3RY7A

Crystal structure of sa239
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
303
structure length
303
Chain Sequence
TNKVVILGSTNVDQFLTVERYAQPGETLHVEEAQKAFGGGKGANQAIATARMQADTTFITKIGTDGVADFILEDFKVAHIDTSYIIKTAEAKTGQAFITVNAEGQNTIYVYGGANMTMTPEDVINAKDAIINADFVVAQLEVPIPAIISAFEIAKAHGVTTVLNPAPAKALPNELLSLIDIIVPNETEAELLSGIKVTNEQSMKDNANYFLSIGIKTVLITLGKQGTYFATKNQSQHIEAYKVNAIDTTAAGDTFIGAFVSRLNKSQDNLADAIDFGNKASSLTVQKHGAQASIPLLEEVNQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Sa239 reveals the structural basis for the activation of ribokinase by monovalent cations.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords Ribokinase
total genus 99
structure length 303
sequence length 303
ec nomenclature ec 2.7.1.15: Ribokinase.
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3ry7A00
3NL5A 4K8TA 3OTXA 3QAIA 3RRFA 1JXIA 3RTCA 4K93A 1TZ3A 3HPDA 5F0ZA 4O1GA 1RFUA 2DDMA 2V78A 2AB8A 3GO6A 4LBXA 5CGAA 3KZHA 4N08A 5COJA 3H74A 1V1SA 3LHXA 3RRBA 4WJMA 2R3BA 5EYNA 2YXTA 1ESJA 1C3QA 3RQ2A 3RU3A 4C5MA 3IE7A 4JKSA 3KTNA 4E3AA 4N09A 4C5NA 1RFVA 3NCAA 2I6BA 3VAQA 4C5KA 5C41A 3RSSA 3NBVA 3B1QA 4JKUA 4EUMA 4PVVA 2C4EA 2RBCA 2R3EA 4KBEA 4U7XA 2I5BA 3ZS7A 3RY7A 3NL3A 2YXUA 1TYYA 1VM7A 3GBUA 3JULA 3QA2A 1V19A 3NM3A 3BF5A 4E69A 2HLZA 1L2LA 3UQEA 4E8WA 4XF7A 1LIIA 1VI9A 3UBOA 1RKDA 3UMPA 1GC5A 3IH0A 3NL2A 3EWMA 4GM6A 4UBEA 3VASA 3Q92A 3RPHA 2AJPA 1RFTA 4O1LA 4XDAA 3RREA 4YWRA 3W4SA 2AX3A 4E8ZA 3RQHA 3LKIA 3NL6A 1V1AA 1YGKA 5CM5A 4K8PA 1GQTA 3RQ8A 1UA4A 2AA0A 3DZVA 2A9ZA 3IKHA 4S1MA 3UMOA 3B1PA 3IQ0A 3FHYA 2AWDA 2C49A 5BYEA 4S1IA 2XTBA 3RT9A 1RKAA 3RQXA 5EY7A 2ABSA 5BYCA 3UQDA 2QHPA 5BYDA 3RS8A 2FV7A 1LIKA 2AFBA 3HICA 4EOHA 4B8RA 3PL2A 1BX4A 5CGEA 3RQQA 4C5LA 2HW1A 3KEUA 4JJPA 1KYHA 3NM1A 1LHPA 3RM5A 4DC3A 3RTGA 4E84A 3MBJA 1LIJA 4XF6A 5F11A 1LIOA 3NC9A 3IN1A 3RTDA 2A9YA 3RTEA 1ESQA 2QCVA 3UQ9A 1TZ6A 3K5WA 2PKKA 2ABQA 5TRWA 3DRWA 1DGMA 4KAHA 2DDOA 1TD2A 1RK2A 2F02A 2PKFA 3B1NA 4K9IA 3RU2A 4K8KA 3RPZA 1WYEA 3I3YA 3NC2A 1LHRA 4KALA 3RSGA 3B1RA 3CQDA 3RSQA 3RSFA 5B6AA 4LC4A 4EBUA 2JGVA 4B8SA 5C3ZA 1YHJA 3PZSA 1EKKA 3B1OA 2HQQA 2DCNA 4EN4A 1JXHA 3B3LA 3HYOA 3LJSA 1EKQA 2JG5A 3BGKA 3FHXA 3IBQA 3RTAA 3UQ6A 2NWHA 5TQIA 5C3YA 2AJRA 5C40A 3KD6A 2DDWA 4C5JA 3K9EA 3RQ6A 1U2XA 1V1BA 2PKNA 3RT7A 3RTBA 1VK4A 3LOOA 4K9CA 4E8YA 3N1CA 3Q1YA 2Q5RA 2F7KA 4YL5A 3NBWA 4X8FA 3MBHA 3RS9A 4S1IB 5BYFA 4LBGA 4DU5A 3RQ5A 1RKSA 2PKMA 4K8CA 4S1HA 1UB0A 2JG1A 2VARA 3H49A 4KADA 4KANA 4LCAA 4XCKA 3RRJA 3RO4A 2I6AA 3GO7A 1YGJA
chains in the Genus database with same CATH superfamily
3NL5A 4K8TA 1JBVA 3OTXA 3NRSA 3QAIA 1JXIA 2Y68A 3RRFA 3RTCA 4K93A 1TZ3A 3HPDA 1UAGA 4O1GA 5F0ZA 1RFUA 1W78A 2DDMA 2AB8A 2V78A 3EAGA 3GO6A 3KZHA 3QCZA 4LBXA 4N08A 5CGAA 5COJA 3H74A 1V1SA 2XJAA 3LHXA 3RRBA 4WJMA 2R3BA 5EYNA 2YXTA 1ESJA 1C3QA 3RQ2A 3RU3A 4BUBA 3IE7A 4JKSA 3KTNA 4C5MA 4N09A 4C5NA 2GCBA 1RFVA 3NCAA 2I6BA 2XPCA 3VAQA 4BUCA 4C5KA 5C41A 2X5OA 3RSSA 3NBVA 3B1QA 4JKUA 4EUMA 4PVVA 2C4EA 2RBCA 2R3EA 4KBEA 4U7XA 2I5BA 4UAGA 3RY7A 2JFGA 3ZS7A 3NL3A 2YXUA 3GBUA 1VM7A 3JULA 3QA2A 3ZL8A 1V19A 3NM3A 2F00A 3BF5A 4ZIYA 4E69A 2HLZA 1L2LA 3UQEA 4E8WA 4XF7A 1LIIA 4CVMA 1VI9A 4C13A 3UBOA 1RKDA 3UMPA 1GC5A 3IH0A 3NL2A 3EWMA 1GQYA 2AM1A 3LK7A 4GM6A 3Q92A 4UBEA 2AJPA 1RFTA 3RPHA 4O1LA 4XDAA 3RREA 4YWRA 3W4SA 2AX3A 1E8CA 4E8ZA 2VTEA 3RQHA 3LKIA 3NL6A 1V1AA 1YGKA 5CM5A 4K8PA 1GQTA 3RQ8A 1UA4A 2AA0A 3DZVA 1W7KA 2A9ZA 3IKHA 4E3AA 4S1MA 3UMOA 3B1PA 3IQ0A 4CVLA 3FHYA 2AWDA 2C49A 5BYEA 2WJPA 4S1IA 1P3DA 2XTBA 1RKAA 3RT9A 3RQXA 2GC6A 2ABSA 5EY7A 5A5FA 5BYCA 2QHPA 1GG4A 3UQ6A 1E0DA 5BYDA 3RS8A 2FV7A 1LIKA 2AFBA 3HICA 4EOHA 3ZM6A 4B8RA 3PL2A 1BX4A 5CGEA 3RQQA 4C5LA 2HW1A 3KEUA 4JJPA 3ZM5A 1EEHA 1KYHA 3VASA 3NM1A 1LHPA 3RM5A 4DC3A 3RTGA 4E84A 3MBJA 1LIJA 4XF6A 5F11A 1LIOA 3NC9A 3IN1A 3RTDA 2A9YA 3PYZA 3RTEA 1ESQA 2QCVA 2Y67A 3UQ9A 1TZ6A 2GCAA 3K5WA 2PKKA 2ABQA 2JFFA 5TRWA 3DRWA 1DGMA 4KAHA 3HN7A 2DDOA 1TD2A 3N2AA 1RK2A 2F02A 2PKFA 3B1NA 2JFHA 4K9IA 3RU2A 1GQQA 2Y66A 4K8KA 3RPZA 1WYEA 3I3YA 3NC2A 1LHRA 2UUPA 4KALA 3B1RA 3CQDA 3RSGA 3RSQA 5B6AA 4LC4A 4EBUA 2AM2A 2JGVA 4B8SA 5C3ZA 1YHJA 3PZSA 1P31A 1EKKA 2VTDA 2HQQA 3B1OA 3UAGA 2DCNA 4EN4A 1JXHA 3B3LA 5A5EA 3HYOA 3LJSA 1EKQA 2JG5A 2VORA 3BGKA 3FHXA 3IBQA 3RTAA 4HV4A 2UAGA 2NWHA 5TQIA 4CVKA 1FGSA 2GC5A 2AJRA 5C3YA 5C40A 2WTZA 1O5ZA 3KD6A 2DDWA 2I6AA 3HJ6A 4C5JA 3K9EA 3RQ6A 1U2XA 1V1BA 2PKNA 1JBWA 2Y1OA 1VK4A 3RT7A 3RTBA 3LOOA 4QDIA 3RSFA 4K9CA 4E8YA 3N1CA 3Q1YA 2Q5RA 2F7KA 4YL5A 3NBWA 4X8FA 3MBHA 3RS9A 4S1IB 4C12A 4LBGA 4DU5A 2VOSA 5BYFA 3RQ5A 1RKSA 2PKMA 2UUOA 4K8CA 3UQDA 4S1HA 1UB0A 2JG1A 2VARA 3H49A 4KADA 4KANA 4LCAA 4XCKA 3RRJA 4QF5A 3RO4A 1J6UA 1TYYA 3GO7A 1YGJA
chains in the Genus database with same CATH topology
3NL5A 4K8TA 3OTXA 3QAIA 3RRFA 1JXIA 3RTCA 4K93A 1TZ3A 3HPDA 5F0ZA 4O1GA 1RFUA 2DDMA 2V78A 2AB8A 3GO6A 4LBXA 5CGAA 3KZHA 4N08A 5COJA 3H74A 1V1SA 3LHXA 3RRBA 4WJMA 2R3BA 5EYNA 2YXTA 1ESJA 1C3QA 3RQ2A 3RU3A 4C5MA 3IE7A 4JKSA 3KTNA 4E3AA 4N09A 4C5NA 1RFVA 3NCAA 2I6BA 3VAQA 4C5KA 5C41A 3RSSA 3NBVA 3B1QA 4JKUA 4EUMA 4PVVA 2C4EA 2RBCA 2R3EA 4KBEA 4U7XA 2I5BA 3ZS7A 3RY7A 3NL3A 2YXUA 1TYYA 1VM7A 3GBUA 3JULA 3QA2A 1V19A 3NM3A 3BF5A 4E69A 2HLZA 1L2LA 3UQEA 4E8WA 4XF7A 1LIIA 1VI9A 3UBOA 1RKDA 3UMPA 1GC5A 3IH0A 3NL2A 3EWMA 4GM6A 4UBEA 3VASA 3Q92A 3RPHA 2AJPA 1RFTA 4O1LA 4XDAA 3RREA 4YWRA 3W4SA 2AX3A 4E8ZA 3RQHA 3LKIA 3NL6A 1V1AA 1YGKA 5CM5A 4K8PA 1GQTA 3RQ8A 1UA4A 2AA0A 3DZVA 2A9ZA 3IKHA 4S1MA 3UMOA 3B1PA 3IQ0A 3FHYA 2AWDA 2C49A 5BYEA 4S1IA 2XTBA 3RT9A 1RKAA 3RQXA 5EY7A 2ABSA 5BYCA 3UQDA 2QHPA 5BYDA 3RS8A 2FV7A 1LIKA 2AFBA 3HICA 4EOHA 4B8RA 3PL2A 1BX4A 5CGEA 3RQQA 4C5LA 2HW1A 3KEUA 4JJPA 1KYHA 3NM1A 1LHPA 3RM5A 4DC3A 3RTGA 4E84A 3MBJA 1LIJA 4XF6A 5F11A 1LIOA 3NC9A 3IN1A 3RTDA 2A9YA 3RTEA 1ESQA 2QCVA 3UQ9A 1TZ6A 3K5WA 2PKKA 2ABQA 5TRWA 3DRWA 1DGMA 4KAHA 2DDOA 1TD2A 1RK2A 2F02A 2PKFA 3B1NA 4K9IA 3RU2A 4K8KA 3RPZA 1WYEA 3I3YA 3NC2A 1LHRA 4KALA 3RSGA 3B1RA 3CQDA 3RSQA 3RSFA 5B6AA 4LC4A 4EBUA 2JGVA 4B8SA 5C3ZA 1YHJA 3PZSA 1EKKA 3B1OA 2HQQA 2DCNA 4EN4A 1JXHA 3B3LA 3HYOA 3LJSA 1EKQA 2JG5A 3BGKA 3FHXA 3IBQA 3RTAA 3UQ6A 2NWHA 5TQIA 5C3YA 2AJRA 5C40A 3KD6A 2DDWA 3HJ6A 4C5JA 3K9EA 3RQ6A 1U2XA 1V1BA 2PKNA 3RT7A 3RTBA 1VK4A 3LOOA 4K9CA 4E8YA 3N1CA 3Q1YA 2Q5RA 2F7KA 4YL5A 3NBWA 4X8FA 3MBHA 3RS9A 4S1IB 5BYFA 4LBGA 4DU5A 3RQ5A 1RKSA 2PKMA 4K8CA 4S1HA 1UB0A 2JG1A 2VARA 3H49A 4KADA 4KANA 4LCAA 4XCKA 3RRJA 3RO4A 2I6AA 3GO7A 1YGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NL5 A;  4K8T A;  3OTX A;  3QAI A;  3RRF A;  1JXI A;  3RTC A;  4K93 A;  1TZ3 A;  3HPD A;  5F0Z A;  4O1G A;  1RFU A;  2DDM A;  2V78 A;  2AB8 A;  3GO6 A;  4LBX A;  5CGA A;  3KZH A;  4N08 A;  5COJ A;  3H74 A;  1V1S A;  3LHX A;  3RRB A;  4WJM A;  2R3B A;  5EYN A;  2YXT A;  1ESJ A;  1C3Q A;  3RQ2 A;  3RU3 A;  4C5M A;  3IE7 A;  4JKS A;  3KTN A;  4E3A A;  4N09 A;  4C5N A;  1RFV A;  3NCA A;  2I6B A;  3VAQ A;  4C5K A;  5C41 A;  3RSS A;  3NBV A;  3B1Q A;  4JKU A;  4EUM A;  4PVV A;  2C4E A;  2RBC A;  2R3E A;  4KBE A;  4U7X A;  2I5B A;  3ZS7 A;  3RY7 A;  3NL3 A;  2YXU A;  1TYY A;  1VM7 A;  3GBU A;  3JUL A;  3QA2 A;  1V19 A;  3NM3 A;  3BF5 A;  4E69 A;  2HLZ A;  1L2L A;  3UQE A;  4E8W A;  4XF7 A;  1LII A;  1VI9 A;  3UBO A;  1RKD A;  3UMP A;  1GC5 A;  3IH0 A;  3NL2 A;  3EWM A;  4GM6 A;  4UBE A;  3VAS A;  3Q92 A;  3RPH A;  2AJP A;  1RFT A;  4O1L A;  4XDA A;  3RRE A;  4YWR A;  3W4S A;  2AX3 A;  4E8Z A;  3RQH A;  3LKI A;  3NL6 A;  1V1A A;  1YGK A;  5CM5 A;  4K8P A;  1GQT A;  3RQ8 A;  1UA4 A;  2AA0 A;  3DZV A;  2A9Z A;  3IKH A;  4S1M A;  3UMO A;  3B1P A;  3IQ0 A;  3FHY A;  2AWD A;  2C49 A;  5BYE A;  4S1I A;  2XTB A;  3RT9 A;  1RKA A;  3RQX A;  5EY7 A;  2ABS A;  5BYC A;  3UQD A;  2QHP A;  5BYD A;  3RS8 A;  2FV7 A;  1LIK A;  2AFB A;  3HIC A;  4EOH A;  4B8R A;  3PL2 A;  1BX4 A;  5CGE A;  3RQQ A;  4C5L A;  2HW1 A;  3KEU A;  4JJP A;  1KYH A;  3NM1 A;  1LHP A;  3RM5 A;  4DC3 A;  3RTG A;  4E84 A;  3MBJ A;  1LIJ A;  4XF6 A;  5F11 A;  1LIO A;  3NC9 A;  3IN1 A;  3RTD A;  2A9Y A;  3RTE A;  1ESQ A;  2QCV A;  3UQ9 A;  1TZ6 A;  3K5W A;  2PKK A;  2ABQ A;  5TRW A;  3DRW A;  1DGM A;  4KAH A;  2DDO A;  1TD2 A;  1RK2 A;  2F02 A;  2PKF A;  3B1N A;  4K9I A;  3RU2 A;  4K8K A;  3RPZ A;  1WYE A;  3I3Y A;  3NC2 A;  1LHR A;  4KAL A;  3RSG A;  3B1R A;  3CQD A;  3RSQ A;  3RSF A;  5B6A A;  4LC4 A;  4EBU A;  2JGV A;  4B8S A;  5C3Z A;  1YHJ A;  3PZS A;  1EKK A;  3B1O A;  2HQQ A;  2DCN A;  4EN4 A;  1JXH A;  3B3L A;  3HYO A;  3LJS A;  1EKQ A;  2JG5 A;  3BGK A;  3FHX A;  3IBQ A;  3RTA A;  3UQ6 A;  2NWH A;  5TQI A;  5C3Y A;  2AJR A;  5C40 A;  3KD6 A;  2DDW A;  4C5J A;  3K9E A;  3RQ6 A;  1U2X A;  1V1B A;  2PKN A;  3RT7 A;  3RTB A;  1VK4 A;  3LOO A;  4K9C A;  4E8Y A;  3N1C A;  3Q1Y A;  2Q5R A;  2F7K A;  4YL5 A;  3NBW A;  4X8F A;  3MBH A;  3RS9 A;  4S1I B;  5BYF A;  4LBG A;  4DU5 A;  3RQ5 A;  1RKS A;  2PKM A;  4K8C A;  4S1H A;  1UB0 A;  2JG1 A;  2VAR A;  3H49 A;  4KAD A;  4KAN A;  4LCA A;  4XCK A;  3RRJ A;  3RO4 A;  2I6A A;  3GO7 A;  1YGJ A; 
#chains in the Genus database with same CATH topology
 3NL5 A;  4K8T A;  1JBV A;  3OTX A;  3NRS A;  3QAI A;  1JXI A;  2Y68 A;  3RRF A;  3RTC A;  4K93 A;  1TZ3 A;  3HPD A;  1UAG A;  4O1G A;  5F0Z A;  1RFU A;  1W78 A;  2DDM A;  2AB8 A;  2V78 A;  3EAG A;  3GO6 A;  3KZH A;  3QCZ A;  4LBX A;  4N08 A;  5CGA A;  5COJ A;  3H74 A;  1V1S A;  2XJA A;  3LHX A;  3RRB A;  4WJM A;  2R3B A;  5EYN A;  2YXT A;  1ESJ A;  1C3Q A;  3RQ2 A;  3RU3 A;  4BUB A;  3IE7 A;  4JKS A;  3KTN A;  4C5M A;  4N09 A;  4C5N A;  2GCB A;  1RFV A;  3NCA A;  2I6B A;  2XPC A;  3VAQ A;  4BUC A;  4C5K A;  5C41 A;  2X5O A;  3RSS A;  3NBV A;  3B1Q A;  4JKU A;  4EUM A;  4PVV A;  2C4E A;  2RBC A;  2R3E A;  4KBE A;  4U7X A;  2I5B A;  4UAG A;  3RY7 A;  2JFG A;  3ZS7 A;  3NL3 A;  2YXU A;  3GBU A;  1VM7 A;  3JUL A;  3QA2 A;  3ZL8 A;  1V19 A;  3NM3 A;  2F00 A;  3BF5 A;  4ZIY A;  4E69 A;  2HLZ A;  1L2L A;  3UQE A;  4E8W A;  4XF7 A;  1LII A;  4CVM A;  1VI9 A;  4C13 A;  3UBO A;  1RKD A;  3UMP A;  1GC5 A;  3IH0 A;  3NL2 A;  3EWM A;  1GQY A;  2AM1 A;  3LK7 A;  4GM6 A;  3Q92 A;  4UBE A;  2AJP A;  1RFT A;  3RPH A;  4O1L A;  4XDA A;  3RRE A;  4YWR A;  3W4S A;  2AX3 A;  1E8C A;  4E8Z A;  2VTE A;  3RQH A;  3LKI A;  3NL6 A;  1V1A A;  1YGK A;  5CM5 A;  4K8P A;  1GQT A;  3RQ8 A;  1UA4 A;  2AA0 A;  3DZV A;  1W7K A;  2A9Z A;  3IKH A;  4E3A A;  4S1M A;  3UMO A;  3B1P A;  3IQ0 A;  4CVL A;  3FHY A;  2AWD A;  2C49 A;  5BYE A;  2WJP A;  4S1I A;  1P3D A;  2XTB A;  1RKA A;  3RT9 A;  3RQX A;  2GC6 A;  2ABS A;  5EY7 A;  5A5F A;  5BYC A;  2QHP A;  1GG4 A;  3UQ6 A;  1E0D A;  5BYD A;  3RS8 A;  2FV7 A;  1LIK A;  2AFB A;  3HIC A;  4EOH A;  3ZM6 A;  4B8R A;  3PL2 A;  1BX4 A;  5CGE A;  3RQQ A;  4C5L A;  2HW1 A;  3KEU A;  4JJP A;  3ZM5 A;  1EEH A;  1KYH A;  3VAS A;  3NM1 A;  1LHP A;  3RM5 A;  4DC3 A;  3RTG A;  4E84 A;  3MBJ A;  1LIJ A;  4XF6 A;  5F11 A;  1LIO A;  3NC9 A;  3IN1 A;  3RTD A;  2A9Y A;  3PYZ A;  3RTE A;  1ESQ A;  2QCV A;  2Y67 A;  3UQ9 A;  1TZ6 A;  2GCA A;  3K5W A;  2PKK A;  2ABQ A;  2JFF A;  5TRW A;  3DRW A;  1DGM A;  4KAH A;  3HN7 A;  2DDO A;  1TD2 A;  3N2A A;  1RK2 A;  2F02 A;  2PKF A;  3B1N A;  2JFH A;  4K9I A;  3RU2 A;  1GQQ A;  2Y66 A;  4K8K A;  3RPZ A;  1WYE A;  3I3Y A;  3NC2 A;  1LHR A;  2UUP A;  4KAL A;  3B1R A;  3CQD A;  3RSG A;  3RSQ A;  5B6A A;  4LC4 A;  4EBU A;  2AM2 A;  2JGV A;  4B8S A;  5C3Z A;  1YHJ A;  3PZS A;  1P31 A;  1EKK A;  2VTD A;  2HQQ A;  3B1O A;  3UAG A;  2DCN A;  4EN4 A;  1JXH A;  3B3L A;  5A5E A;  3HYO A;  3LJS A;  1EKQ A;  2JG5 A;  2VOR A;  3BGK A;  3FHX A;  3IBQ A;  3RTA A;  4HV4 A;  2UAG A;  2NWH A;  5TQI A;  4CVK A;  1FGS A;  2GC5 A;  2AJR A;  5C3Y A;  5C40 A;  2WTZ A;  1O5Z A;  3KD6 A;  2DDW A;  2I6A A;  3HJ6 A;  4C5J A;  3K9E A;  3RQ6 A;  1U2X A;  1V1B A;  2PKN A;  1JBW A;  2Y1O A;  1VK4 A;  3RT7 A;  3RTB A;  3LOO A;  4QDI A;  3RSF A;  4K9C A;  4E8Y A;  3N1C A;  3Q1Y A;  2Q5R A;  2F7K A;  4YL5 A;  3NBW A;  4X8F A;  3MBH A;  3RS9 A;  4S1I B;  4C12 A;  4LBG A;  4DU5 A;  2VOS A;  5BYF A;  3RQ5 A;  1RKS A;  2PKM A;  2UUO A;  4K8C A;  3UQD A;  4S1H A;  1UB0 A;  2JG1 A;  2VAR A;  3H49 A;  4KAD A;  4KAN A;  4LCA A;  4XCK A;  3RRJ A;  4QF5 A;  3RO4 A;  1J6U A;  1TYY A;  3GO7 A;  1YGJ A; 
#chains in the Genus database with same CATH homology
 3NL5 A;  4K8T A;  3OTX A;  3QAI A;  3RRF A;  1JXI A;  3RTC A;  4K93 A;  1TZ3 A;  3HPD A;  5F0Z A;  4O1G A;  1RFU A;  2DDM A;  2V78 A;  2AB8 A;  3GO6 A;  4LBX A;  5CGA A;  3KZH A;  4N08 A;  5COJ A;  3H74 A;  1V1S A;  3LHX A;  3RRB A;  4WJM A;  2R3B A;  5EYN A;  2YXT A;  1ESJ A;  1C3Q A;  3RQ2 A;  3RU3 A;  4C5M A;  3IE7 A;  4JKS A;  3KTN A;  4E3A A;  4N09 A;  4C5N A;  1RFV A;  3NCA A;  2I6B A;  3VAQ A;  4C5K A;  5C41 A;  3RSS A;  3NBV A;  3B1Q A;  4JKU A;  4EUM A;  4PVV A;  2C4E A;  2RBC A;  2R3E A;  4KBE A;  4U7X A;  2I5B A;  3ZS7 A;  3RY7 A;  3NL3 A;  2YXU A;  1TYY A;  1VM7 A;  3GBU A;  3JUL A;  3QA2 A;  1V19 A;  3NM3 A;  3BF5 A;  4E69 A;  2HLZ A;  1L2L A;  3UQE A;  4E8W A;  4XF7 A;  1LII A;  1VI9 A;  3UBO A;  1RKD A;  3UMP A;  1GC5 A;  3IH0 A;  3NL2 A;  3EWM A;  4GM6 A;  4UBE A;  3VAS A;  3Q92 A;  3RPH A;  2AJP A;  1RFT A;  4O1L A;  4XDA A;  3RRE A;  4YWR A;  3W4S A;  2AX3 A;  4E8Z A;  3RQH A;  3LKI A;  3NL6 A;  1V1A A;  1YGK A;  5CM5 A;  4K8P A;  1GQT A;  3RQ8 A;  1UA4 A;  2AA0 A;  3DZV A;  2A9Z A;  3IKH A;  4S1M A;  3UMO A;  3B1P A;  3IQ0 A;  3FHY A;  2AWD A;  2C49 A;  5BYE A;  4S1I A;  2XTB A;  3RT9 A;  1RKA A;  3RQX A;  5EY7 A;  2ABS A;  5BYC A;  3UQD A;  2QHP A;  5BYD A;  3RS8 A;  2FV7 A;  1LIK A;  2AFB A;  3HIC A;  4EOH A;  4B8R A;  3PL2 A;  1BX4 A;  5CGE A;  3RQQ A;  4C5L A;  2HW1 A;  3KEU A;  4JJP A;  1KYH A;  3NM1 A;  1LHP A;  3RM5 A;  4DC3 A;  3RTG A;  4E84 A;  3MBJ A;  1LIJ A;  4XF6 A;  5F11 A;  1LIO A;  3NC9 A;  3IN1 A;  3RTD A;  2A9Y A;  3RTE A;  1ESQ A;  2QCV A;  3UQ9 A;  1TZ6 A;  3K5W A;  2PKK A;  2ABQ A;  5TRW A;  3DRW A;  1DGM A;  4KAH A;  2DDO A;  1TD2 A;  1RK2 A;  2F02 A;  2PKF A;  3B1N A;  4K9I A;  3RU2 A;  4K8K A;  3RPZ A;  1WYE A;  3I3Y A;  3NC2 A;  1LHR A;  4KAL A;  3RSG A;  3B1R A;  3CQD A;  3RSQ A;  3RSF A;  5B6A A;  4LC4 A;  4EBU A;  2JGV A;  4B8S A;  5C3Z A;  1YHJ A;  3PZS A;  1EKK A;  3B1O A;  2HQQ A;  2DCN A;  4EN4 A;  1JXH A;  3B3L A;  3HYO A;  3LJS A;  1EKQ A;  2JG5 A;  3BGK A;  3FHX A;  3IBQ A;  3RTA A;  3UQ6 A;  2NWH A;  5TQI A;  5C3Y A;  2AJR A;  5C40 A;  3KD6 A;  2DDW A;  3HJ6 A;  4C5J A;  3K9E A;  3RQ6 A;  1U2X A;  1V1B A;  2PKN A;  3RT7 A;  3RTB A;  1VK4 A;  3LOO A;  4K9C A;  4E8Y A;  3N1C A;  3Q1Y A;  2Q5R A;  2F7K A;  4YL5 A;  3NBW A;  4X8F A;  3MBH A;  3RS9 A;  4S1I B;  5BYF A;  4LBG A;  4DU5 A;  3RQ5 A;  1RKS A;  2PKM A;  4K8C A;  4S1H A;  1UB0 A;  2JG1 A;  2VAR A;  3H49 A;  4KAD A;  4KAN A;  4LCA A;  4XCK A;  3RRJ A;  3RO4 A;  2I6A A;  3GO7 A;  1YGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...