3RY2A

Wild-type core streptavidin-biotin complex at atomic resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
b'EAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Streptavidin and its biotin complex at atomic resolution.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 26
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 3ry2A00
4Z27A 1LCWA 2IZDB 3T2XA 1KL5A 2RTGB 4JO6A 2GH7A 3T6LA 5L3YA 4Z2OA 2F01A 2AVIA 1VWHB 1HXLA 2IZIA 1NDJA 5JD2A 4CPEA 2Y3FA 4U46A 2IZBA 1HY2A 1SRGA 2IZGB 1DF8A 4BX5B 4CPIA 4JNJA 1RXJA 2IZCB 3RDSA 1VWGB 2UYWA 2IZAA 1KFFA 1LDOA 3VHIA 4BX6B 2QCBA 3RY1A 1MEPA 3RE6A 1NBXA 1VYOA 4Y5DA 5CSEA 4CPHA 4JHQA 1VWBB 1STRB 2OFBA 4Z2PA 1AVEA 2Y3EA 3X00A 1SWQA 1VWFB 2FHNX 2IZEB 1SRJA 2C1SA 3PK2A 3VHMA 1SRHA 1HXZA 1LUQA 3MM0A 4Z28A 2A8GA 2IZHB 1VWNB 2A5CA 4GD9A 2OF9A 2RTDB 1SWDA 5IRAA 2G5LA 3FDCA 2CAMA 1SWEA 1VWQB 1KL3A 1VWKB 3SZIA 2FHLA 1N9YA 1SLDB 2OFAA 5F2BA 3RDOA 2C4IA 2RTOB 5IRWA 2RTLA 2OF8A 4CPHB 1SWNA 1SRIA 1SLEB 4I60A 1VWLB 3VHHA 2RTQB 1SWRA 1VWPB 1VWAB 2RTPB 3T2WA 2ZSCA 2IZKA 4IRWA 4BX7B 2A5BA 1AVDA 2IZFB 1N4JA 4BX7A 1N43A 2JGSA 2C1QA 5K68A 3MG5A 4GJVA 1NC9A 1PTSA 1RSTB 4DNEA 1SWFA 2RTCB 2BC3A 1MM9A 1VWDB 3WZNA 2IZLB 1KL4A 3SZJA 1SWLA 1SREA 2RTIB 3WYPA 1LELA 1RSUB 4Z6JA 1RXKA 3RDMA 3WZQA 4GGTA 5IRUA 3RE5A 4CPFA 4GGRA 1SWJA 1Y53X 1LDQA 3WYQA 1SLFB 2RTNB 2Y32A 3EW1A 5B5GA 5B5FA 4Y59A 1SWGA 1SWPA 1VWEB 1STPA 2RTAA 2RTHB 2WPUA 1VWIB 1WBIA 3EW2A 3RDXA 1MK5A 1MOYA 3SZHA 4GGZA 1NQMA 4EKVA 1SWAA 2RTBB 3RDUA 2RTMA 3WZPA 2UZ2A 1VWJB 2RTEB 3RY2A 1NQNA 4BCSA 1SWUA 4YVBA 1SWTA 1SWSA 1N9MA 2RTJA 4BBOA 3WZOA 1Y55X 4BX5A 1SWHA 2RTRB 1I9HA 3VGWA 1SLGB 5CHKA 3RDQA 1LCZA 4OKAA 2RTFB 1LCVA 1SWBA 1SWOA 1VWRB 1RAVA 4BJ8A 2MF6A 1Y52X 1SRFA 4BX6A 4Z2VA 2IZJA 1RXHA 1VWCB 5K67A 4GDAA 1STSB 1SWCA 3T6FA 1N7YA 1HQQA 1VWOB 1SWKA 1VWMB 4GJSA 2RTKA 1IJ8A
chains in the Genus database with same CATH superfamily
1A2DA 2FKGA 3PQUA 1JYDA 2AT0X 5HA1A 4AZNA 5HWZA 1D3SA 4JO6A 2ZAIA 2OL6O 5L3YA 3FW5A 2RA6A 3OBLA 5JD2A 2HZQA 1YWAA 3F9DA 4U46A 1E2TA 2IZBA 1HY2A 3CQNA 5BVQA 1DF8A 4BX5B 3VU1A 4BGFA 2FLJA 4IB7A 2NP1A 4NYRA 4KC8A 5IXGA 4ZR2A 3U03A 4AZMA 1IW2A 1A18A 4YDAA 5FAZA 1UYNX 1HBQA 2F09A 2DM5A 3UEUA 5CSEA 4JHQA 3OJYC 1I4UA 2OFBA 4YMYA 1JJJA 3NADA 3PH6A 4MVEA 2P8GA 1VWFB 4L3RA 3SLJA 4ORXA 4ON1A 3BU9A 4NLIA 4WFVA 5FFHA 1SXWA 4IB9A 3VG6A 3CBCA 4Z28A 2A8GA 5HBSA 3KFHA 1BSQA 2A5CA 3B2JA 1XKIA 2FR3A 3ZW0B 2Q2PA 2CAMA 3BLGA 1DZMA 3WJEA 4ZHCA 2OY8A 2BS6A 4U9CA 1VWKB 4A1HA 1KXOA 1N9YA 1QABE 1SLDB 2HMBA 2I5VO 4A8ZA 3HOLA 2C4IA 1AB0A 4TKJA 2KTDA 4PJ2A 3DTQA 1I78A 4CPHB 2OF8A 4QZUA 1ZNKA 5LJKA 2X8SA 1SLEB 2FWVA 1OEKA 4I60A 3VHHA 3K3LA 1PEEA 1QY1A 1SWRA 1KT6A 5LJBA 3D9WA 2RTPB 1CBRA 2KD2A 2IZKA 4IRWA 2FTBA 3AKMA 4A60A 4BX7B 4D6BA 3WOVA 4OELA 1AVDA 4ZHDA 3P6CA 4U3QA 1SWFA 1MDCA 2RD7C 1MM9A 3NPOA 3WXQA 4O3YA 3WJCA 3WZNA 2IZLB 3SZJA 2ACPX 1SWLA 2HZRA 1U17A 2YMSA 1LELA 3GAQA 4I3DA 4Z6JA 1IFCA 3NP1A 3O2YA 4U8UO 1Y9TA 2JU7A 2POAA 3JQOA 3KFGA 4GGTA 3PQSA 4QZTA 5FQ7E 3RE5A 3ZI8A 4AZPA 5HA0A 1Y9LA 2AKQA 2QO4A 3TF6A 1EI5A 4ALOA 2MJIA 4GUZA 4IBAA 1WBIA 1E06A 3MBTA 4YGGA 5HCCC 4HWMA 1ADLA 4I9SA 4ES7A 3WZPA 3EYCA 1SA8A 1FE3A 5HTEA 2UZ2A 4O4UA 2Z4HA 4XMGA 1GKAB 1X8OA 1NQNA 3E3CA 2EU7X 1BRPA 4TKHA 1LIDA 2OVDA 1FTPA 3BY0A 3FENA 3WZOA 1WUBA 1FENA 1OBUA 4IB6A 4U8UN 2X46A 4BBOA 5H9NA 1W5RA 4BX5A 1SLGB 4CDDA 2FKJA 1TOWA 1IKEA 2JN3A 3IA8A 2OY5O 4ODDA 3ELXA 5K06A 3TZSA 5DG4A 4ARHA 2BSZA 5LJGA 3LTWA 5HCEC 1FJ1E 5LKFA 5D45A 1YWBA 1GT1A 1SY2A 4I3CA 4GRJA 4EXZA 1AELA 5D4AA 2O62A 3FLLA 3ZW2A 1STSB 1SWCA 1O8VA 2Q39A 3AKNA 3EBWA 5FQ6E 5C0NA 1EALA 4OS8A 2CBSA 4GJSA 2FRSA 4DQ4A 1H91A 1X8PA 1IJ8A 3BU1A 1EXSA 4ZH9A 4Z27A 3T2XA 1QY2A 4TNNA 4YFPA 4CDFA 3T6LA 2FS7A 1S44A 4EEJA 1BLRA 1AQBA 2W2FA 2AVIA 3BRNA 1HXLA 2IZIA 1HMTA 2GTFX 3KFFA 3P6GA 4L1NA 2Y3FA 4IABA 3ZW0A 4JGLA 1YWCA 3H3IA 5IO5A 2L5PA 2VFBA 2X8FA 4GK9A 1UREA 4O49A 2IZAA 1KFFA 2CM4A 3RY1A 2VDFA 2LFOA 3RE6A 1VYOA 3P6EA 4Y5DA 4CPHA 1JJXA 1LPJA 1VWBB 1HN2A 1P6PA 1STRB 3MVFA 1AVEA 4O3WA 4ZH6A 1ICMA 3SAOA 1SWQA 3X00A 2PI3O 2YG2A 3FA7A 1LIEA 3NQ9A 4ORYA 2W2BA 3UEWA 4D6AA 3EC5A 2AH7X 3MM0A 3STNA 5HZ6A 1XCAA 1GGLA 2K23A 5F6BA 2R73A 1PBYA 2OF9A 5EEDA 3FELA 1SWDA 5LJCA 2NNDA 3F8AA 2G5LA 2OY7A 3VG4A 1BSOA 1DV9A 1OSPO 1DC9A 1KL3A 3D96A 3SZIA 3U9PC 2DJFA 2FHLA 3ZUIA 2A13A 3C78X 2AT6X 4WHIA 3CKFA 4QQ1A 3CQRA 5F2BA 3RDOA 3HK1A 2QMIA 3P02A 5DPQA 1DZPA 1KT5A 2X45A 3NX1A 5HTDA 4QGVA 4XMDA 1OBPA 1X89A 1MX8A 1SRIA 5L8IA 2AMMX 1QY0A 1VWPB 1RBPA 4M7MA 3I0AA 1VWAB 4BVMA 5B11O 2OYBO 3ZWEA 2A5BA 2ASNX 5IO6A 3APXA 1EQDA 3WBGA 1TXLA 2JGSA 3HWDA 3KQ0A 4GJVA 3WJGA 4DNEA 4GH7A 5LJHA 1KZXA 1GKAA 2A2UA 2RTCB 5FQ8E 1B4MA 4IAXA 2BS5A 1B8EA 2JU8A 1KL4A 2NNEA 5B29A 3WYPA 3APUA 5B2AO 3NQ3A 2X55A 3HOEA 3B2LA 5IRUA 1EPBA 3MX7A 3S5VA 4O4OA 4QRLA 1SLFB 3EW1A 1G5WA 1JQPA 1ZNGA 1OEEA 2X56A 4Y59A 3NR3A 1SWPA 1LICA 1U0XA 4HPBA 2R56A 3EW2A 4Y0PA 1MOYA 3F6ZB 4GGZA 1NQMA 4YCHA 2RTBB 1FEMA 4M6SA 2Q9SA 2N93A 2M4LA 2RTEB 3JSQA 3L4RA 2DJGA 1RLBE 4O4XA 2CM9A 3RY2A 3RZYA 1ZNDA 1QG5A 1EIIA 2QO5A 3WJDA 2OZQA 4FQBB 2MO5A 1LIFA 2WEWA 2WSJA 4GKCA 2MHDA 1SWHA 1GM6A 3RDQA 1LFOA 1PBOA 1LCZA 1YP7A 2RTFB 1K24A 3PEDA 4R0BA 5H9LA 4NNSA 1B0OA 1IFBA 4EQAC 1SRFA 5L8OA 3C77X 4Z2VA 4YBUA 5AEOA 1HBPA 1T0VA 1RXHA 5HZ5A 4GZVA 2GTLM 4GDAA 4HFOA 4NV8A 5K67A 4ORRA 4N7CA 2Q4NA 1GT5A 1EW3A 5F6ZA 1VWMB 4AZQA 2RTKA 5KICA 1ACDA 1LCWA 2IZDB 2LKKA 5B10O 1KL5A 2OFMX 1SXXA 1LNMA 4MIRA 3RBYA 2E4JA 3B2IA 4BOEA 2GH7A 3N91A 4QGWA 2AL0X 3P6HA 5AJCA 1BM5A 2FS6A 1JJUA 2F01A 3ZQ3A 1QFTA 4FGIB 3PH5A 1EPAA 1R0UA 1KQWA 1I05A 1Y0GA 4MEEA 4GDZA 4RUUA 1SRGA 3U0DA 4JNJA 1RXJA 1GT3A 3TGAA 4ZHGA 1VWGB 4IMNA 3AUMO 3ZZVA 2JOZA 4NNTA 4NLJA 2CZTA 3VHIA 4BX6B 1JZUA 1NBXA 2RQ0A 5CYBA 1FELA 4LZUA 2LBVA 5BVTA 1OPAA 4FBRA 4Z2PA 3PECA 1K3BA 2Y3EA 4TQ2A 2IZEB 3B2HA 5HAEA 3PK2A 2OL8O 4YFQA 3VHMA 3VG3A 1VYGA 3S5XA 1MUPA 2G79A 4ZJ0A 1KT7A 1LUQA 3VG7A 1HMRA 1G85A 1TOUA 2IZHB 1VWNB 2OFRX 3VG2A 3S60A 4GD9A 5BYPA 5IRAA 3APVA 1BSYA 1E00A 1JMXA 3CBSA 3FR2A 2A0AA 4RUNA 1SWEA 2AT5X 2HKDA 1VWQB 2RN4A 2ANSA 2BLGA 4GNWA 4YH0A 4LKTA 1N0SA 4BQUA 1SMPI 1KQXA 1LF7A 2WEXA 3FR4A 3I17A 2RTOB 5B27A 5IRWA 5CE4A 5D47A 2RTLA 2L67A 3FIDA 3OD9A 4TKBA 4K19A 4ZGFA 1ZNLA 2X32A 1VWLB 3KFIA 4CDCA 2RTQB 1SXUA 5EDBA 3T2WA 2K62A 2QM9A 3D97A 2F73A 2KTSA 5HZQA 1GX9A 2RCQA 3APWA 1N4JA 4BX7A 1AVGI 2Q2MA 3VE2A 4C5PA 2C1QA 5K68A 4YKOA 1NC9A 1O1VA 3PDFA 2BC3A 3GE2A 2G8CO 5D48A 1NP4A 4ZCBA 4FBOA 5JR8A 1S7DA 1SREA 2AF5A 2MM3A 3UEVA 1RXKA 4ZGUA 3RDMA 2VFCA 4AZOA 3OE3A 1G74A 1KT4A 2KW1A 2X4MA 2KT4B 1SWJA 3B2KA 3BX8A 1OBQA 1LDQA 3EMMA 1KGLA 1PM1X 1ERXA 2G7BA 1EUOA 2Y32A 4KC7A 2QO6A 5B5GA 4O3ZA 1NP1A 1T8VA 3STMX 2AT3X 4QGXA 3CWKA 1VWEB 1SWGA 2RTAA 1G7NA 1STPA 2RTHB 2WPUA 4I3BA 4ORSA 4B55A 2CZUA 1MK5A 3RSWA 2AT8X 4YFRA 1EIOA 1JV4A 1Z24A 3FA6A 3RDUA 4EKVA 3TGCA 4ZHHA 4NW4A 3WJBA 1VWJB 4YGZA 4IMOA 1I04A 1YP6A 1SXYA 2FT9A 2LA7A 1DFVA 1SY0A 3BDRA 3CR6A 3KZAA 4YGHA 3S26A 3ZW1B 4IAWA 1SWSA 1MX7A 1X8NA 1KT3A 1X71A 2RTJA 4QYNA 4AYHA 2RTRB 4CV7A 1I9HA 3VGWA 5CHKA 4ID2A 1OEJA 4OS3A 3P24A 1SWBA 4ML7B 1RAVA 4BJ8A 3SOTA 4HPCA 2JW1A 5B3MO 3IFBA 4BX6A 1CBQA 2IZJA 4XMHA 3ZUOA 1VWCB 4QNIA 5KIDA 1JBHA 1CJ5A 4AW8A 1N7YA 2BT9A 2LB6A 3BX7A 1O1UA 3KVNA 4GETA 4HPAA 1UYOX 4U8UM 4XMEA 3FEPA 2WR6A 2RTGB 1JMZA 1SY1A 1IIUA 3P6FA 4Z2OA 5HZ9A 5BVSA 2JU3A 4GE1A 3VE1A 1VWHB 1NDJA 4YKMA 1DZJA 1TW4A 2X34A 5F1EA 4CPEA 4DCBA 1HMSA 3QQ2A 3VG5A 2HYSA 2IZGB 4ZHFA 1CRBA 2G78A 3O19A 4CPIA 5IO7A 2IZCB 4Y0SA 5F58A 3RDSA 5H9KA 2UYWA 4TLJA 3RKGA 4GNYA 4KH8A 3BS2A 1LDOA 1ERBA 4CSBA 2QCBA 1X8UA 1MEPA 4O4SA 2FGSA 2MWHA 1QQSA 1W6FA 4I95A 4NYQA 1YUPA 1ZNEA 2W2AA 1BWYA 3T1DA 4KT5A 3FR5A 4QAEA 2FHNX 2HNXA 4YBPA 1SRJA 2C1SA 1FDQA 2LBAA 5AQ6A 4DQ3A 1SRHA 4N7DA 2JMBA 4ORUA 1HXZA 3D4RA 2QOMA 3FA9A 1JYJA 3FW4A 4MVIA 3O22A 4I9RA 2RTDB 3PPTA 1U18A 1YWDA 3C76X 2GJ5A 1BJ7A 3FDCA 1NGLA 2OL7A 4GU8A 3UEXA 2GC9A 5AJBA 3FIQA 4UU2A 2OY1O 4NV7A 4OMWA 1IKJA 5EDCA 3DSZA 3FEKA 2OFAA 1S2PA 3HWFA 3EBKA 3P6DA 3WJFA 5KHPA 1VYFA 4OEMA 2OVAA 4WFUA 5EZ2A 3SLOA 4COTA 2Z4IA 4O3XB 1KZWA 3CMPA 2I5ZO 1SWNA 5F7GA 1D2UA 3LHNA 4MISA 4AZRA 4Y0QA 1ZNHA 4UU3A 4ZFXA 2ZSCA 1ALBA 1GX3A 1ML7A 1SY3A 2WQAE 4EFGA 1MVGA 1X8QA 1KOIA 2IZFB 1A3YA 3HWGA 4FBVA 1UZ2X 1JIWI 4O9SA 1N43A 1T68X 4MVKA 4XMCA 2XSTA 3MG5A 3WVMA 1PTSA 1RSTB 5LKEA 3ZW1A 2OVEA 1VWDB 3UAQA 4QYPA 4EDEA 1GT4A 2RTIB 2GTLO 3BSZE 4LZVA 1RSUB 4PSQA 2QOSC 3AEHA 2L68A 3ELZA 3NBXX 3PP6A 1BEBA 5EPQA 3V8UA 4A1YA 3FMZA 1I06A 2ACOA 2IFBA 1CBIA 1ZRYA 2PY1A 3QKGA 1OPBA 4YCEA 3WZQA 4LQZA 3RWXA 1HQPA 2A3FX 4GGRA 5H8TA 1Y53X 1BBPA 4IB8A 1E02A 4CPFA 1A57A 3WYQA 2RTNB 3VPJE 1W4TA 3D95A 4ORWA 5B5FA 1VPRA 1PMPA 4I6SA 2OVSA 1QWDA 3NQKA 3JS1A 1B56A 1LKEA 2X8TA 3Q6LA 3RDXA 1VWIB 4OMXA 5H9AA 3SZHA 2BHVA 1E5PA 2RCTA 1TVQA 2R74A 1SWAA 1LIBA 2FR2A 2RTMA 2CBRA 5LJDA 4CDEA 5L8NA 3G7XA 5D8JA 4Y0RA 3TGBA 1DF3A 1GXAA 1QFVA 4CK4A 2L9CA 2NNQA 4LKPA 4WBKA 2XKLA 4TJZA 1GX8A 2GTLN 4BCSA 1SWUA 4YVBA 1SWTA 3Q34A 1N9MA 4ALBA 1Y55X 3HPEA 2WQ9A 3SLTA 4OS0A 4OKAA 1BRQA 4KCAA 1LCVA 2HLVA 1ICNA 5LJEA 1SWOA 1VWRB 2A2GA 2WWPA 2ZAGA 4XMFA 2MF6A 3FYFA 1Y52X 3LV4A 4MVLA 4HPDA 3EM0A 3FA8A 4NP1A 5EEEA 1YIVA 3HTYA 3NX2A 2ALLX 1L6MA 2WUTA 3CKGA 4YDBA 3HWEA 3STKA 5FENA 5HZ8A 5HCDC 3T6FA 1HQQA 1DZKA 1VWOB 4INNA 4KIIA 1SWKA 1CBSA
chains in the Genus database with same CATH topology
4Z27A 1LCWA 2IZDB 3T2XA 1KL5A 2RTGB 4JO6A 2GH7A 3T6LA 5L3YA 4Z2OA 2F01A 2AVIA 1VWHB 1HXLA 2IZIA 1NDJA 5JD2A 4CPEA 2Y3FA 4U46A 2IZBA 1HY2A 1SRGA 2IZGB 1DF8A 4BX5B 4CPIA 4JNJA 1RXJA 2IZCB 3RDSA 1VWGB 2UYWA 2IZAA 1KFFA 1LDOA 3VHIA 4BX6B 2QCBA 3RY1A 1MEPA 3RE6A 1NBXA 1VYOA 4Y5DA 5CSEA 4CPHA 4JHQA 1VWBB 1STRB 2OFBA 4Z2PA 1AVEA 2Y3EA 3X00A 1SWQA 1VWFB 2FHNX 2IZEB 1SRJA 2C1SA 3PK2A 3VHMA 1SRHA 1HXZA 1LUQA 3MM0A 4Z28A 2A8GA 2IZHB 1VWNB 2A5CA 4GD9A 2OF9A 2RTDB 1SWDA 5IRAA 2G5LA 3FDCA 2CAMA 1SWEA 1VWQB 1KL3A 1VWKB 3SZIA 2FHLA 1N9YA 1SLDB 2OFAA 5F2BA 3RDOA 2C4IA 2RTOB 5IRWA 2RTLA 2OF8A 4CPHB 1SWNA 1SRIA 1SLEB 4I60A 1VWLB 3VHHA 2RTQB 1SWRA 1VWPB 1VWAB 2RTPB 3T2WA 2ZSCA 2IZKA 4IRWA 4BX7B 2A5BA 1AVDA 2IZFB 1N4JA 4BX7A 1N43A 2JGSA 2C1QA 5K68A 3MG5A 4GJVA 1NC9A 1PTSA 1RSTB 4DNEA 1SWFA 2RTCB 2BC3A 1MM9A 1VWDB 3WZNA 2IZLB 1KL4A 3SZJA 1SWLA 1SREA 2RTIB 3WYPA 1LELA 1RSUB 4Z6JA 1RXKA 3RDMA 3WZQA 4GGTA 5IRUA 3RE5A 4CPFA 4GGRA 1SWJA 1Y53X 1LDQA 3WYQA 1SLFB 2RTNB 2Y32A 3EW1A 5B5GA 5B5FA 4Y59A 1SWGA 1SWPA 1VWEB 1STPA 2RTAA 2RTHB 2WPUA 1VWIB 1WBIA 3EW2A 3RDXA 1MK5A 1MOYA 3SZHA 4GGZA 1NQMA 4EKVA 1SWAA 2RTBB 3RDUA 2RTMA 3WZPA 2UZ2A 1VWJB 2RTEB 3RY2A 1NQNA 4BCSA 1SWUA 4YVBA 1SWTA 1SWSA 1N9MA 2RTJA 4BBOA 3WZOA 1Y55X 4BX5A 1SWHA 2RTRB 1I9HA 3VGWA 1SLGB 5CHKA 3RDQA 1LCZA 4OKAA 2RTFB 1LCVA 1SWBA 1SWOA 1VWRB 1RAVA 4BJ8A 2MF6A 1Y52X 1SRFA 4BX6A 4Z2VA 2IZJA 1RXHA 1VWCB 5K67A 4GDAA 1STSB 1SWCA 3T6FA 1N7YA 1HQQA 1VWOB 1SWKA 1VWMB 4GJSA 2RTKA 1IJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z27 A;  1LCW A;  2IZD B;  3T2X A;  1KL5 A;  2RTG B;  4JO6 A;  2GH7 A;  3T6L A;  5L3Y A;  4Z2O A;  2F01 A;  2AVI A;  1VWH B;  1HXL A;  2IZI A;  1NDJ A;  5JD2 A;  4CPE A;  2Y3F A;  4U46 A;  2IZB A;  1HY2 A;  1SRG A;  2IZG B;  1DF8 A;  4BX5 B;  4CPI A;  4JNJ A;  1RXJ A;  2IZC B;  3RDS A;  1VWG B;  2UYW A;  2IZA A;  1KFF A;  1LDO A;  3VHI A;  4BX6 B;  2QCB A;  3RY1 A;  1MEP A;  3RE6 A;  1NBX A;  1VYO A;  4Y5D A;  5CSE A;  4CPH A;  4JHQ A;  1VWB B;  1STR B;  2OFB A;  4Z2P A;  1AVE A;  2Y3E A;  3X00 A;  1SWQ A;  1VWF B;  2FHN X;  2IZE B;  1SRJ A;  2C1S A;  3PK2 A;  3VHM A;  1SRH A;  1HXZ A;  1LUQ A;  3MM0 A;  4Z28 A;  2A8G A;  2IZH B;  1VWN B;  2A5C A;  4GD9 A;  2OF9 A;  2RTD B;  1SWD A;  5IRA A;  2G5L A;  3FDC A;  2CAM A;  1SWE A;  1VWQ B;  1KL3 A;  1VWK B;  3SZI A;  2FHL A;  1N9Y A;  1SLD B;  2OFA A;  5F2B A;  3RDO A;  2C4I A;  2RTO B;  5IRW A;  2RTL A;  2OF8 A;  4CPH B;  1SWN A;  1SRI A;  1SLE B;  4I60 A;  1VWL B;  3VHH A;  2RTQ B;  1SWR A;  1VWP B;  1VWA B;  2RTP B;  3T2W A;  2ZSC A;  2IZK A;  4IRW A;  4BX7 B;  2A5B A;  1AVD A;  2IZF B;  1N4J A;  4BX7 A;  1N43 A;  2JGS A;  2C1Q A;  5K68 A;  3MG5 A;  4GJV A;  1NC9 A;  1PTS A;  1RST B;  4DNE A;  1SWF A;  2RTC B;  2BC3 A;  1MM9 A;  1VWD B;  3WZN A;  2IZL B;  1KL4 A;  3SZJ A;  1SWL A;  1SRE A;  2RTI B;  3WYP A;  1LEL A;  1RSU B;  4Z6J A;  1RXK A;  3RDM A;  3WZQ A;  4GGT A;  5IRU A;  3RE5 A;  4CPF A;  4GGR A;  1SWJ A;  1Y53 X;  1LDQ A;  3WYQ A;  1SLF B;  2RTN B;  2Y32 A;  3EW1 A;  5B5G A;  5B5F A;  4Y59 A;  1SWG A;  1SWP A;  1VWE B;  1STP A;  2RTA A;  2RTH B;  2WPU A;  1VWI B;  1WBI A;  3EW2 A;  3RDX A;  1MK5 A;  1MOY A;  3SZH A;  4GGZ A;  1NQM A;  4EKV A;  1SWA A;  2RTB B;  3RDU A;  2RTM A;  3WZP A;  2UZ2 A;  1VWJ B;  2RTE B;  3RY2 A;  1NQN A;  4BCS A;  1SWU A;  4YVB A;  1SWT A;  1SWS A;  1N9M A;  2RTJ A;  4BBO A;  3WZO A;  1Y55 X;  4BX5 A;  1SWH A;  2RTR B;  1I9H A;  3VGW A;  1SLG B;  5CHK A;  3RDQ A;  1LCZ A;  4OKA A;  2RTF B;  1LCV A;  1SWB A;  1SWO A;  1VWR B;  1RAV A;  4BJ8 A;  2MF6 A;  1Y52 X;  1SRF A;  4BX6 A;  4Z2V A;  2IZJ A;  1RXH A;  1VWC B;  5K67 A;  4GDA A;  1STS B;  1SWC A;  3T6F A;  1N7Y A;  1HQQ A;  1VWO B;  1SWK A;  1VWM B;  4GJS A;  2RTK A;  1IJ8 A; 
#chains in the Genus database with same CATH topology
 1A2D A;  2FKG A;  3PQU A;  1JYD A;  2AT0 X;  5HA1 A;  4AZN A;  5HWZ A;  1D3S A;  4JO6 A;  2ZAI A;  2OL6 O;  5L3Y A;  3FW5 A;  2RA6 A;  3OBL A;  5JD2 A;  2HZQ A;  1YWA A;  3F9D A;  4U46 A;  1E2T A;  2IZB A;  1HY2 A;  3CQN A;  5BVQ A;  1DF8 A;  4BX5 B;  3VU1 A;  4BGF A;  2FLJ A;  4IB7 A;  2NP1 A;  4NYR A;  4KC8 A;  5IXG A;  4ZR2 A;  3U03 A;  4AZM A;  1IW2 A;  1A18 A;  4YDA A;  5FAZ A;  1UYN X;  1HBQ A;  2F09 A;  2DM5 A;  3UEU A;  5CSE A;  4JHQ A;  3OJY C;  1I4U A;  2OFB A;  4YMY A;  1JJJ A;  3NAD A;  3PH6 A;  4MVE A;  2P8G A;  1VWF B;  4L3R A;  3SLJ A;  4ORX A;  4ON1 A;  3BU9 A;  4NLI A;  4WFV A;  5FFH A;  1SXW A;  4IB9 A;  3VG6 A;  3CBC A;  4Z28 A;  2A8G A;  5HBS A;  3KFH A;  1BSQ A;  2A5C A;  3B2J A;  1XKI A;  2FR3 A;  3ZW0 B;  2Q2P A;  2CAM A;  3BLG A;  1DZM A;  3WJE A;  4ZHC A;  2OY8 A;  2BS6 A;  4U9C A;  1VWK B;  4A1H A;  1KXO A;  1N9Y A;  1QAB E;  1SLD B;  2HMB A;  2I5V O;  4A8Z A;  3HOL A;  2C4I A;  1AB0 A;  4TKJ A;  2KTD A;  4PJ2 A;  3DTQ A;  1I78 A;  4CPH B;  2OF8 A;  4QZU A;  1ZNK A;  5LJK A;  2X8S A;  1SLE B;  2FWV A;  1OEK A;  4I60 A;  3VHH A;  3K3L A;  1PEE A;  1QY1 A;  1SWR A;  1KT6 A;  5LJB A;  3D9W A;  2RTP B;  1CBR A;  2KD2 A;  2IZK A;  4IRW A;  2FTB A;  3AKM A;  4A60 A;  4BX7 B;  4D6B A;  3WOV A;  4OEL A;  1AVD A;  4ZHD A;  3P6C A;  4U3Q A;  1SWF A;  1MDC A;  2RD7 C;  1MM9 A;  3NPO A;  3WXQ A;  4O3Y A;  3WJC A;  3WZN A;  2IZL B;  3SZJ A;  2ACP X;  1SWL A;  2HZR A;  1U17 A;  2YMS A;  1LEL A;  3GAQ A;  4I3D A;  4Z6J A;  1IFC A;  3NP1 A;  3O2Y A;  4U8U O;  1Y9T A;  2JU7 A;  2POA A;  3JQO A;  3KFG A;  4GGT A;  3PQS A;  4QZT A;  5FQ7 E;  3RE5 A;  3ZI8 A;  4AZP A;  5HA0 A;  1Y9L A;  2AKQ A;  2QO4 A;  3TF6 A;  1EI5 A;  4ALO A;  2MJI A;  4GUZ A;  4IBA A;  1WBI A;  1E06 A;  3MBT A;  4YGG A;  5HCC C;  4HWM A;  1ADL A;  4I9S A;  4ES7 A;  3WZP A;  3EYC A;  1SA8 A;  1FE3 A;  5HTE A;  2UZ2 A;  4O4U A;  2Z4H A;  4XMG A;  1GKA B;  1X8O A;  1NQN A;  3E3C A;  2EU7 X;  1BRP A;  4TKH A;  1LID A;  2OVD A;  1FTP A;  3BY0 A;  3FEN A;  3WZO A;  1WUB A;  1FEN A;  1OBU A;  4IB6 A;  4U8U N;  2X46 A;  4BBO A;  5H9N A;  1W5R A;  4BX5 A;  1SLG B;  4CDD A;  2FKJ A;  1TOW A;  1IKE A;  2JN3 A;  3IA8 A;  2OY5 O;  4ODD A;  3ELX A;  5K06 A;  3TZS A;  5DG4 A;  4ARH A;  2BSZ A;  5LJG A;  3LTW A;  5HCE C;  1FJ1 E;  5LKF A;  5D45 A;  1YWB A;  1GT1 A;  1SY2 A;  4I3C A;  4GRJ A;  4EXZ A;  1AEL A;  5D4A A;  2O62 A;  3FLL A;  3ZW2 A;  1STS B;  1SWC A;  1O8V A;  2Q39 A;  3AKN A;  3EBW A;  5FQ6 E;  5C0N A;  1EAL A;  4OS8 A;  2CBS A;  4GJS A;  2FRS A;  4DQ4 A;  1H91 A;  1X8P A;  1IJ8 A;  3BU1 A;  1EXS A;  4ZH9 A;  4Z27 A;  3T2X A;  1QY2 A;  4TNN A;  4YFP A;  4CDF A;  3T6L A;  2FS7 A;  1S44 A;  4EEJ A;  1BLR A;  1AQB A;  2W2F A;  2AVI A;  3BRN A;  1HXL A;  2IZI A;  1HMT A;  2GTF X;  3KFF A;  3P6G A;  4L1N A;  2Y3F A;  4IAB A;  3ZW0 A;  4JGL A;  1YWC A;  3H3I A;  5IO5 A;  2L5P A;  2VFB A;  2X8F A;  4GK9 A;  1URE A;  4O49 A;  2IZA A;  1KFF A;  2CM4 A;  3RY1 A;  2VDF A;  2LFO A;  3RE6 A;  1VYO A;  3P6E A;  4Y5D A;  4CPH A;  1JJX A;  1LPJ A;  1VWB B;  1HN2 A;  1P6P A;  1STR B;  3MVF A;  1AVE A;  4O3W A;  4ZH6 A;  1ICM A;  3SAO A;  1SWQ A;  3X00 A;  2PI3 O;  2YG2 A;  3FA7 A;  1LIE A;  3NQ9 A;  4ORY A;  2W2B A;  3UEW A;  4D6A A;  3EC5 A;  2AH7 X;  3MM0 A;  3STN A;  5HZ6 A;  1XCA A;  1GGL A;  2K23 A;  5F6B A;  2R73 A;  1PBY A;  2OF9 A;  5EED A;  3FEL A;  1SWD A;  5LJC A;  2NND A;  3F8A A;  2G5L A;  2OY7 A;  3VG4 A;  1BSO A;  1DV9 A;  1OSP O;  1DC9 A;  1KL3 A;  3D96 A;  3SZI A;  3U9P C;  2DJF A;  2FHL A;  3ZUI A;  2A13 A;  3C78 X;  2AT6 X;  4WHI A;  3CKF A;  4QQ1 A;  3CQR A;  5F2B A;  3RDO A;  3HK1 A;  2QMI A;  3P02 A;  5DPQ A;  1DZP A;  1KT5 A;  2X45 A;  3NX1 A;  5HTD A;  4QGV A;  4XMD A;  1OBP A;  1X89 A;  1MX8 A;  1SRI A;  5L8I A;  2AMM X;  1QY0 A;  1VWP B;  1RBP A;  4M7M A;  3I0A A;  1VWA B;  4BVM A;  5B11 O;  2OYB O;  3ZWE A;  2A5B A;  2ASN X;  5IO6 A;  3APX A;  1EQD A;  3WBG A;  1TXL A;  2JGS A;  3HWD A;  3KQ0 A;  4GJV A;  3WJG A;  4DNE A;  4GH7 A;  5LJH A;  1KZX A;  1GKA A;  2A2U A;  2RTC B;  5FQ8 E;  1B4M A;  4IAX A;  2BS5 A;  1B8E A;  2JU8 A;  1KL4 A;  2NNE A;  5B29 A;  3WYP A;  3APU A;  5B2A O;  3NQ3 A;  2X55 A;  3HOE A;  3B2L A;  5IRU A;  1EPB A;  3MX7 A;  3S5V A;  4O4O A;  4QRL A;  1SLF B;  3EW1 A;  1G5W A;  1JQP A;  1ZNG A;  1OEE A;  2X56 A;  4Y59 A;  3NR3 A;  1SWP A;  1LIC A;  1U0X A;  4HPB A;  2R56 A;  3EW2 A;  4Y0P A;  1MOY A;  3F6Z B;  4GGZ A;  1NQM A;  4YCH A;  2RTB B;  1FEM A;  4M6S A;  2Q9S A;  2N93 A;  2M4L A;  2RTE B;  3JSQ A;  3L4R A;  2DJG A;  1RLB E;  4O4X A;  2CM9 A;  3RY2 A;  3RZY A;  1ZND A;  1QG5 A;  1EII A;  2QO5 A;  3WJD A;  2OZQ A;  4FQB B;  2MO5 A;  1LIF A;  2WEW A;  2WSJ A;  4GKC A;  2MHD A;  1SWH A;  1GM6 A;  3RDQ A;  1LFO A;  1PBO A;  1LCZ A;  1YP7 A;  2RTF B;  1K24 A;  3PED A;  4R0B A;  5H9L A;  4NNS A;  1B0O A;  1IFB A;  4EQA C;  1SRF A;  5L8O A;  3C77 X;  4Z2V A;  4YBU A;  5AEO A;  1HBP A;  1T0V A;  1RXH A;  5HZ5 A;  4GZV A;  2GTL M;  4GDA A;  4HFO A;  4NV8 A;  5K67 A;  4ORR A;  4N7C A;  2Q4N A;  1GT5 A;  1EW3 A;  5F6Z A;  1VWM B;  4AZQ A;  2RTK A;  5KIC A;  1ACD A;  1LCW A;  2IZD B;  2LKK A;  5B10 O;  1KL5 A;  2OFM X;  1SXX A;  1LNM A;  4MIR A;  3RBY A;  2E4J A;  3B2I A;  4BOE A;  2GH7 A;  3N91 A;  4QGW A;  2AL0 X;  3P6H A;  5AJC A;  1BM5 A;  2FS6 A;  1JJU A;  2F01 A;  3ZQ3 A;  1QFT A;  4FGI B;  3PH5 A;  1EPA A;  1R0U A;  1KQW A;  1I05 A;  1Y0G A;  4MEE A;  4GDZ A;  4RUU A;  1SRG A;  3U0D A;  4JNJ A;  1RXJ A;  1GT3 A;  3TGA A;  4ZHG A;  1VWG B;  4IMN A;  3AUM O;  3ZZV A;  2JOZ A;  4NNT A;  4NLJ A;  2CZT A;  3VHI A;  4BX6 B;  1JZU A;  1NBX A;  2RQ0 A;  5CYB A;  1FEL A;  4LZU A;  2LBV A;  5BVT A;  1OPA A;  4FBR A;  4Z2P A;  3PEC A;  1K3B A;  2Y3E A;  4TQ2 A;  2IZE B;  3B2H A;  5HAE A;  3PK2 A;  2OL8 O;  4YFQ A;  3VHM A;  3VG3 A;  1VYG A;  3S5X A;  1MUP A;  2G79 A;  4ZJ0 A;  1KT7 A;  1LUQ A;  3VG7 A;  1HMR A;  1G85 A;  1TOU A;  2IZH B;  1VWN B;  2OFR X;  3VG2 A;  3S60 A;  4GD9 A;  5BYP A;  5IRA A;  3APV A;  1BSY A;  1E00 A;  1JMX A;  3CBS A;  3FR2 A;  2A0A A;  4RUN A;  1SWE A;  2AT5 X;  2HKD A;  1VWQ B;  2RN4 A;  2ANS A;  2BLG A;  4GNW A;  4YH0 A;  4LKT A;  1N0S A;  4BQU A;  1SMP I;  1KQX A;  1LF7 A;  2WEX A;  3FR4 A;  3I17 A;  2RTO B;  5B27 A;  5IRW A;  5CE4 A;  5D47 A;  2RTL A;  2L67 A;  3FID A;  3OD9 A;  4TKB A;  4K19 A;  4ZGF A;  1ZNL A;  2X32 A;  1VWL B;  3KFI A;  4CDC A;  2RTQ B;  1SXU A;  5EDB A;  3T2W A;  2K62 A;  2QM9 A;  3D97 A;  2F73 A;  2KTS A;  5HZQ A;  1GX9 A;  2RCQ A;  3APW A;  1N4J A;  4BX7 A;  1AVG I;  2Q2M A;  3VE2 A;  4C5P A;  2C1Q A;  5K68 A;  4YKO A;  1NC9 A;  1O1V A;  3PDF A;  2BC3 A;  3GE2 A;  2G8C O;  5D48 A;  1NP4 A;  4ZCB A;  4FBO A;  5JR8 A;  1S7D A;  1SRE A;  2AF5 A;  2MM3 A;  3UEV A;  1RXK A;  4ZGU A;  3RDM A;  2VFC A;  4AZO A;  3OE3 A;  1G74 A;  1KT4 A;  2KW1 A;  2X4M A;  2KT4 B;  1SWJ A;  3B2K A;  3BX8 A;  1OBQ A;  1LDQ A;  3EMM A;  1KGL A;  1PM1 X;  1ERX A;  2G7B A;  1EUO A;  2Y32 A;  4KC7 A;  2QO6 A;  5B5G A;  4O3Z A;  1NP1 A;  1T8V A;  3STM X;  2AT3 X;  4QGX A;  3CWK A;  1VWE B;  1SWG A;  2RTA A;  1G7N A;  1STP A;  2RTH B;  2WPU A;  4I3B A;  4ORS A;  4B55 A;  2CZU A;  1MK5 A;  3RSW A;  2AT8 X;  4YFR A;  1EIO A;  1JV4 A;  1Z24 A;  3FA6 A;  3RDU A;  4EKV A;  3TGC A;  4ZHH A;  4NW4 A;  3WJB A;  1VWJ B;  4YGZ A;  4IMO A;  1I04 A;  1YP6 A;  1SXY A;  2FT9 A;  2LA7 A;  1DFV A;  1SY0 A;  3BDR A;  3CR6 A;  3KZA A;  4YGH A;  3S26 A;  3ZW1 B;  4IAW A;  1SWS A;  1MX7 A;  1X8N A;  1KT3 A;  1X71 A;  2RTJ A;  4QYN A;  4AYH A;  2RTR B;  4CV7 A;  1I9H A;  3VGW A;  5CHK A;  4ID2 A;  1OEJ A;  4OS3 A;  3P24 A;  1SWB A;  4ML7 B;  1RAV A;  4BJ8 A;  3SOT A;  4HPC A;  2JW1 A;  5B3M O;  3IFB A;  4BX6 A;  1CBQ A;  2IZJ A;  4XMH A;  3ZUO A;  1VWC B;  4QNI A;  5KID A;  1JBH A;  1CJ5 A;  4AW8 A;  1N7Y A;  2BT9 A;  2LB6 A;  3BX7 A;  1O1U A;  3KVN A;  4GET A;  4HPA A;  1UYO X;  4U8U M;  4XME A;  3FEP A;  2WR6 A;  2RTG B;  1JMZ A;  1SY1 A;  1IIU A;  3P6F A;  4Z2O A;  5HZ9 A;  5BVS A;  2JU3 A;  4GE1 A;  3VE1 A;  1VWH B;  1NDJ A;  4YKM A;  1DZJ A;  1TW4 A;  2X34 A;  5F1E A;  4CPE A;  4DCB A;  1HMS A;  3QQ2 A;  3VG5 A;  2HYS A;  2IZG B;  4ZHF A;  1CRB A;  2G78 A;  3O19 A;  4CPI A;  5IO7 A;  2IZC B;  4Y0S A;  5F58 A;  3RDS A;  5H9K A;  2UYW A;  4TLJ A;  3RKG A;  4GNY A;  4KH8 A;  3BS2 A;  1LDO A;  1ERB A;  4CSB A;  2QCB A;  1X8U A;  1MEP A;  4O4S A;  2FGS A;  2MWH A;  1QQS A;  1W6F A;  4I95 A;  4NYQ A;  1YUP A;  1ZNE A;  2W2A A;  1BWY A;  3T1D A;  4KT5 A;  3FR5 A;  4QAE A;  2FHN X;  2HNX A;  4YBP A;  1SRJ A;  2C1S A;  1FDQ A;  2LBA A;  5AQ6 A;  4DQ3 A;  1SRH A;  4N7D A;  2JMB A;  4ORU A;  1HXZ A;  3D4R A;  2QOM A;  3FA9 A;  1JYJ A;  3FW4 A;  4MVI A;  3O22 A;  4I9R A;  2RTD B;  3PPT A;  1U18 A;  1YWD A;  3C76 X;  2GJ5 A;  1BJ7 A;  3FDC A;  1NGL A;  2OL7 A;  4GU8 A;  3UEX A;  2GC9 A;  5AJB A;  3FIQ A;  4UU2 A;  2OY1 O;  4NV7 A;  4OMW A;  1IKJ A;  5EDC A;  3DSZ A;  3FEK A;  2OFA A;  1S2P A;  3HWF A;  3EBK A;  3P6D A;  3WJF A;  5KHP A;  1VYF A;  4OEM A;  2OVA A;  4WFU A;  5EZ2 A;  3SLO A;  4COT A;  2Z4I A;  4O3X B;  1KZW A;  3CMP A;  2I5Z O;  1SWN A;  5F7G A;  1D2U A;  3LHN A;  4MIS A;  4AZR A;  4Y0Q A;  1ZNH A;  4UU3 A;  4ZFX A;  2ZSC A;  1ALB A;  1GX3 A;  1ML7 A;  1SY3 A;  2WQA E;  4EFG A;  1MVG A;  1X8Q A;  1KOI A;  2IZF B;  1A3Y A;  3HWG A;  4FBV A;  1UZ2 X;  1JIW I;  4O9S A;  1N43 A;  1T68 X;  4MVK A;  4XMC A;  2XST A;  3MG5 A;  3WVM A;  1PTS A;  1RST B;  5LKE A;  3ZW1 A;  2OVE A;  1VWD B;  3UAQ A;  4QYP A;  4EDE A;  1GT4 A;  2RTI B;  2GTL O;  3BSZ E;  4LZV A;  1RSU B;  4PSQ A;  2QOS C;  3AEH A;  2L68 A;  3ELZ A;  3NBX X;  3PP6 A;  1BEB A;  5EPQ A;  3V8U A;  4A1Y A;  3FMZ A;  1I06 A;  2ACO A;  2IFB A;  1CBI A;  1ZRY A;  2PY1 A;  3QKG A;  1OPB A;  4YCE A;  3WZQ A;  4LQZ A;  3RWX A;  1HQP A;  2A3F X;  4GGR A;  5H8T A;  1Y53 X;  1BBP A;  4IB8 A;  1E02 A;  4CPF A;  1A57 A;  3WYQ A;  2RTN B;  3VPJ E;  1W4T A;  3D95 A;  4ORW A;  5B5F A;  1VPR A;  1PMP A;  4I6S A;  2OVS A;  1QWD A;  3NQK A;  3JS1 A;  1B56 A;  1LKE A;  2X8T A;  3Q6L A;  3RDX A;  1VWI B;  4OMX A;  5H9A A;  3SZH A;  2BHV A;  1E5P A;  2RCT A;  1TVQ A;  2R74 A;  1SWA A;  1LIB A;  2FR2 A;  2RTM A;  2CBR A;  5LJD A;  4CDE A;  5L8N A;  3G7X A;  5D8J A;  4Y0R A;  3TGB A;  1DF3 A;  1GXA A;  1QFV A;  4CK4 A;  2L9C A;  2NNQ A;  4LKP A;  4WBK A;  2XKL A;  4TJZ A;  1GX8 A;  2GTL N;  4BCS A;  1SWU A;  4YVB A;  1SWT A;  3Q34 A;  1N9M A;  4ALB A;  1Y55 X;  3HPE A;  2WQ9 A;  3SLT A;  4OS0 A;  4OKA A;  1BRQ A;  4KCA A;  1LCV A;  2HLV A;  1ICN A;  5LJE A;  1SWO A;  1VWR B;  2A2G A;  2WWP A;  2ZAG A;  4XMF A;  2MF6 A;  3FYF A;  1Y52 X;  3LV4 A;  4MVL A;  4HPD A;  3EM0 A;  3FA8 A;  4NP1 A;  5EEE A;  1YIV A;  3HTY A;  3NX2 A;  2ALL X;  1L6M A;  2WUT A;  3CKG A;  4YDB A;  3HWE A;  3STK A;  5FEN A;  5HZ8 A;  5HCD C;  3T6F A;  1HQQ A;  1DZK A;  1VWO B;  4INN A;  4KII A;  1SWK A;  1CBS A; 
#chains in the Genus database with same CATH homology
 4Z27 A;  1LCW A;  2IZD B;  3T2X A;  1KL5 A;  2RTG B;  4JO6 A;  2GH7 A;  3T6L A;  5L3Y A;  4Z2O A;  2F01 A;  2AVI A;  1VWH B;  1HXL A;  2IZI A;  1NDJ A;  5JD2 A;  4CPE A;  2Y3F A;  4U46 A;  2IZB A;  1HY2 A;  1SRG A;  2IZG B;  1DF8 A;  4BX5 B;  4CPI A;  4JNJ A;  1RXJ A;  2IZC B;  3RDS A;  1VWG B;  2UYW A;  2IZA A;  1KFF A;  1LDO A;  3VHI A;  4BX6 B;  2QCB A;  3RY1 A;  1MEP A;  3RE6 A;  1NBX A;  1VYO A;  4Y5D A;  5CSE A;  4CPH A;  4JHQ A;  1VWB B;  1STR B;  2OFB A;  4Z2P A;  1AVE A;  2Y3E A;  3X00 A;  1SWQ A;  1VWF B;  2FHN X;  2IZE B;  1SRJ A;  2C1S A;  3PK2 A;  3VHM A;  1SRH A;  1HXZ A;  1LUQ A;  3MM0 A;  4Z28 A;  2A8G A;  2IZH B;  1VWN B;  2A5C A;  4GD9 A;  2OF9 A;  2RTD B;  1SWD A;  5IRA A;  2G5L A;  3FDC A;  2CAM A;  1SWE A;  1VWQ B;  1KL3 A;  1VWK B;  3SZI A;  2FHL A;  1N9Y A;  1SLD B;  2OFA A;  5F2B A;  3RDO A;  2C4I A;  2RTO B;  5IRW A;  2RTL A;  2OF8 A;  4CPH B;  1SWN A;  1SRI A;  1SLE B;  4I60 A;  1VWL B;  3VHH A;  2RTQ B;  1SWR A;  1VWP B;  1VWA B;  2RTP B;  3T2W A;  2ZSC A;  2IZK A;  4IRW A;  4BX7 B;  2A5B A;  1AVD A;  2IZF B;  1N4J A;  4BX7 A;  1N43 A;  2JGS A;  2C1Q A;  5K68 A;  3MG5 A;  4GJV A;  1NC9 A;  1PTS A;  1RST B;  4DNE A;  1SWF A;  2RTC B;  2BC3 A;  1MM9 A;  1VWD B;  3WZN A;  2IZL B;  1KL4 A;  3SZJ A;  1SWL A;  1SRE A;  2RTI B;  3WYP A;  1LEL A;  1RSU B;  4Z6J A;  1RXK A;  3RDM A;  3WZQ A;  4GGT A;  5IRU A;  3RE5 A;  4CPF A;  4GGR A;  1SWJ A;  1Y53 X;  1LDQ A;  3WYQ A;  1SLF B;  2RTN B;  2Y32 A;  3EW1 A;  5B5G A;  5B5F A;  4Y59 A;  1SWG A;  1SWP A;  1VWE B;  1STP A;  2RTA A;  2RTH B;  2WPU A;  1VWI B;  1WBI A;  3EW2 A;  3RDX A;  1MK5 A;  1MOY A;  3SZH A;  4GGZ A;  1NQM A;  4EKV A;  1SWA A;  2RTB B;  3RDU A;  2RTM A;  3WZP A;  2UZ2 A;  1VWJ B;  2RTE B;  3RY2 A;  1NQN A;  4BCS A;  1SWU A;  4YVB A;  1SWT A;  1SWS A;  1N9M A;  2RTJ A;  4BBO A;  3WZO A;  1Y55 X;  4BX5 A;  1SWH A;  2RTR B;  1I9H A;  3VGW A;  1SLG B;  5CHK A;  3RDQ A;  1LCZ A;  4OKA A;  2RTF B;  1LCV A;  1SWB A;  1SWO A;  1VWR B;  1RAV A;  4BJ8 A;  2MF6 A;  1Y52 X;  1SRF A;  4BX6 A;  4Z2V A;  2IZJ A;  1RXH A;  1VWC B;  5K67 A;  4GDA A;  1STS B;  1SWC A;  3T6F A;  1N7Y A;  1HQQ A;  1VWO B;  1SWK A;  1VWM B;  4GJS A;  2RTK A;  1IJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...