AW0A 3UOUA 1GHZA 3RMMH 1Z8JB 5C1YA 1EKBB 2O8LA 1B0FA 4U30A 1BMNH 4Q7ZA 4Y8YA 3HGPA 2XW9A 3TH3H 5DJ7A 3RUOA 1K28D 1TGCA 1KDQA 1ELFA 2OC7A 1PYTC 3QN7A 1FY3A 3GCTG 1W2KH 7LPRA 1TX8A 1XMNB 1HAPH 2ZCHP 1TPSA 3KQBA 4TPYA 4NGAH 4GCHG 2FOHA 1WBGB 2HPQH 3RC4A 5AFZH 4HTCH 2P59A 1G2LA 1HJ9A 1QY6A 4RKJB 2VVVA 1SQOA 2IPHA 1Z8GA 2VNTA 3MH7A 1ELGA 2ZU5A 1BJUA 1W13U 4K60A 4NZQA 4CRAA 2Z6BD 2Q6GA 3NK8A 3LC5A 4WJG2 3OYPA 2BX3A 1H9LB 1EAXA 3ELAH 2BOHB 4YTAA 2WV5A 4XDEA 3PYHA 1A5HA 3BV9B 1V2QT 1PJPA 3SGQE 1GL0E 2Z9JA 2XNIA 2AFQB 3PTNA 1DWDH 2FYRA 1GHAG 3W94A 2SNVA 2F9OA 1MKWK 3OU0A 3E91A 3LGIA 2AMQA 1KDQB 1TQ0B 1GMDG 3PMHB 1ZMJA 1SGIB 4JCNA 4AFUA 2UUFB 1UVSH 1CSOE 4JZ1A 1W7XH 4NG9H 9LPRA 3SJOA 5E2PA 1YGCH 2GMTC 1DOJA 2PWXA 5ABWA 5GWZA 1V6DA 2OQUA 3FFGA 5GCHG 4D7GA 3EDXB 5LPFA 3TITA 1F0RA 2C8WB 1T8OA 2Y5FA 1LHGH 2BHGA 1ORFA 4ZHMU 3A8BA 3WY8A 3ZVGA 1BIOA 1PPGE 1Y3XA 2A4RA 2Z3EA 3AAVA 2OC1A 2PUXB 3KIDU 3MNSA 1QA7A 5C2ZA 1Y5AT 4PROA 4WMDA 3RXTA 1SB1H 2VJ1A 4DY7B 5J4SA 2O8TA 2SGDE 4FVBA 3RC6A 3TK5A 1FUJA 3PMAB 1Q31A 1RIWB 1NZQH 2H9EH 3I78A 1H1BA 3QK1A 1HDTH 2ZO3H 1TLDA 3QDZB 3V12A 1YYY1 3UQOA 1O33A 1QQ4A 1V2OT 4XBBA 1GJ5H 3VXEH 2FEQH 1MZAA 1FY1A 2ZF0H 5I46H 3KCGH 2BD7A 4FU9A 3IG6B 1CO7E 1UCYK 2GCHG 2PGBB 3MMGA 2V35A 2BY6X 1GBFA 2D8WA 1BMAA 1X7AC 4K3JA 1EP6A 2XTTB 4YOIA 3FP7E 3RXIA 1O3CA 3TH2H 1GJ8B 5T3HA 3ZZ7A 1O3GA 1EXFA 1T7CA 2FS9A 4GUXA 1W10U 5EG4A 2XWBI 1O2ZA 3GCTF 1CVWH 4LOYH 3O8CA 3SI3H 2ZU3A 1DX5M 1IQLA 3LT3A 3VFEA 3A82A 1ETTH 1O0DH 4THNH 3ZZ6A 4GCHF 1C5SA 3SO3A 1FI8A 1O2OA 2TPIZ 1CBWC 1YM0A 2Z9GA 4FU7A 3PTBA 2BY8X 1F92A 4ABDA 1GG6B 5JYIA 4CH2B 1HJ8A 1Z6JH 1KLTA 6LPRA 1UK2A 3V7TA 1VGCB 1O5GH 1O2PA 2VH0A 3RXAA 2VIPA 1O3KA 3Q3YA 1TNGA 3SN8A 3RU4T 4ISIH 1YF4A 3UQVA 3C27B 3T62A 1EPTC 1LVOA 4BTIB 1GHAF 1P2NA 4ISLA 1GJ6A 1HXFH 1L0ZA 1CE5A 2G5NA 4BTUB 4O9VA 1UTJA 3MFJA 1NRSH 1GMDF 1O2GH 1OPHB 1C5YB 5C20A 1DY9A 4IMQA 1SGFA 3KF2A 1BTHH 1O2NA 2OCVB 5JPMH 3RU4D 3MU5A 1NU9A 3A7XA 1DWEH 5A0CA 1IQNA 1MQ6A 4CRDA 5GCHF 3D23A 1HAIH 3OTJE 3BTWE 3RXPA 2OTVA 3KQCA 3TJOA 3SNCA 1GHBG 5FCRA 4KELA 1QRXA 3MYWA 3QLPH 1F2SE 1HJAC 4AFSA 5HGGA 1MAYA 5F6MA 4NA7A 1NFXA 3TNTA 1C2MA 5IDKA 1SGCA 3RXSA 3EA7A 1DSUA 1LPKB 1TMUH 1ZRBA 1DPOA 1C4U2 2P93A 1C2GA 3F9GA 3NKKA 3BTFE 3G01A 3UREA 1P9SA 1VJ9U 4WMEA 3BTEE 3SQHE 1YCPH 4NFFA 1HUTH 1B5GH 1SGRE 3QO6A 2VIQA 1KLJH 2ZTZA 2OBQA 3RXRA 1ZOMA 2GCHF 1HAZB 1SLXB 1D3TB 1EASA 4LK4A 4E06H 3T27A 1HB0B 1ZYOA 1ELCA 1QFKH 3ZZ8A 3BTDE 4IC6A 1XUFA 4R8TB 5F03A 1L4ZA 3ODDA 1H4WA 1PQAA 4UFFH 2XBVA 4Y76A 1AZ8A 1LHDH 1LVYA 1DICA 1BBRE 1GBCA 4TPIZ 2HNTC 2ANMH 4INLA 2GP9B 1EJAA 1GBIA 3FP8E 1O2JA 1M9UA 2WPIS 2VIOA 2BD2A 3FANA 1V3XA 1Z8RA 1LQEA 4UEHH 5BRRE 3DFJA 3RXCA 3UUZA 4OS1A 2VGCB 1FZZA 3A88A 4CRFA 2J9NA 1O2HA 1CU1A 3VGCB 1DFPA 3M5LA 1KTSB 2QY0B 2STAE 1NTPA 3BN9A 3E16B 5DP3A 1G2MA 4AN7A 1RGQA 4YM9A 4I33A 5A8ZA 3SZNA 1VITG 2BQ6B 3F68H 1GBTA 5LH8A 3TLOA 3M61U 4B75A 2STBE 2BYAX 1NFYA 3UR9A 4FU8A 4CBOA 2H2ZA 1LHFH 2WPKS 1KYNA 2ILNA 1GI9B 2BDYA 4IGDA 3A7ZA 1C1RA 1AQ7A 1KXBA 1O2QA 3LDXH 3LH3A 1O3BA 7ESTE 3GCNA 4M7GA 4TWYA 1PPEE 3CP7A 4Q2KA 3RLYH 1A0JA 2ZHEH 1N1LA 3SUGA 1WTGH 1GBHA 1L4DA 1AVGH 2ZDNA 4I8JA 4BANB 1GHBF 2BDBA 3L6PA 3SNEA 4Q7YA 1XUIA 4JZDH 6CHAC 1TNKA 1C1SA 3ZYDA 2EI6A 4RKOB 2NWNA 1L1JA 3M35A 3BTGE 1W3CA 2GZ7A 4ZKOU 2YNBA 5FAHA 1UVTH 3UIRA 2ANYA 4OS7A 2AGIX 1AB9C 1CA8B 1QIXB 1YPHC 3GICB 3U98H 5DO4H 1KXEA 1FV9A 2XCNA 1ZJDA 1Q2WA 1P9UA 1JRSA 1GG6C 3KNXA 3ZVAA 1C5TA 4A5TS 2FOMB 3GY6A 1AIXH 2V0BA 3K2UA 2CV3A 2VH6A 1TQ7B 2R2MB 3S69A 2ZGXH 1SLWB 3MO3A 1DWBH 2R3YA 2GD4B 4ZXXH 2A0QB 2VIVA 1ZTKA 4Y7AA 2F9BH 3T26A 1YKTA 1KTTB 1IQKA 1VZQH 3GYMA 1BBRK 1N6YA 1SFQB 1HYLA 3ATWA 4AYVB 2VWMA 2ZDLA 1QJ7B 2AEIH 4MTBA 3Q00A 5FX5A 2A2QH 2Y7ZA 1FPCH 2A5IA 4UFGH 4CRCA 1ZR0A 2BY7X 4BNRA 2ANKH 3RLWH 3LGTA 1AFEH 1O3MA 3VB7A 2P95A 3A81A 1HFDA 1P06A 1PQ7A 2Z9LA 1NRRH 1P2KA 3TGJE 4INHA 4X2YA 1PPBH 4UE7H 3P8OA 3LGVA 1XM1A 1ZHRA 8KME2 5EU8A 1FN8A 2PW8H 4AOQA 2FPZA 2W26A 4Y0ZE 1EAIA 1HPGA 1SHHB 1G9IE 2O8WA 1P09A 1OS8A 4B76A 4MPVA 5E2OA 3U1JB 1ARCA 2NU4E 3UWIA 5A0AE 2V3OH 1SLUB 4F49A 1GI5A 1TIOA 3PLKA 1W7GH 2CXVA 3RXJA 1GBMA 3BTME 4I8HA 3URDA 1VITF 2BZAA 4ESTE 3UR6A 1CGIE 4WH8A 1GI7B 2W3IA 2ZQ1A 3MNCA 1CHOG 3RXFA 1FIWA 4A1VA 4DIIH