3RY8A

Structural basis for norovirus inhibition and fucose mimicry by citrate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
314
structure length
310
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTVPGEGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for norovirus inhibition and fucose mimicry by citrate.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 69
structure length 310
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3ry8A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3ry8A01
4RDLA 4X7FA 4P26A 4Z4RA 4WZTA 3BY2A 3ASRA 5J3OA 4P1VA 3Q3AA 5F4OA 4RM0A 4X05A 3V7AA 3PVDA 4OPVA 4Z4UA 5IYNA 3BQJA 3SJPA 4X06A 4OPOA 3LQ6A 5IYPA 3ASQA 5IYWA 1IHMA 3BY1A 4RLZA 4OOSA 4Z4TA 3D26A 5KW9A 4WZKA 5IYRA 3PA2A 4RPBA 5F4JA 4X7CA 5BSXA 2ZL6A 3SEJA 3ASTA 4P12A 4ROXA 4QVJA 4RDKA 4QV2A 4P25A 4OOXA 3PA1A 3LQEA 4Z4VA 3SLDA 4RPDA 4OP7A 2OBTA 4X0CA 3ONUA 4Z4YA 5IYQA 4P2NA 4X07A 5BSYA 2ZL7A 4WZLA 3RY8A 3R6JA 4Z4SA 4X7DA 3R6KA 3Q6QA 4X7EA 3SKBA 3ASPA 4Z4WA 3PUNA 3Q39A 5E6TA 2ZL5A 5HZAA 3Q6RA 2OBRA 4QVAA 4OOVA 3ONYA 3SLNA 3Q38A 4WZEA 3PUMA 5HZBA 2OBSA 4Z4ZA 4P3IA 4OPSA 5F4MA 3ASSA 5J35A 4RDJA 4QUZA
chains in the Genus database with same CATH superfamily
2BPOA 4PAAA 1UMKA 2CC2A 3CP2A 1V0EA 1BPLA 1WP6A 4WZTA 4XL9A 3ASRA 4LC0A 1QUFA 1Q82D 1E3XA 1QG0A 3B78A 3JQQA 3Q3AA 4NBSA 4PGOA 3FKSA 2FX3A 3OE7A 5H5JA 2DCUA 1RQPA 4HE5A 1KD1D 2R6HA 4DNTB 3A8IA 3BQJA 4G7XA 1QVFB 1WSVA 1VQPB 1VLOA 2V4DA 1QFZA 3LQ6A 2X6WA 4ZGNB 4H9GA 1YJ9B 4XOTA 4QHYA 1V0FA 4EH1A 1RQRA 2V7XA 4ZCIA 3CCUB 3CC4B 4ZGQB 2VJJA 3E20A 4KKUA 4XN3A 3T51B 4Z4TA 2ZTGA 5KW9A 1DARA 2NV4A 1I7PA 3PA2A 4YALA 2VBVA 1EXMA 1IJFA 4TN1A 2VBUA 2VJIA 1PJ7A 3G4SB 3CPWB 2KVOA 3ZBUA 1XE1A 1Q7YD 1YJNB 4ACAA 3OEHA 2C2WA 4TMTA 2BM1A 2M5SA 3W5VA 2WJVA 2V7QA 1OHHA 4P9SA 1E63A 3LQEA 3SLDA 2D74A 2LZJA 5HKKA 1D1NA 3OPOA 2QTZA 4DQKA 4XQFA 1EP2B 2D3LA 2VZLA 1N06A 3AVXA 4LBWA 4MYUA 4P6YA 1FDRA 4XLHA 3CP8A 3WBJA 3WNCA 4P3YA 3CRZA 3V76A 3W2FA 2ZL7A 3OEEA 4G5GA 4ACBA 2BM0A 1VQ6B 2BVNA 3WXMA 1YJWB 1VQMB 4RD1A 1Y0YA 3CPXA 1B23P 1N08A 3CC7B 1VQ7B 3ES9A 3SJZA 1HZEA 4G1BA 1G7SA 1JB9A 2JIZA 1W2BB 4YHBA 3Q39A 4N3NA 4RD2A 4X8IA 3FPKA 3OW2B 2XZPA 1WOPA 3JQPA 5HZAA 3Q6RA 1E3ZA 3ONYA 1FNCA 1CNFA 5TRDA 3ZZTA 2XZLA 1W87A 1KK2A 3A8JA 1BQEA 1BJKA 3AVTA 1WU8A 3ZBTA 1QH0A 3BCFA 5TY0A 4F7DA 1F60A 1YIJB 5J35A 3WNBA 4G7WA 1ZM2A 4C0SA 4RD4A 4J0QA 2W6JA 4X7FA 1WDTA 4XD7A 1J9ZA 1WTHD 1NDHA 1Q9SA 1IJEA 2Z6BD 1QUEA 1AIPA 3CCMB 2XGJA 4XLEA 4XONA 1T5EA 1DDGA 4FN5A 2VNKA 1KK1A 4RM0A 5FO1A 3MHPA 5DSZA 1UD2A 1Q81D 2C4UA 1EP3B 1MRZA 4II2A 2X53S 3LO8A 1K73D 2X0KA 4OPVA 1JJ2B 5FNZA 4Y9RA 4YEJA 3U6BA 1GAQA 3BH4A 4KKTA 4LBVA 4II3A 1GAWA 4YAOA 1GR1A 5IYPA 5IYWA 1VQ9B 2DERA 1IHMA 3BY1A 3VMFA 4L8JA 4CQJA 4PC1A 3I55B 2DYIA 2PE3A 3CESA 3ZPNA 2QGGA 4QFMA 1QX4A 2DOGA 3BNWA 2FVGA 1FNMA 1E64A 1N07A 4RPBA 3WY9A 5BSXA 4FWTA 4HE6A 1SKQA 4PABA 4QVJA 4RDKA 4XLAA 3W5UA 1KK0A 3ZZUA 4P25A 2CRVA 4TKOB 1CQXA 3PA1A 1H85A 1VQLB 4M4SA 1KK3A 1FNBA 4DQLA 5HXBA 3FPPA 2VYQA 4YAFA 2QE7A 3MCAA 3W2EA 1FRQA 1R5OA 3GIRA 3KEWA 3QFTA 2WYRA 4Z4YA 1WSRA 1H42A 5FO0A 3BC9A 1N05A 2F4NA 2VNHA 1VQOB 4UZFA 5KNLA 2BN4A 1W9XA 5BSYA 2OTLB 5EMNA 1E1QA 3HAGA 2WSSA 3OAAA 2E1RA 2F1MA 4E0FA 1B2RA 4WZLA 4M53A 4PC6A 2YWEA 3R6JA 1BX1A 4Z4SA 4XLFA 2BSAA 4N3GA 5A8AA 2XNDA 4P22A 4B43A 4Y7CA 3GVJA 1EFRA 2V31A 3H94A 3OZWA 3Q6QA 3E1YE 3LNNA 2RC5A 2P3MA 3A35A 4K1XA 3QFSA 4WQMA 3G71B 4KKSA 3CMEB 3AVYA 3ASPA 2DEUA 3PUNA 1N8RD 4TT3A 1I8DA 2XZOA 4B3GA 1WOOA 3LVBA 5H59A 2Q6OA 4Q7JB 1VF7A 2QDXA 5CDFA 3CCEB 3CCQB 1A8PA 3A1PA 1PJ5A 3ISXA 3OJXA 3PUMA 4FK8A 4XM3A 5LMZA 3DDYA 1R5NA 5IK2A 5HZBA 4PC7A 1VQ5B 5F4MA 3ASSA 4QUZA 1KMHA 4TMXA 4RDLA 4Y9UA 2ZZQA 4P26A 3PENA 1TVCA 1H8EA 3P27A 3T56B 2WZNA 3OFNA 2OK8A 4XLCA 5GV7A 2B7CA 4M1KA 1YHQB 3WNDA 4PC2A 2D9RA 2OYNA 2V7WA 5DN6A 4X05A 5F4OA 3W2HA 3V7AA 3CMAB 2VBSA 4ZV4A 3CCJB 4RJLA 2CF4A 2YWGA 1G7TA 3PVDA 2WZPP 2GPJA 4Z4UA 1Q86D 5TV2A 4DK1A 3A3GA 3AVVA 1OB0A 4OPOA 4X06A 1HVXA 1E62A 2GJPA 2OK7A 4U9UA 1OB2A 3CC2B 1BX0A 4YELA 2ZZEA 4G6IA 3WQZA 1S4MA 4WWVA 4RLZA 4OOSA 3JU4A 2HDNB 2J7KA 2JDIA 1EWYA 1M90D 4TMVA 1ZM3A 3QSYA 1XB2A 3W2GA 3CD6B 1G7CA 1YI2B 1D8TA 1QGAA 3VO2A 4P12A 1N0VC 2DIEA 1ZM4A 1H8HA 1OGJA 1UD3A 5DS0A 1SKYB 2C5BA 1Y0RA 2PMDA 4M2LA 4NCNA 1GO2A 2XNJA 1R5BA 3VR6A 3QFRA 2ZZFA 4XN0A 4YXWA 2NPFA 1NJID 2OTJB 2OBTA 2GQFA 3H9NA 3ONUA 2BGJA 2WPDA 4MYTA 4RCZA 5IYQA 2B5OA 1VQKB 2QEXB 4X07A 1W0KA 2JN9A 2BF4A 2I1LA 2QTLA 3CXCB 3W2IA 2ZXHA 2QA4B 2X85A 2W6IA 4B48A 3QE2A 1XQBA 4C43A 3B8HA 2F1LA 3I1FA 1KZLA 2QMUA 1IB0A 4RD3A 1KTVA 3VNVA 1DDIA 4B47A 5FIUA 1DG1G 1KQSB 1T6XA 1YLOA 5A88A 3AVUA 1XFOA 4X7EA 3SKBA 5L46A 2BMWA 2F43A 1MABA 4HIZA 4P6VF 4Z4WA 2CW5A 3I56B 4DNRB 4YAUA 1QVGB 4XMYA 1K28D 2GJKA 1KRHA 4Z1MA 3CCVB 3GSIA 1S0UA 5A89A 2D3NA 3WBKA 4AF7A 1NB0A 2VNJA 4OOVA 1KJZA 1QGYA 3SLNA 2GJRA 3U2QA 3Q38A 3QFCA 4WZEA 2GK6A 4IW3B 2GK7A 2CK3A 4Z4ZA 4P3IA 4OPSA 3AVWA 3CCLB 1VQNB 4ASUA 2AHOA 4RDJA 3MMPA 3ASTA 3P26A 5JBQA 4RD6A 1E1RA 1JNYA 1E79A 2CNDA 4Z4RA 2ZTNA 3CW2A 3VO1A 1W0JA 4M0LA 1ZUNB 3OZUA 3BY2A 4LBZA 1CNEA 3CB4A 1SM4A 5J3OA 4P1VA 3AGPA 4TSFA 1AMOA 4AVZA 1NB9A 3G05A 1OB5A 1WPCA 3U6KA 1UD6A 1VQ8B 2Q6IA 4ZCLA 3AGQA 3A8KA 2PLFA 2EIXA 1ELOA 2ZXIA 5KSWB 4G1VA 2JJ2A 1NRKA 5IYNA 1M1KD 3OW7A 3SJPA 4NNJA 3KL9A 2VNIA 3ASQA 1T6ZA 3WYAA 1VHEA 1E43A 3CCSB 1U2RA 1WOSA 2YWHA 1FX0A 1JA0A 1VHOA 3D26A 3GVLA 2C78A 4WZKA 2DETA 5IYRA 3CCRB 1UD8A 3BCDA 1EP1B 5F4JA 4X7CA 4B3FX 1ZM9A 4B4DA 3ZZ0A 2ZL6A 1WORA 3SEJA 5TR9A 5THXA 2ZBVA 1D2EA 1VQ4B 4ROXA 1KC8D 1HA3A 2B7BA 3G6EB 1GJRA 4XKVA 1V5VA 1YX2A 2V7UA 1G7RA 3GQBA 4FXUA 2XOKA 4GQNA 4QV2A 2HLDA 2JJ1A 2X6YA 4OOXA 4PC3A 4R71A 1FNDA 1JA1A 1T6YA 1W35A 1EFCA 3GVKA 3JQRA 1OGIA 4Z4VA 4ZCMA 1VJSA 4XKWA 4RPDA 4XR6A 3W5HA 3J81k 2V7VA 2WR8A 4YAWA 5FL7A 4OP7A 4BPRA 2CBXA 2VBTA 4X0CA 4B44A 1NBMA 2GREA 5FA6A 2ZZGA 2XNCA 4XNFA 2R9VA 2Q6KA 3ZUGA 5AN9A 4P2NA 1S72B 1UD4A 4TMWA 1I18A 2XEXA 1N0UA 3ZIAA 4TMZA 1W34A 5GV8A 4UZEA 1EFUA 2ZITA 4RCYA 3FJOA 3RY8A 4XOPA 1QFJA 2RC6A 2BV3A 4X7DA 3R6KA 3ZC3A 1PKVA 3OOCA 1YITB 2QN6A 4AC9A 3B82A 1EFTA 1QGZA 1VLYA 3T53B 2X8KA 2DY1A 2X3UA 3OKXA 2PIAA 2C5HA 1UD5A 1BLIA 2C4TA 1TUIA 2V7TA 2ZBUA 2ZL5A 5E6TA 2HCJB 1K8AD 2C77A 2BGIA 1FRNA 3OJWA 4RD0A 1QFYA 3OP1A 1P4MA 3NE5B 4LBYA 3A3BA 2OBRA 3OZVA 4DK0A 2YWFA 4QVAA 3VNUA 1TLLA 4AF6A 2E1BA 3CMMA 1COWA 2EFGA 1F20A 1TTTA 2X6XA 4UZUA 1BMFA 2WJYA 4XORA 4B3XA 5B6IA 2OBSA 2Q6LA 1K9MD 3CTAA 1GVHA 4JMQA 4UAJA 1PJ6A 2HMAA
chains in the Genus database with same CATH topology
4RDLA 4X7FA 4P26A 4Z4RA 4WZTA 3BY2A 3ASRA 5J3OA 4P1VA 3Q3AA 5F4OA 4RM0A 4X05A 3V7AA 3PVDA 4OPVA 4Z4UA 5IYNA 3BQJA 3SJPA 4X06A 4OPOA 3LQ6A 5IYPA 3ASQA 5IYWA 1IHMA 3BY1A 4RLZA 4OOSA 4Z4TA 3D26A 5KW9A 4WZKA 5IYRA 3PA2A 4RPBA 5F4JA 4X7CA 5BSXA 2ZL6A 3SEJA 3ASTA 4P12A 4ROXA 4QVJA 4RDKA 4QV2A 4P25A 4OOXA 3PA1A 3LQEA 4Z4VA 3SLDA 4RPDA 4OP7A 2OBTA 4X0CA 3ONUA 4Z4YA 5IYQA 4P2NA 4X07A 5BSYA 2ZL7A 4WZLA 3RY8A 3R6JA 4Z4SA 4X7DA 3R6KA 3Q6QA 4X7EA 3SKBA 3ASPA 4Z4WA 3PUNA 3Q39A 5E6TA 2ZL5A 5HZAA 3Q6RA 2OBRA 4QVAA 4OOVA 3ONYA 3SLNA 3Q38A 4WZEA 3PUMA 5HZBA 2OBSA 4Z4ZA 4P3IA 4OPSA 5F4MA 3ASSA 5J35A 4RDJA 4QUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RDL A;  4X7F A;  4P26 A;  4Z4R A;  4WZT A;  3BY2 A;  3ASR A;  5J3O A;  4P1V A;  3Q3A A;  5F4O A;  4RM0 A;  4X05 A;  3V7A A;  3PVD A;  4OPV A;  4Z4U A;  5IYN A;  3BQJ A;  3SJP A;  4X06 A;  4OPO A;  3LQ6 A;  5IYP A;  3ASQ A;  5IYW A;  1IHM A;  3BY1 A;  4RLZ A;  4OOS A;  4Z4T A;  3D26 A;  5KW9 A;  4WZK A;  5IYR A;  3PA2 A;  4RPB A;  5F4J A;  4X7C A;  5BSX A;  2ZL6 A;  3SEJ A;  3AST A;  4P12 A;  4ROX A;  4QVJ A;  4RDK A;  4QV2 A;  4P25 A;  4OOX A;  3PA1 A;  3LQE A;  4Z4V A;  3SLD A;  4RPD A;  4OP7 A;  2OBT A;  4X0C A;  3ONU A;  4Z4Y A;  5IYQ A;  4P2N A;  4X07 A;  5BSY A;  2ZL7 A;  4WZL A;  3RY8 A;  3R6J A;  4Z4S A;  4X7D A;  3R6K A;  3Q6Q A;  4X7E A;  3SKB A;  3ASP A;  4Z4W A;  3PUN A;  3Q39 A;  5E6T A;  2ZL5 A;  5HZA A;  3Q6R A;  2OBR A;  4QVA A;  4OOV A;  3ONY A;  3SLN A;  3Q38 A;  4WZE A;  3PUM A;  5HZB A;  2OBS A;  4Z4Z A;  4P3I A;  4OPS A;  5F4M A;  3ASS A;  5J35 A;  4RDJ A;  4QUZ A; 
#chains in the Genus database with same CATH topology
 2BPO A;  4PAA A;  1UMK A;  2CC2 A;  3CP2 A;  1V0E A;  1BPL A;  1WP6 A;  4WZT A;  4XL9 A;  3ASR A;  4LC0 A;  1QUF A;  1Q82 D;  1E3X A;  1QG0 A;  3B78 A;  3JQQ A;  3Q3A A;  4NBS A;  4PGO A;  3FKS A;  2FX3 A;  3OE7 A;  5H5J A;  2DCU A;  1RQP A;  4HE5 A;  1KD1 D;  2R6H A;  4DNT B;  3A8I A;  3BQJ A;  4G7X A;  1QVF B;  1WSV A;  1VQP B;  1VLO A;  2V4D A;  1QFZ A;  3LQ6 A;  2X6W A;  4ZGN B;  4H9G A;  1YJ9 B;  4XOT A;  4QHY A;  1V0F A;  4EH1 A;  1RQR A;  2V7X A;  4ZCI A;  3CCU B;  3CC4 B;  4ZGQ B;  2VJJ A;  3E20 A;  4KKU A;  4XN3 A;  3T51 B;  4Z4T A;  2ZTG A;  5KW9 A;  1DAR A;  2NV4 A;  1I7P A;  3PA2 A;  4YAL A;  2VBV A;  1EXM A;  1IJF A;  4TN1 A;  2VBU A;  2VJI A;  1PJ7 A;  3G4S B;  3CPW B;  2KVO A;  3ZBU A;  1XE1 A;  1Q7Y D;  1YJN B;  4ACA A;  3OEH A;  2C2W A;  4TMT A;  2BM1 A;  2M5S A;  3W5V A;  2WJV A;  2V7Q A;  1OHH A;  4P9S A;  1E63 A;  3LQE A;  3SLD A;  2D74 A;  2LZJ A;  5HKK A;  1D1N A;  3OPO A;  2QTZ A;  4DQK A;  4XQF A;  1EP2 B;  2D3L A;  2VZL A;  1N06 A;  3AVX A;  4LBW A;  4MYU A;  4P6Y A;  1FDR A;  4XLH A;  3CP8 A;  3WBJ A;  3WNC A;  4P3Y A;  3CRZ A;  3V76 A;  3W2F A;  2ZL7 A;  3OEE A;  4G5G A;  4ACB A;  2BM0 A;  1VQ6 B;  2BVN A;  3WXM A;  1YJW B;  1VQM B;  4RD1 A;  1Y0Y A;  3CPX A;  1B23 P;  1N08 A;  3CC7 B;  1VQ7 B;  3ES9 A;  3SJZ A;  1HZE A;  4G1B A;  1G7S A;  1JB9 A;  2JIZ A;  1W2B B;  4YHB A;  3Q39 A;  4N3N A;  4RD2 A;  4X8I A;  3FPK A;  3OW2 B;  2XZP A;  1WOP A;  3JQP A;  5HZA A;  3Q6R A;  1E3Z A;  3ONY A;  1FNC A;  1CNF A;  5TRD A;  3ZZT A;  2XZL A;  1W87 A;  1KK2 A;  3A8J A;  1BQE A;  1BJK A;  3AVT A;  1WU8 A;  3ZBT A;  1QH0 A;  3BCF A;  5TY0 A;  4F7D A;  1F60 A;  1YIJ B;  5J35 A;  3WNB A;  4G7W A;  1ZM2 A;  4C0S A;  4RD4 A;  4J0Q A;  2W6J A;  4X7F A;  1WDT A;  4XD7 A;  1J9Z A;  1WTH D;  1NDH A;  1Q9S A;  1IJE A;  2Z6B D;  1QUE A;  1AIP A;  3CCM B;  2XGJ A;  4XLE A;  4XON A;  1T5E A;  1DDG A;  4FN5 A;  2VNK A;  1KK1 A;  4RM0 A;  5FO1 A;  3MHP A;  5DSZ A;  1UD2 A;  1Q81 D;  2C4U A;  1EP3 B;  1MRZ A;  4II2 A;  2X53 S;  3LO8 A;  1K73 D;  2X0K A;  4OPV A;  1JJ2 B;  5FNZ A;  4Y9R A;  4YEJ A;  3U6B A;  1GAQ A;  3BH4 A;  4KKT A;  4LBV A;  4II3 A;  1GAW A;  4YAO A;  1GR1 A;  5IYP A;  5IYW A;  1VQ9 B;  2DER A;  1IHM A;  3BY1 A;  3VMF A;  4L8J A;  4CQJ A;  4PC1 A;  3I55 B;  2DYI A;  2PE3 A;  3CES A;  3ZPN A;  2QGG A;  4QFM A;  1QX4 A;  2DOG A;  3BNW A;  2FVG A;  1FNM A;  1E64 A;  1N07 A;  4RPB A;  3WY9 A;  5BSX A;  4FWT A;  4HE6 A;  1SKQ A;  4PAB A;  4QVJ A;  4RDK A;  4XLA A;  3W5U A;  1KK0 A;  3ZZU A;  4P25 A;  2CRV A;  4TKO B;  1CQX A;  3PA1 A;  1H85 A;  1VQL B;  4M4S A;  1KK3 A;  1FNB A;  4DQL A;  5HXB A;  3FPP A;  2VYQ A;  4YAF A;  2QE7 A;  3MCA A;  3W2E A;  1FRQ A;  1R5O A;  3GIR A;  3KEW A;  3QFT A;  2WYR A;  4Z4Y A;  1WSR A;  1H42 A;  5FO0 A;  3BC9 A;  1N05 A;  2F4N A;  2VNH A;  1VQO B;  4UZF A;  5KNL A;  2BN4 A;  1W9X A;  5BSY A;  2OTL B;  5EMN A;  1E1Q A;  3HAG A;  2WSS A;  3OAA A;  2E1R A;  2F1M A;  4E0F A;  1B2R A;  4WZL A;  4M53 A;  4PC6 A;  2YWE A;  3R6J A;  1BX1 A;  4Z4S A;  4XLF A;  2BSA A;  4N3G A;  5A8A A;  2XND A;  4P22 A;  4B43 A;  4Y7C A;  3GVJ A;  1EFR A;  2V31 A;  3H94 A;  3OZW A;  3Q6Q A;  3E1Y E;  3LNN A;  2RC5 A;  2P3M A;  3A35 A;  4K1X A;  3QFS A;  4WQM A;  3G71 B;  4KKS A;  3CME B;  3AVY A;  3ASP A;  2DEU A;  3PUN A;  1N8R D;  4TT3 A;  1I8D A;  2XZO A;  4B3G A;  1WOO A;  3LVB A;  5H59 A;  2Q6O A;  4Q7J B;  1VF7 A;  2QDX A;  5CDF A;  3CCE B;  3CCQ B;  1A8P A;  3A1P A;  1PJ5 A;  3ISX A;  3OJX A;  3PUM A;  4FK8 A;  4XM3 A;  5LMZ A;  3DDY A;  1R5N A;  5IK2 A;  5HZB A;  4PC7 A;  1VQ5 B;  5F4M A;  3ASS A;  4QUZ A;  1KMH A;  4TMX A;  4RDL A;  4Y9U A;  2ZZQ A;  4P26 A;  3PEN A;  1TVC A;  1H8E A;  3P27 A;  3T56 B;  2WZN A;  3OFN A;  2OK8 A;  4XLC A;  5GV7 A;  2B7C A;  4M1K A;  1YHQ B;  3WND A;  4PC2 A;  2D9R A;  2OYN A;  2V7W A;  5DN6 A;  4X05 A;  5F4O A;  3W2H A;  3V7A A;  3CMA B;  2VBS A;  4ZV4 A;  3CCJ B;  4RJL A;  2CF4 A;  2YWG A;  1G7T A;  3PVD A;  2WZP P;  2GPJ A;  4Z4U A;  1Q86 D;  5TV2 A;  4DK1 A;  3A3G A;  3AVV A;  1OB0 A;  4OPO A;  4X06 A;  1HVX A;  1E62 A;  2GJP A;  2OK7 A;  4U9U A;  1OB2 A;  3CC2 B;  1BX0 A;  4YEL A;  2ZZE A;  4G6I A;  3WQZ A;  1S4M A;  4WWV A;  4RLZ A;  4OOS A;  3JU4 A;  2HDN B;  2J7K A;  2JDI A;  1EWY A;  1M90 D;  4TMV A;  1ZM3 A;  3QSY A;  1XB2 A;  3W2G A;  3CD6 B;  1G7C A;  1YI2 B;  1D8T A;  1QGA A;  3VO2 A;  4P12 A;  1N0V C;  2DIE A;  1ZM4 A;  1H8H A;  1OGJ A;  1UD3 A;  5DS0 A;  1SKY B;  2C5B A;  1Y0R A;  2PMD A;  4M2L A;  4NCN A;  1GO2 A;  2XNJ A;  1R5B A;  3VR6 A;  3QFR A;  2ZZF A;  4XN0 A;  4YXW A;  2NPF A;  1NJI D;  2OTJ B;  2OBT A;  2GQF A;  3H9N A;  3ONU A;  2BGJ A;  2WPD A;  4MYT A;  4RCZ A;  5IYQ A;  2B5O A;  1VQK B;  2QEX B;  4X07 A;  1W0K A;  2JN9 A;  2BF4 A;  2I1L A;  2QTL A;  3CXC B;  3W2I A;  2ZXH A;  2QA4 B;  2X85 A;  2W6I A;  4B48 A;  3QE2 A;  1XQB A;  4C43 A;  3B8H A;  2F1L A;  3I1F A;  1KZL A;  2QMU A;  1IB0 A;  4RD3 A;  1KTV A;  3VNV A;  1DDI A;  4B47 A;  5FIU A;  1DG1 G;  1KQS B;  1T6X A;  1YLO A;  5A88 A;  3AVU A;  1XFO A;  4X7E A;  3SKB A;  5L46 A;  2BMW A;  2F43 A;  1MAB A;  4HIZ A;  4P6V F;  4Z4W A;  2CW5 A;  3I56 B;  4DNR B;  4YAU A;  1QVG B;  4XMY A;  1K28 D;  2GJK A;  1KRH A;  4Z1M A;  3CCV B;  3GSI A;  1S0U A;  5A89 A;  2D3N A;  3WBK A;  4AF7 A;  1NB0 A;  2VNJ A;  4OOV A;  1KJZ A;  1QGY A;  3SLN A;  2GJR A;  3U2Q A;  3Q38 A;  3QFC A;  4WZE A;  2GK6 A;  4IW3 B;  2GK7 A;  2CK3 A;  4Z4Z A;  4P3I A;  4OPS A;  3AVW A;  3CCL B;  1VQN B;  4ASU A;  2AHO A;  4RDJ A;  3MMP A;  3AST A;  3P26 A;  5JBQ A;  4RD6 A;  1E1R A;  1JNY A;  1E79 A;  2CND A;  4Z4R A;  2ZTN A;  3CW2 A;  3VO1 A;  1W0J A;  4M0L A;  1ZUN B;  3OZU A;  3BY2 A;  4LBZ A;  1CNE A;  3CB4 A;  1SM4 A;  5J3O A;  4P1V A;  3AGP A;  4TSF A;  1AMO A;  4AVZ A;  1NB9 A;  3G05 A;  1OB5 A;  1WPC A;  3U6K A;  1UD6 A;  1VQ8 B;  2Q6I A;  4ZCL A;  3AGQ A;  3A8K A;  2PLF A;  2EIX A;  1ELO A;  2ZXI A;  5KSW B;  4G1V A;  2JJ2 A;  1NRK A;  5IYN A;  1M1K D;  3OW7 A;  3SJP A;  4NNJ A;  3KL9 A;  2VNI A;  3ASQ A;  1T6Z A;  3WYA A;  1VHE A;  1E43 A;  3CCS B;  1U2R A;  1WOS A;  2YWH A;  1FX0 A;  1JA0 A;  1VHO A;  3D26 A;  3GVL A;  2C78 A;  4WZK A;  2DET A;  5IYR A;  3CCR B;  1UD8 A;  3BCD A;  1EP1 B;  5F4J A;  4X7C A;  4B3F X;  1ZM9 A;  4B4D A;  3ZZ0 A;  2ZL6 A;  1WOR A;  3SEJ A;  5TR9 A;  5THX A;  2ZBV A;  1D2E A;  1VQ4 B;  4ROX A;  1KC8 D;  1HA3 A;  2B7B A;  3G6E B;  1GJR A;  4XKV A;  1V5V A;  1YX2 A;  2V7U A;  1G7R A;  3GQB A;  4FXU A;  2XOK A;  4GQN A;  4QV2 A;  2HLD A;  2JJ1 A;  2X6Y A;  4OOX A;  4PC3 A;  4R71 A;  1FND A;  1JA1 A;  1T6Y A;  1W35 A;  1EFC A;  3GVK A;  3JQR A;  1OGI A;  4Z4V A;  4ZCM A;  1VJS A;  4XKW A;  4RPD A;  4XR6 A;  3W5H A;  3J81 k;  2V7V A;  2WR8 A;  4YAW A;  5FL7 A;  4OP7 A;  4BPR A;  2CBX A;  2VBT A;  4X0C A;  4B44 A;  1NBM A;  2GRE A;  5FA6 A;  2ZZG A;  2XNC A;  4XNF A;  2R9V A;  2Q6K A;  3ZUG A;  5AN9 A;  4P2N A;  1S72 B;  1UD4 A;  4TMW A;  1I18 A;  2XEX A;  1N0U A;  3ZIA A;  4TMZ A;  1W34 A;  5GV8 A;  4UZE A;  1EFU A;  2ZIT A;  4RCY A;  3FJO A;  3RY8 A;  4XOP A;  1QFJ A;  2RC6 A;  2BV3 A;  4X7D A;  3R6K A;  3ZC3 A;  1PKV A;  3OOC A;  1YIT B;  2QN6 A;  4AC9 A;  3B82 A;  1EFT A;  1QGZ A;  1VLY A;  3T53 B;  2X8K A;  2DY1 A;  2X3U A;  3OKX A;  2PIA A;  2C5H A;  1UD5 A;  1BLI A;  2C4T A;  1TUI A;  2V7T A;  2ZBU A;  2ZL5 A;  5E6T A;  2HCJ B;  1K8A D;  2C77 A;  2BGI A;  1FRN A;  3OJW A;  4RD0 A;  1QFY A;  3OP1 A;  1P4M A;  3NE5 B;  4LBY A;  3A3B A;  2OBR A;  3OZV A;  4DK0 A;  2YWF A;  4QVA A;  3VNU A;  1TLL A;  4AF6 A;  2E1B A;  3CMM A;  1COW A;  2EFG A;  1F20 A;  1TTT A;  2X6X A;  4UZU A;  1BMF A;  2WJY A;  4XOR A;  4B3X A;  5B6I A;  2OBS A;  2Q6L A;  1K9M D;  3CTA A;  1GVH A;  4JMQ A;  4UAJ A;  1PJ6 A;  2HMA A; 
#chains in the Genus database with same CATH homology
 4RDL A;  4X7F A;  4P26 A;  4Z4R A;  4WZT A;  3BY2 A;  3ASR A;  5J3O A;  4P1V A;  3Q3A A;  5F4O A;  4RM0 A;  4X05 A;  3V7A A;  3PVD A;  4OPV A;  4Z4U A;  5IYN A;  3BQJ A;  3SJP A;  4X06 A;  4OPO A;  3LQ6 A;  5IYP A;  3ASQ A;  5IYW A;  1IHM A;  3BY1 A;  4RLZ A;  4OOS A;  4Z4T A;  3D26 A;  5KW9 A;  4WZK A;  5IYR A;  3PA2 A;  4RPB A;  5F4J A;  4X7C A;  5BSX A;  2ZL6 A;  3SEJ A;  3AST A;  4P12 A;  4ROX A;  4QVJ A;  4RDK A;  4QV2 A;  4P25 A;  4OOX A;  3PA1 A;  3LQE A;  4Z4V A;  3SLD A;  4RPD A;  4OP7 A;  2OBT A;  4X0C A;  3ONU A;  4Z4Y A;  5IYQ A;  4P2N A;  4X07 A;  5BSY A;  2ZL7 A;  4WZL A;  3RY8 A;  3R6J A;  4Z4S A;  4X7D A;  3R6K A;  3Q6Q A;  4X7E A;  3SKB A;  3ASP A;  4Z4W A;  3PUN A;  3Q39 A;  5E6T A;  2ZL5 A;  5HZA A;  3Q6R A;  2OBR A;  4QVA A;  4OOV A;  3ONY A;  3SLN A;  3Q38 A;  4WZE A;  3PUM A;  5HZB A;  2OBS A;  4Z4Z A;  4P3I A;  4OPS A;  5F4M A;  3ASS A;  5J35 A;  4RDJ A;  4QUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...