3RY7A

Crystal structure of sa239
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
303
structure length
303
Chain Sequence
TNKVVILGSTNVDQFLTVERYAQPGETLHVEEAQKAFGGGKGANQAIATARMQADTTFITKIGTDGVADFILEDFKVAHIDTSYIIKTAEAKTGQAFITVNAEGQNTIYVYGGANMTMTPEDVINAKDAIINADFVVAQLEVPIPAIISAFEIAKAHGVTTVLNPAPAKALPNELLSLIDIIVPNETEAELLSGIKVTNEQSMKDNANYFLSIGIKTVLITLGKQGTYFATKNQSQHIEAYKVNAIDTTAAGDTFIGAFVSRLNKSQDNLADAIDFGNKASSLTVQKHGAQASIPLLEEVNQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Sa239 reveals the structural basis for the activation of ribokinase by monovalent cations.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
molecule keywords Ribokinase
total genus 99
structure length 303
sequence length 303
ec nomenclature ec 2.7.1.15: Ribokinase.
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3ry7A00
5BYEA 3QAIA 3H49A 3DRWA 4GM6A 3RSFA 2YXTA 5TRWA 3RRBA 4K8PA 3HICA 2JGVA 4N08A 5CGEA 1ESJA 3GO6A 3B1OA 4C5MA 3RU3A 3RO4A 3RPHA 2AFBA 2DCNA 3VAQA 4E8YA 1RFTA 3RU2A 5BYDA 3KEUA 1VI9A 3IBQA 4O1LA 3NL6A 4S1IB 3PL2A 4EOHA 5F11A 5COJA 3EWMA 3KTNA 2AX3A 3RQXA 3Q92A 2I6AA 3KZHA 3NC9A 3NM1A 4S1MA 3BGKA 2R3EA 3MBJA 3HYOA 4DC3A 1LIOA 1EKKA 3ZS7A 2AA0A 3UBOA 1V1BA 3RTDA 2AJPA 3JULA 1VM7A 3RM5A 3RQ5A 3GBUA 3B1NA 4S1IA 4YL5A 4LCAA 2QHPA 1RK2A 4KALA 4C5KA 2NWHA 3IQ0A 1BX4A 4KAHA 4JKSA 4XF7A 2VARA 3NL2A 1RKSA 4KBEA 5C41A 3UQ9A 1UA4A 3B1RA 1V19A 1WYEA 2HW1A 3B3LA 4E84A 2PKFA 4XDAA 3NCAA 4S1HA 3RTGA 4PVVA 2PKNA 2DDMA 2I5BA 3RQQA 1JXHA 3HPDA 3RRJA 4E69A 3KD6A 1U2XA 3CQDA 2DDOA 3QA2A 2RBCA 3LHXA 3RQ2A 3UMOA 3IE7A 3VASA 3RY7A 5C3ZA 4EUMA 5B6AA 4XCKA 1L2LA 3RTEA 4E3AA 3LKIA 1ESQA 3RSGA 3RQHA 1JXIA 2F7KA 1DGMA 3RPZA 3RS9A 2F02A 4B8SA 3NBWA 3NL5A 4LBGA 3MBHA 3RQ8A 3RTAA 1GC5A 4C5NA 1V1AA 3DZVA 3RTCA 3K5WA 4LBXA 3UMPA 3UQDA 2HQQA 4LC4A 3GO7A 2V78A 4KADA 3LJSA 4K8TA 4YWRA 4B8RA 3N1CA 2ABSA 2QCVA 4N09A 1YGJA 3RT7A 2C4EA 1TD2A 2YXUA 2Q5RA 2A9ZA 1RKDA 4K8KA 3RQ6A 4JKUA 3NL3A 1LHPA 1VK4A 2XTBA 1TZ3A 4EBUA 2AWDA 4UBEA 1RKAA 4KANA 4EN4A 2DDWA 3IKHA 4K8CA 1LIIA 2FV7A 3RT9A 5BYCA 2PKMA 3LOOA 3IN1A 1LIJA 2AJRA 2I6BA 3B1PA 4X8FA 3RSQA 4U7XA 3Q1YA 5C3YA 1TYYA 3B1QA 5TQIA 2R3BA 2HLZA 1LHRA 3RTBA 4E8ZA 3RSSA 3NM3A 3OTXA 3FHYA 5CGAA 1C3QA 2ABQA 1V1SA 3RREA 2JG1A 1RFVA 3NBVA 5BYFA 1RFUA 5C40A 4XF6A 3UQ6A 3H74A 3I3YA 4K9IA 3BF5A 3FHXA 4JJPA 1YHJA 4K9CA 5EYNA 1GQTA 3RRFA 3RS8A 3UQEA 1UB0A 3W4SA 2JG5A 4C5JA 1YGKA 1KYHA 2AB8A 3NC2A 4E8WA 4DU5A 4K93A 1TZ6A 1LIKA 4O1GA 2PKKA 3PZSA 5EY7A 4WJMA 5F0ZA 1EKQA 2A9YA 2C49A 4C5LA 5CM5A 3IH0A 3K9EA
chains in the Genus database with same CATH superfamily
1GQYA 5BYEA 3QAIA 2GCAA 3H49A 3DRWA 4UAGA 2Y1OA 4GM6A 3RSFA 2Y66A 1J6UA 2YXTA 5TRWA 3RRBA 4K8PA 2UUOA 3HICA 3W4SA 2JGVA 4N08A 3EAGA 1ESJA 3N2AA 5CGEA 3GO6A 3ZM5A 2AM1A 3B1OA 4C5MA 2XJAA 3RU3A 3RO4A 3RPHA 2DCNA 2AFBA 3HN7A 3VAQA 1RFTA 4E8YA 3RU2A 1W78A 5BYDA 3KEUA 1VI9A 2GC6A 3IBQA 1O5ZA 3NL6A 4O1LA 3PL2A 4S1IB 4EOHA 5F11A 2VORA 5COJA 3EWMA 3KTNA 2AX3A 3RQXA 3ZM6A 2VTDA 3Q92A 2I6AA 3KZHA 2JFHA 2Y67A 3NC9A 3NM1A 3QCZA 1P31A 4S1MA 3BGKA 2R3EA 3MBJA 3HYOA 4DC3A 1LIOA 1EKKA 3ZS7A 2AA0A 3UBOA 1V1BA 3RTDA 2AJPA 3JULA 1JBVA 1VM7A 3RM5A 3RQ5A 3GBUA 3B1NA 4S1IA 4YL5A 4CVMA 1GG4A 4CVKA 4LCAA 2QHPA 1RK2A 4KALA 4C5KA 2NWHA 3IQ0A 1BX4A 4KAHA 4JKSA 4XF7A 3ZL8A 2VARA 3NL2A 1RKSA 4KBEA 5C41A 3UQ9A 1UA4A 3B1RA 1V19A 1WYEA 2HW1A 3B3LA 4E84A 2PKFA 4XDAA 3NCAA 4S1HA 3RTGA 4BUBA 4PVVA 2PKNA 5A5EA 2DDMA 2I5BA 3RQQA 1JXHA 3HPDA 2VOSA 3RRJA 3KD6A 4E69A 1U2XA 3CQDA 2DDOA 3QA2A 2RBCA 3LHXA 2JFGA 3RQ2A 3UMOA 3IE7A 3VASA 3RY7A 5C3ZA 4EUMA 5B6AA 4XCKA 1L2LA 2UUPA 3RTEA 4E3AA 3LKIA 1ESQA 3RSGA 4C13A 3RQHA 1JXIA 2F7KA 1DGMA 3RPZA 3RS9A 2F02A 4B8SA 3NBWA 3NL5A 4LBGA 1FGSA 3MBHA 3RQ8A 3RTAA 1GC5A 4C5NA 1V1AA 3DZVA 3RTCA 3K5WA 1GQQA 4LBXA 3UMPA 3UQDA 2HQQA 4LC4A 4C12A 3GO7A 2V78A 4KADA 3LJSA 4K8TA 4QDIA 4YWRA 4B8RA 3N1CA 2ABSA 2QCVA 3UAGA 4N09A 1YGJA 2AM2A 3RT7A 2C4EA 1TD2A 2YXUA 2GCBA 1E0DA 2Q5RA 2A9ZA 1RKDA 4K8KA 3RQ6A 4JKUA 3NL3A 1LHPA 1VK4A 2WTZA 2XTBA 1TZ3A 4EBUA 2AWDA 4UBEA 1RKAA 4KANA 4EN4A 2DDWA 3IKHA 4K8CA 1LIIA 2FV7A 4ZIYA 3RT9A 2PKMA 3LOOA 4HV4A 5BYCA 1UAGA 3IN1A 1LIJA 2AJRA 2I6BA 3B1PA 4X8FA 3RSQA 4U7XA 3Q1YA 5C3YA 1TYYA 3B1QA 5TQIA 2R3BA 2HLZA 1LHRA 4CVLA 3PYZA 3RTBA 4E8ZA 3NRSA 1P3DA 1EEHA 3RSSA 3NM3A 3OTXA 3FHYA 2VTEA 5CGAA 1C3QA 2ABQA 1E8CA 1V1SA 1W7KA 2F00A 2JG1A 1RFVA 3RREA 3NBVA 4C5JA 2WJPA 2Y68A 1RFUA 5BYFA 5C40A 4XF6A 3UQ6A 3H74A 3I3YA 4K9IA 3BF5A 3FHXA 4JJPA 4QF5A 1YHJA 2X5OA 4K9CA 1GQTA 3HJ6A 5EYNA 3RRFA 1UB0A 3RS8A 2JG5A 3UQEA 1YGKA 5A5FA 1KYHA 2AB8A 2UAGA 3NC2A 4E8WA 4DU5A 2JFFA 2XPCA 4K93A 1TZ6A 4BUCA 1LIKA 4O1GA 2PKKA 3PZSA 5EY7A 4WJMA 5F0ZA 1EKQA 2A9YA 2C49A 2GC5A 5CM5A 3IH0A 4C5LA 1JBWA 3K9EA 3LK7A
chains in the Genus database with same CATH topology
5BYEA 3QAIA 3H49A 3DRWA 4GM6A 3RSFA 2YXTA 5TRWA 3RRBA 4K8PA 3HICA 2JGVA 4N08A 5CGEA 1ESJA 3GO6A 3B1OA 4C5MA 3RU3A 3RO4A 3RPHA 2AFBA 2DCNA 3VAQA 4E8YA 1RFTA 3RU2A 5BYDA 3KEUA 1VI9A 3IBQA 4O1LA 3NL6A 4S1IB 3PL2A 4EOHA 5F11A 5COJA 3EWMA 3KTNA 2AX3A 3RQXA 3Q92A 2I6AA 3KZHA 3NC9A 3NM1A 4S1MA 3BGKA 2R3EA 3MBJA 3HYOA 4DC3A 1LIOA 1EKKA 3ZS7A 2AA0A 3UBOA 1V1BA 3RTDA 2AJPA 3JULA 1VM7A 3RM5A 3RQ5A 3GBUA 3B1NA 4S1IA 4YL5A 4LCAA 2QHPA 1RK2A 4KALA 4C5KA 2NWHA 3IQ0A 1BX4A 4KAHA 4JKSA 4XF7A 2VARA 3NL2A 1RKSA 4KBEA 5C41A 3UQ9A 1UA4A 3B1RA 1V19A 1WYEA 2HW1A 3B3LA 4E84A 2PKFA 4XDAA 3NCAA 4S1HA 3RTGA 4PVVA 2PKNA 2DDMA 2I5BA 3RQQA 1JXHA 3HPDA 3RRJA 4E69A 3KD6A 1U2XA 3CQDA 2DDOA 3QA2A 2RBCA 3LHXA 3RQ2A 3UMOA 3IE7A 3VASA 3RY7A 5C3ZA 4EUMA 5B6AA 4XCKA 1L2LA 3RTEA 4E3AA 3LKIA 1ESQA 3RSGA 3RQHA 1JXIA 2F7KA 1DGMA 3RPZA 3RS9A 2F02A 4B8SA 3NBWA 3NL5A 4LBGA 3MBHA 3RQ8A 3RTAA 1GC5A 4C5NA 1V1AA 3DZVA 3RTCA 3K5WA 4LBXA 3UMPA 3UQDA 2HQQA 4LC4A 3GO7A 2V78A 4KADA 3LJSA 4K8TA 4YWRA 4B8RA 3N1CA 2ABSA 2QCVA 4N09A 1YGJA 3RT7A 2C4EA 1TD2A 2YXUA 2Q5RA 2A9ZA 1RKDA 4K8KA 3RQ6A 4JKUA 3NL3A 1LHPA 1VK4A 2XTBA 1TZ3A 4EBUA 2AWDA 4UBEA 1RKAA 4KANA 4EN4A 2DDWA 3IKHA 4K8CA 1LIIA 2FV7A 3RT9A 5BYCA 2PKMA 3LOOA 3IN1A 1LIJA 2AJRA 2I6BA 3B1PA 4X8FA 3RSQA 4U7XA 3Q1YA 5C3YA 1TYYA 3B1QA 5TQIA 2R3BA 2HLZA 1LHRA 3RTBA 4E8ZA 3RSSA 3NM3A 3OTXA 3FHYA 5CGAA 1C3QA 2ABQA 1V1SA 3RREA 2JG1A 4C5JA 1RFVA 3NBVA 5BYFA 1RFUA 5C40A 4XF6A 3UQ6A 3H74A 3I3YA 4K9IA 3BF5A 3FHXA 4JJPA 1YHJA 4K9CA 5EYNA 1GQTA 3HJ6A 3RRFA 3RS8A 1UB0A 3UQEA 2JG5A 3W4SA 1YGKA 1KYHA 2AB8A 3NC2A 4E8WA 4DU5A 4K93A 1TZ6A 1LIKA 4O1GA 2PKKA 3PZSA 5EY7A 4WJMA 5F0ZA 1EKQA 2A9YA 2C49A 4C5LA 5CM5A 3IH0A 3K9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BYE A;  3QAI A;  3H49 A;  3DRW A;  4GM6 A;  3RSF A;  2YXT A;  5TRW A;  3RRB A;  4K8P A;  3HIC A;  2JGV A;  4N08 A;  5CGE A;  1ESJ A;  3GO6 A;  3B1O A;  4C5M A;  3RU3 A;  3RO4 A;  3RPH A;  2AFB A;  2DCN A;  3VAQ A;  4E8Y A;  1RFT A;  3RU2 A;  5BYD A;  3KEU A;  1VI9 A;  3IBQ A;  4O1L A;  3NL6 A;  4S1I B;  3PL2 A;  4EOH A;  5F11 A;  5COJ A;  3EWM A;  3KTN A;  2AX3 A;  3RQX A;  3Q92 A;  2I6A A;  3KZH A;  3NC9 A;  3NM1 A;  4S1M A;  3BGK A;  2R3E A;  3MBJ A;  3HYO A;  4DC3 A;  1LIO A;  1EKK A;  3ZS7 A;  2AA0 A;  3UBO A;  1V1B A;  3RTD A;  2AJP A;  3JUL A;  1VM7 A;  3RM5 A;  3RQ5 A;  3GBU A;  3B1N A;  4S1I A;  4YL5 A;  4LCA A;  2QHP A;  1RK2 A;  4KAL A;  4C5K A;  2NWH A;  3IQ0 A;  1BX4 A;  4KAH A;  4JKS A;  4XF7 A;  2VAR A;  3NL2 A;  1RKS A;  4KBE A;  5C41 A;  3UQ9 A;  1UA4 A;  3B1R A;  1V19 A;  1WYE A;  2HW1 A;  3B3L A;  4E84 A;  2PKF A;  4XDA A;  3NCA A;  4S1H A;  3RTG A;  4PVV A;  2PKN A;  2DDM A;  2I5B A;  3RQQ A;  1JXH A;  3HPD A;  3RRJ A;  4E69 A;  3KD6 A;  1U2X A;  3CQD A;  2DDO A;  3QA2 A;  2RBC A;  3LHX A;  3RQ2 A;  3UMO A;  3IE7 A;  3VAS A;  3RY7 A;  5C3Z A;  4EUM A;  5B6A A;  4XCK A;  1L2L A;  3RTE A;  4E3A A;  3LKI A;  1ESQ A;  3RSG A;  3RQH A;  1JXI A;  2F7K A;  1DGM A;  3RPZ A;  3RS9 A;  2F02 A;  4B8S A;  3NBW A;  3NL5 A;  4LBG A;  3MBH A;  3RQ8 A;  3RTA A;  1GC5 A;  4C5N A;  1V1A A;  3DZV A;  3RTC A;  3K5W A;  4LBX A;  3UMP A;  3UQD A;  2HQQ A;  4LC4 A;  3GO7 A;  2V78 A;  4KAD A;  3LJS A;  4K8T A;  4YWR A;  4B8R A;  3N1C A;  2ABS A;  2QCV A;  4N09 A;  1YGJ A;  3RT7 A;  2C4E A;  1TD2 A;  2YXU A;  2Q5R A;  2A9Z A;  1RKD A;  4K8K A;  3RQ6 A;  4JKU A;  3NL3 A;  1LHP A;  1VK4 A;  2XTB A;  1TZ3 A;  4EBU A;  2AWD A;  4UBE A;  1RKA A;  4KAN A;  4EN4 A;  2DDW A;  3IKH A;  4K8C A;  1LII A;  2FV7 A;  3RT9 A;  5BYC A;  2PKM A;  3LOO A;  3IN1 A;  1LIJ A;  2AJR A;  2I6B A;  3B1P A;  4X8F A;  3RSQ A;  4U7X A;  3Q1Y A;  5C3Y A;  1TYY A;  3B1Q A;  5TQI A;  2R3B A;  2HLZ A;  1LHR A;  3RTB A;  4E8Z A;  3RSS A;  3NM3 A;  3OTX A;  3FHY A;  5CGA A;  1C3Q A;  2ABQ A;  1V1S A;  3RRE A;  2JG1 A;  1RFV A;  3NBV A;  5BYF A;  1RFU A;  5C40 A;  4XF6 A;  3UQ6 A;  3H74 A;  3I3Y A;  4K9I A;  3BF5 A;  3FHX A;  4JJP A;  1YHJ A;  4K9C A;  5EYN A;  1GQT A;  3RRF A;  3RS8 A;  3UQE A;  1UB0 A;  3W4S A;  2JG5 A;  4C5J A;  1YGK A;  1KYH A;  2AB8 A;  3NC2 A;  4E8W A;  4DU5 A;  4K93 A;  1TZ6 A;  1LIK A;  4O1G A;  2PKK A;  3PZS A;  5EY7 A;  4WJM A;  5F0Z A;  1EKQ A;  2A9Y A;  2C49 A;  4C5L A;  5CM5 A;  3IH0 A;  3K9E A; 
#chains in the Genus database with same CATH topology
 1GQY A;  5BYE A;  3QAI A;  2GCA A;  3H49 A;  3DRW A;  4UAG A;  2Y1O A;  4GM6 A;  3RSF A;  2Y66 A;  1J6U A;  2YXT A;  5TRW A;  3RRB A;  4K8P A;  2UUO A;  3HIC A;  3W4S A;  2JGV A;  4N08 A;  3EAG A;  1ESJ A;  3N2A A;  5CGE A;  3GO6 A;  3ZM5 A;  2AM1 A;  3B1O A;  4C5M A;  2XJA A;  3RU3 A;  3RO4 A;  3RPH A;  2DCN A;  2AFB A;  3HN7 A;  3VAQ A;  1RFT A;  4E8Y A;  3RU2 A;  1W78 A;  5BYD A;  3KEU A;  1VI9 A;  2GC6 A;  3IBQ A;  1O5Z A;  3NL6 A;  4O1L A;  3PL2 A;  4S1I B;  4EOH A;  5F11 A;  2VOR A;  5COJ A;  3EWM A;  3KTN A;  2AX3 A;  3RQX A;  3ZM6 A;  2VTD A;  3Q92 A;  2I6A A;  3KZH A;  2JFH A;  2Y67 A;  3NC9 A;  3NM1 A;  3QCZ A;  1P31 A;  4S1M A;  3BGK A;  2R3E A;  3MBJ A;  3HYO A;  4DC3 A;  1LIO A;  1EKK A;  3ZS7 A;  2AA0 A;  3UBO A;  1V1B A;  3RTD A;  2AJP A;  3JUL A;  1JBV A;  1VM7 A;  3RM5 A;  3RQ5 A;  3GBU A;  3B1N A;  4S1I A;  4YL5 A;  4CVM A;  1GG4 A;  4CVK A;  4LCA A;  2QHP A;  1RK2 A;  4KAL A;  4C5K A;  2NWH A;  3IQ0 A;  1BX4 A;  4KAH A;  4JKS A;  4XF7 A;  3ZL8 A;  2VAR A;  3NL2 A;  1RKS A;  4KBE A;  5C41 A;  3UQ9 A;  1UA4 A;  3B1R A;  1V19 A;  1WYE A;  2HW1 A;  3B3L A;  4E84 A;  2PKF A;  4XDA A;  3NCA A;  4S1H A;  3RTG A;  4BUB A;  4PVV A;  2PKN A;  5A5E A;  2DDM A;  2I5B A;  3RQQ A;  1JXH A;  3HPD A;  2VOS A;  3RRJ A;  3KD6 A;  4E69 A;  1U2X A;  3CQD A;  2DDO A;  3QA2 A;  2RBC A;  3LHX A;  2JFG A;  3RQ2 A;  3UMO A;  3IE7 A;  3VAS A;  3RY7 A;  5C3Z A;  4EUM A;  5B6A A;  4XCK A;  1L2L A;  2UUP A;  3RTE A;  4E3A A;  3LKI A;  1ESQ A;  3RSG A;  4C13 A;  3RQH A;  1JXI A;  2F7K A;  1DGM A;  3RPZ A;  3RS9 A;  2F02 A;  4B8S A;  3NBW A;  3NL5 A;  4LBG A;  1FGS A;  3MBH A;  3RQ8 A;  3RTA A;  1GC5 A;  4C5N A;  1V1A A;  3DZV A;  3RTC A;  3K5W A;  1GQQ A;  4LBX A;  3UMP A;  3UQD A;  2HQQ A;  4LC4 A;  4C12 A;  3GO7 A;  2V78 A;  4KAD A;  3LJS A;  4K8T A;  4QDI A;  4YWR A;  4B8R A;  3N1C A;  2ABS A;  2QCV A;  3UAG A;  4N09 A;  1YGJ A;  2AM2 A;  3RT7 A;  2C4E A;  1TD2 A;  2YXU A;  2GCB A;  1E0D A;  2Q5R A;  2A9Z A;  1RKD A;  4K8K A;  3RQ6 A;  4JKU A;  3NL3 A;  1LHP A;  1VK4 A;  2WTZ A;  2XTB A;  1TZ3 A;  4EBU A;  2AWD A;  4UBE A;  1RKA A;  4KAN A;  4EN4 A;  2DDW A;  3IKH A;  4K8C A;  1LII A;  2FV7 A;  4ZIY A;  3RT9 A;  2PKM A;  3LOO A;  4HV4 A;  5BYC A;  1UAG A;  3IN1 A;  1LIJ A;  2AJR A;  2I6B A;  3B1P A;  4X8F A;  3RSQ A;  4U7X A;  3Q1Y A;  5C3Y A;  1TYY A;  3B1Q A;  5TQI A;  2R3B A;  2HLZ A;  1LHR A;  4CVL A;  3PYZ A;  3RTB A;  4E8Z A;  3NRS A;  1P3D A;  1EEH A;  3RSS A;  3NM3 A;  3OTX A;  3FHY A;  2VTE A;  5CGA A;  1C3Q A;  2ABQ A;  1E8C A;  1V1S A;  1W7K A;  2F00 A;  2JG1 A;  1RFV A;  3RRE A;  3NBV A;  4C5J A;  2WJP A;  2Y68 A;  1RFU A;  5BYF A;  5C40 A;  4XF6 A;  3UQ6 A;  3H74 A;  3I3Y A;  4K9I A;  3BF5 A;  3FHX A;  4JJP A;  4QF5 A;  1YHJ A;  2X5O A;  4K9C A;  1GQT A;  3HJ6 A;  5EYN A;  3RRF A;  1UB0 A;  3RS8 A;  2JG5 A;  3UQE A;  1YGK A;  5A5F A;  1KYH A;  2AB8 A;  2UAG A;  3NC2 A;  4E8W A;  4DU5 A;  2JFF A;  2XPC A;  4K93 A;  1TZ6 A;  4BUC A;  1LIK A;  4O1G A;  2PKK A;  3PZS A;  5EY7 A;  4WJM A;  5F0Z A;  1EKQ A;  2A9Y A;  2C49 A;  2GC5 A;  5CM5 A;  3IH0 A;  4C5L A;  1JBW A;  3K9E A;  3LK7 A; 
#chains in the Genus database with same CATH homology
 5BYE A;  3QAI A;  3H49 A;  3DRW A;  4GM6 A;  3RSF A;  2YXT A;  5TRW A;  3RRB A;  4K8P A;  3HIC A;  2JGV A;  4N08 A;  5CGE A;  1ESJ A;  3GO6 A;  3B1O A;  4C5M A;  3RU3 A;  3RO4 A;  3RPH A;  2AFB A;  2DCN A;  3VAQ A;  4E8Y A;  1RFT A;  3RU2 A;  5BYD A;  3KEU A;  1VI9 A;  3IBQ A;  4O1L A;  3NL6 A;  4S1I B;  3PL2 A;  4EOH A;  5F11 A;  5COJ A;  3EWM A;  3KTN A;  2AX3 A;  3RQX A;  3Q92 A;  2I6A A;  3KZH A;  3NC9 A;  3NM1 A;  4S1M A;  3BGK A;  2R3E A;  3MBJ A;  3HYO A;  4DC3 A;  1LIO A;  1EKK A;  3ZS7 A;  2AA0 A;  3UBO A;  1V1B A;  3RTD A;  2AJP A;  3JUL A;  1VM7 A;  3RM5 A;  3RQ5 A;  3GBU A;  3B1N A;  4S1I A;  4YL5 A;  4LCA A;  2QHP A;  1RK2 A;  4KAL A;  4C5K A;  2NWH A;  3IQ0 A;  1BX4 A;  4KAH A;  4JKS A;  4XF7 A;  2VAR A;  3NL2 A;  1RKS A;  4KBE A;  5C41 A;  3UQ9 A;  1UA4 A;  3B1R A;  1V19 A;  1WYE A;  2HW1 A;  3B3L A;  4E84 A;  2PKF A;  4XDA A;  3NCA A;  4S1H A;  3RTG A;  4PVV A;  2PKN A;  2DDM A;  2I5B A;  3RQQ A;  1JXH A;  3HPD A;  3RRJ A;  4E69 A;  3KD6 A;  1U2X A;  3CQD A;  2DDO A;  3QA2 A;  2RBC A;  3LHX A;  3RQ2 A;  3UMO A;  3IE7 A;  3VAS A;  3RY7 A;  5C3Z A;  4EUM A;  5B6A A;  4XCK A;  1L2L A;  3RTE A;  4E3A A;  3LKI A;  1ESQ A;  3RSG A;  3RQH A;  1JXI A;  2F7K A;  1DGM A;  3RPZ A;  3RS9 A;  2F02 A;  4B8S A;  3NBW A;  3NL5 A;  4LBG A;  3MBH A;  3RQ8 A;  3RTA A;  1GC5 A;  4C5N A;  1V1A A;  3DZV A;  3RTC A;  3K5W A;  4LBX A;  3UMP A;  3UQD A;  2HQQ A;  4LC4 A;  3GO7 A;  2V78 A;  4KAD A;  3LJS A;  4K8T A;  4YWR A;  4B8R A;  3N1C A;  2ABS A;  2QCV A;  4N09 A;  1YGJ A;  3RT7 A;  2C4E A;  1TD2 A;  2YXU A;  2Q5R A;  2A9Z A;  1RKD A;  4K8K A;  3RQ6 A;  4JKU A;  3NL3 A;  1LHP A;  1VK4 A;  2XTB A;  1TZ3 A;  4EBU A;  2AWD A;  4UBE A;  1RKA A;  4KAN A;  4EN4 A;  2DDW A;  3IKH A;  4K8C A;  1LII A;  2FV7 A;  3RT9 A;  5BYC A;  2PKM A;  3LOO A;  3IN1 A;  1LIJ A;  2AJR A;  2I6B A;  3B1P A;  4X8F A;  3RSQ A;  4U7X A;  3Q1Y A;  5C3Y A;  1TYY A;  3B1Q A;  5TQI A;  2R3B A;  2HLZ A;  1LHR A;  3RTB A;  4E8Z A;  3RSS A;  3NM3 A;  3OTX A;  3FHY A;  5CGA A;  1C3Q A;  2ABQ A;  1V1S A;  3RRE A;  2JG1 A;  4C5J A;  1RFV A;  3NBV A;  5BYF A;  1RFU A;  5C40 A;  4XF6 A;  3UQ6 A;  3H74 A;  3I3Y A;  4K9I A;  3BF5 A;  3FHX A;  4JJP A;  1YHJ A;  4K9C A;  5EYN A;  1GQT A;  3HJ6 A;  3RRF A;  3RS8 A;  1UB0 A;  3UQE A;  2JG5 A;  3W4S A;  1YGK A;  1KYH A;  2AB8 A;  3NC2 A;  4E8W A;  4DU5 A;  4K93 A;  1TZ6 A;  1LIK A;  4O1G A;  2PKK A;  3PZS A;  5EY7 A;  4WJM A;  5F0Z A;  1EKQ A;  2A9Y A;  2C49 A;  4C5L A;  5CM5 A;  3IH0 A;  3K9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...