3RY8A

Structural basis for norovirus inhibition and fucose mimicry by citrate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
314
structure length
310
Chain Sequence
KPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTTQLLPTGICAFRGKVTQQVQGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQIYGVISQRNTNTVPGEGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPTKFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKGGYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVARNSAGPVVAPTNGYFRFDSWVNQFYTLAPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for norovirus inhibition and fucose mimicry by citrate.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Viral protein
molecule keywords Capsid protein
total genus 69
structure length 310
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 3ry8A02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 3ry8A01
4ROXA 4Z4RA 2ZL7A 5HZBA 4P1VA 4P25A 4Z4SA 4Z4WA 4QVJA 3R6KA 4RM0A 3PUMA 4P2NA 3ASQA 4WZTA 3Q6QA 4Z4VA 4OPSA 4WZKA 3Q3AA 3LQ6A 4WZLA 3LQEA 5BSXA 4X7CA 3RY8A 3SJPA 3PUNA 4P12A 4X7FA 3ONUA 4Z4YA 2OBRA 5IYWA 5HZAA 5KW9A 3BQJA 3Q38A 3SLDA 1IHMA 2ZL5A 4X7EA 4OOSA 3SLNA 4OP7A 5J35A 4X05A 3SKBA 3R6JA 2ZL6A 3ASTA 3BY1A 3ASPA 4OPVA 4P26A 4QVAA 3PA2A 5IYQA 5F4OA 5IYNA 5F4JA 3ASSA 5BSYA 5J3OA 4RPDA 4X06A 2OBTA 5F4MA 4RDJA 4OPOA 4RPBA 4Z4ZA 3ASRA 4OOVA 3PVDA 4X07A 3PA1A 4P3IA 3BY2A 4QUZA 3ONYA 4WZEA 4RDKA 2OBSA 4RLZA 4QV2A 5IYRA 3Q39A 4X0CA 3D26A 4Z4UA 3SEJA 4X7DA 3Q6RA 4Z4TA 3V7AA 4OOXA 5E6TA 4RDLA 5IYPA
chains in the Genus database with same CATH superfamily
4LBYA 1EXMA 4ROXA 3OKXA 2XNCA 1ZM9A 2P3MA 3CMMA 1EFTA 1WOOA 3OZWA 5KNLA 1OGIA 1YIJB 4M2LA 3FPKA 4ZV4A 3CB4A 1EWYA 4Z4WA 3CESA 1PJ6A 2WJYA 3R6KA 4RM0A 3QFSA 4H9GA 1M90D 3OOCA 4RD3A 2DEUA 2ZZGA 3WNBA 4DQLA 4HE5A 4N3GA 1YLOA 3H94A 4ACBA 4TSFA 1KD1D 1WOSA 1N07A 3ZZUA 1OHHA 2CBXA 4U9UA 1Q86D 1VQNB 1ZUNB 4TMTA 5FL7A 3Q3AA 1EP1B 1S4MA 4NCNA 4XQFA 3OJWA 1IJEA 2XNJA 4BPRA 3B78A 3OZVA 2BMWA 4X7FA 3WNCA 4XLFA 2ZXHA 2R9VA 4AF6A 3SJZA 2YWGA 3I55B 4AVZA 1P4MA 3A35A 3CCQB 4B3GA 5B6IA 1DDIA 1Q7YD 1WDTA 4YEJA 1ELOA 4HIZA 4C43A 2QEXB 3CCMB 5GV8A 3CC2B 4YELA 3NE5B 1T6YA 3WXMA 2QDXA 4E0FA 1YJNB 1VQ4B 4DQKA 1YJWB 3A8IA 4XL9A 3SKBA 2WZPP 2ZL6A 3CP2A 1FDRA 1G7CA 1AMOA 2OK8A 1DARA 1Q9SA 1M1KD 1NB0A 4P26A 4XLAA 1K8AD 3PA2A 3CTAA 5IYNA 4F7DA 1KJZA 1WTHD 2VNIA 2X0KA 4RPDA 3QFRA 4XLHA 1VLOA 1WSRA 4RD1A 4TMXA 1VQ8B 1JA0A 2F1MA 2B7BA 1H85A 2F43A 1K28D 3QFTA 3QSYA 2C78A 1SM4A 1UD3A 1B2RA 4UZUA 3ZUGA 1N0UA 2DOGA 2ZZFA 2X6XA 4PC7A 2W6JA 3MCAA 2GQFA 2V7TA 4LBWA 3CCLB 2V7QA 4WZEA 2BM0A 4XN3A 5TRDA 3G05A 3AGQA 1UD6A 2B5OA 4PC6A 4UZEA 3D26A 5GV7A 2WZNA 3MHPA 3CPWB 1YI2B 4ZCIA 2QTLA 3AVWA 3Q6RA 3CCUB 1KZLA 2ZBVA 2CC2A 3CMAB 1HVXA 2XGJA 3CCRB 2VYQA 2RC5A 5FO1A 2WYRA 2DYIA 1CQXA 1FNDA 1QVGB 3OW7A 1UMKA 4Z4RA 3VR6A 3OFNA 2NV4A 1VQLB 2XZOA 1CNEA 3GVKA 1W34A 4RD2A 2VNHA 4P1VA 1Q81D 4YALA 1KTVA 2WPDA 1QFYA 3OPOA 1BJKA 4PC1A 2QMUA 3G4SB 4WZTA 4TMZA 1TTTA 2VBSA 1I7PA 4RCYA 3QE2A 1GR1A 3I56B 5TY0A 1GO2A 2E1BA 2HDNB 2CRVA 1XQBA 5L46A 2DCUA 1GAQA 4NNJA 1ZM3A 1EFCA 1SKQA 3U6KA 2BN4A 4WZKA 4B4DA 2EIXA 4XOTA 5FIUA 1FX0A 4TT3A 1GJRA 3LQ6A 2XNDA 2C77A 4YAOA 2GK6A 3PENA 4LBVA 2C5BA 1R5BA 2OYNA 3CC4B 2NPFA 2X53S 2C4UA 3RY8A 1QX4A 2BGIA 1XFOA 2VBVA 3ONUA 3BCFA 4J0QA 5AN9A 3LNNA 3VNUA 2GK7A 1E64A 3A8KA 2BV3A 4Z4YA 5IYWA 2QA4B 1FNCA 3BQJA 3SLDA 3W2FA 1D8TA 4G7XA 1YHQB 1F20A 3I1FA 2X6YA 1UD4A 1WP6A 4PGOA 3CCJB 2PLFA 4PC2A 1K73D 2QE7A 3A8JA 4P22A 4XNFA 2DETA 1N06A 3R6JA 4XD7A 2V7WA 1KK1A 1UD5A 1A8PA 3JQRA 5HXBA 1R5NA 5DS0A 1BPLA 2PMDA 1WPCA 3ZC3A 2C5HA 5IYQA 3CMEB 1H8HA 5J3OA 2OBTA 4EH1A 4M4SA 3OZUA 3H9NA 1WSVA 5F4MA 3J81k 3MMPA 4XLEA 4JMQA 1N8RD 1S0UA 4GQNA 2QN6A 2JJ1A 1BX1A 1E1RA 3P26A 4YHBA 1QGAA 3AVUA 1W0JA 4XOPA 3BY2A 2W6IA 3JQQA 4B47A 2V4DA 1SKYB 2Q6OA 1MRZA 2C2WA 2OBSA 4XM3A 4RLZA 3W2IA 4WWVA 2VJJA 4ZGQB 1I8DA 1G7TA 4XMYA 4X0CA 2C4TA 4TMVA 4RJLA 2BGJA 1EP2B 4KKSA 4Z4UA 1UD2A 3HAGA 2D3NA 4AF7A 2D3LA 4G6IA 2PE3A 4X7DA 1TUIA 5KSWB 3V76A 2VZLA 5THXA 4CQJA 1QGZA 1YX2A 3GSIA 3V7AA 1HZEA 3JU4A 1VQOB 1OB5A 4DNTB 1V0FA 1OB0A 4OOXA 4PAAA 1EFUA 3AVYA 2FVGA 1BX0A 4YAFA 1DDGA 1E63A 1PJ7A 3FPPA 2ZZQA 3ZZ0A 3QFCA 3T56B 1QVFB 3A3GA 2QTZA 4PABA 1H42A 5TV2A 4P25A 4Z4SA 1NRKA 3AVVA 4PC3A 1KK2A 3OAAA 4DNRB 2JJ2A 2V7UA 1CNFA 4MYUA 3ASQA 3WNDA 3Q6QA 3JQPA 1K9MD 1E3XA 1KC8D 4XKVA 5FA6A 4Z4VA 1IB0A 4G1BA 2XZLA 2X6WA 4YAWA 1GAWA 1VQ5B 5IK2A 3VO1A 4WZLA 1W35A 3LQEA 3U6BA 3BC9A 1RQPA 1KK0A 1PKVA 3W2HA 1RQRA 2E1RA 3ES9A 4G7WA 4X7CA 3OJXA 4YAUA 1YITB 1E1QA 4P6YA 4XR6A 3SJPA 1NDHA 4LC0A 4II2A 4Q7JB 2JDIA 2I1LA 3ISXA 3PUNA 1WORA 3OE7A 4P12A 4TKOB 2VBTA 1FRQA 3ZBUA 2OTJB 1GVHA 4QHYA 1JA1A 1U2RA 3AVTA 2X8KA 1BQEA 2CK3A 1W0KA 5KW9A 2ZTNA 3A3BA 1E79A 2OK7A 3Q38A 4XORA 2BPOA 5EMNA 4II3A 1G7SA 1IHMA 3E20A 3ZIAA 4OOSA 3CW2A 4B43A 1TVCA 3AGPA 1FNMA 2GJKA 3W5VA 5FNZA 5H59A 2X3UA 4X05A 2ZTGA 1BLIA 2KVOA 1W9XA 2VNJA 3ZBTA 4OPVA 2D9RA 1E43A 3KL9A 4UZFA 2BF4A 4QVAA 3T53B 2BVNA 1D1NA 4KKUA 5F4OA 5FO0A 4Y7CA 3E1YE 3ASSA 1VQ9B 4P3YA 4X06A 2V7VA 4RD6A 2Q6IA 1TLLA 3U2QA 4B48A 4FK8A 1QFJA 3WBJA 3WY9A 1N08A 1QFZA 3LO8A 4Z4ZA 3ASRA 2CW5A 5TR9A 3G71B 1KQSB 2B7CA 1AIPA 3GVJA 4ZGNB 3CD6B 1E62A 1F60A 3PVDA 4P3IA 4L8JA 2QGGA 1HA3A 4UAJA 4QUZA 1V0EA 1EP3B 1QH0A 3W2EA 2GREA 4ACAA 1N05A 2HLDA 1JNYA 2WR8A 1T5EA 5IYRA 2ZBUA 4Z1MA 3CRZA 3VO2A 3WBKA 5HKKA 1Y0YA 1S72B 3W2GA 1COWA 2GPJA 3ZPNA 2CF4A 1VHOA 3CP8A 3A1PA 2ZXIA 1VQKB 3WYAA 1XB2A 1G7RA 1KMHA 2J7KA 1VJSA 1VLYA 2VJIA 5A88A 3ZZTA 1JJ2B 1JB9A 3OEEA 5E6TA 4RDLA 3CCEB 3CCSB 5IYPA 4DK0A 2V31A 4ZCMA 3BH4A 4XN0A 2ZL7A 5HZBA 1QG0A 2PIAA 1KRHA 3T51B 2XOKA 4M53A 4B3FX 3DDYA 4QVJA 5A8AA 2VBUA 1YJ9B 1NBMA 1I18A 3PUMA 4P2NA 1VQ6B 2WJVA 2Z6BD 3OW2B 4YXWA 3BCDA 2FX3A 3P27A 4QFMA 2DERA 2AHOA 2DIEA 2Q6KA 3KEWA 4N3NA 2RC6A 4OPSA 1B23P 1QGYA 1D2EA 4ASUA 2YWHA 3GIRA 1V5VA 1NJID 3G6EB 1WU8A 5H5JA 5BSXA 2JN9A 4G1VA 5CDFA 1T6XA 2JIZA 4K1XA 1VQPB 1VQMB 1Y0RA 4KKTA 4P9SA 1H8EA 4IW3B 1EFRA 2WSSA 1IJFA 2XZPA 4TN1A 3W5UA 1ZM2A 3VMFA 3B8HA 5DSZA 3OEHA 4FN5A 2R6HA 2OBRA 5HZAA 1VHEA 5A89A 2Q6LA 3GVLA 1KK3A 4TMWA 4X8IA 2ZL5A 4X7EA 3SLNA 1UD8A 2F1LA 2HCJB 4B44A 3CXCB 1NB9A 4OP7A 1W2BB 4MYTA 1QUFA 5J35A 1FNBA 1OGJA 2BSAA 3ASTA 3CPXA 3BY1A 3ASPA 1DG1G 1QUEA 1VQ7B 3AVXA 1BMFA 2F4NA 3FKSA 1Q82D 4G5GA 2EFGA 1T6ZA 2GJPA 5F4JA 4FXUA 1E3ZA 5BSYA 4LBZA 2GJRA 1N0VC 1ZM4A 1FRNA 1WOPA 2OTLB 4HE6A 4DK1A 1VF7A 3B82A 4OPOA 4RDJA 4Y9UA 2LZJA 4RD0A 1R5OA 2CNDA 5LMZA 2M5SA 4RPBA 1J9ZA 2VNKA 2D74A 2YWEA 4C0SA 3BNWA 3WQZA 2BM1A 4OOVA 3PA1A 4M0LA 2ZZEA 4X07A 5DN6A 4ZCLA 2V7XA 4P6VF 3CCVB 2ZITA 3OP1A 4WQMA 3ONYA 4RDKA 4Y9RA 2DY1A 1OB2A 1W87A 4QV2A 4NBSA 4AC9A 3Q39A 1XE1A 5JBQA 1MABA 4B3XA 3SEJA 3GQBA 4R71A 4XKWA 3FJOA 3LVBA 4M1KA 4Z4TA 4RCZA 4RD4A 4XLCA 2HMAA 3CC7B 4XONA 3VNVA 3W5HA 2YWFA 4FWTA 2X85A 1PJ5A 2XEXA
chains in the Genus database with same CATH topology
4ROXA 4Z4RA 2ZL7A 5HZBA 4P1VA 4P25A 4Z4SA 4Z4WA 4QVJA 3R6KA 4RM0A 3PUMA 4P2NA 3ASQA 4WZTA 3Q6QA 4Z4VA 4OPSA 4WZKA 3Q3AA 3LQ6A 4WZLA 3LQEA 5BSXA 4X7CA 3RY8A 3SJPA 3PUNA 4P12A 4X7FA 3ONUA 4Z4YA 2OBRA 5IYWA 5HZAA 5KW9A 3BQJA 3Q38A 3SLDA 1IHMA 2ZL5A 4X7EA 4OOSA 3SLNA 4OP7A 5J35A 4X05A 3SKBA 3R6JA 2ZL6A 3ASTA 3BY1A 3ASPA 4OPVA 4P26A 4QVAA 3PA2A 5IYQA 5F4OA 5IYNA 5F4JA 3ASSA 5BSYA 5J3OA 4RPDA 4X06A 2OBTA 5F4MA 4RDJA 4OPOA 4RPBA 4Z4ZA 3ASRA 4OOVA 3PVDA 4X07A 3PA1A 4P3IA 3BY2A 4QUZA 3ONYA 4WZEA 4RDKA 2OBSA 4RLZA 4QV2A 5IYRA 3Q39A 4X0CA 3D26A 4Z4UA 3SEJA 4X7DA 3Q6RA 4Z4TA 3V7AA 4OOXA 5E6TA 4RDLA 5IYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ROX A;  4Z4R A;  2ZL7 A;  5HZB A;  4P1V A;  4P25 A;  4Z4S A;  4Z4W A;  4QVJ A;  3R6K A;  4RM0 A;  3PUM A;  4P2N A;  3ASQ A;  4WZT A;  3Q6Q A;  4Z4V A;  4OPS A;  4WZK A;  3Q3A A;  3LQ6 A;  4WZL A;  3LQE A;  5BSX A;  4X7C A;  3RY8 A;  3SJP A;  3PUN A;  4P12 A;  4X7F A;  3ONU A;  4Z4Y A;  2OBR A;  5IYW A;  5HZA A;  5KW9 A;  3BQJ A;  3Q38 A;  3SLD A;  1IHM A;  2ZL5 A;  4X7E A;  4OOS A;  3SLN A;  4OP7 A;  5J35 A;  4X05 A;  3SKB A;  3R6J A;  2ZL6 A;  3AST A;  3BY1 A;  3ASP A;  4OPV A;  4P26 A;  4QVA A;  3PA2 A;  5IYQ A;  5F4O A;  5IYN A;  5F4J A;  3ASS A;  5BSY A;  5J3O A;  4RPD A;  4X06 A;  2OBT A;  5F4M A;  4RDJ A;  4OPO A;  4RPB A;  4Z4Z A;  3ASR A;  4OOV A;  3PVD A;  4X07 A;  3PA1 A;  4P3I A;  3BY2 A;  4QUZ A;  3ONY A;  4WZE A;  4RDK A;  2OBS A;  4RLZ A;  4QV2 A;  5IYR A;  3Q39 A;  4X0C A;  3D26 A;  4Z4U A;  3SEJ A;  4X7D A;  3Q6R A;  4Z4T A;  3V7A A;  4OOX A;  5E6T A;  4RDL A;  5IYP A; 
#chains in the Genus database with same CATH topology
 4LBY A;  1EXM A;  4ROX A;  3OKX A;  2XNC A;  1ZM9 A;  2P3M A;  3CMM A;  1EFT A;  1WOO A;  3OZW A;  5KNL A;  1OGI A;  1YIJ B;  4M2L A;  3FPK A;  4ZV4 A;  3CB4 A;  1EWY A;  4Z4W A;  3CES A;  1PJ6 A;  2WJY A;  3R6K A;  4RM0 A;  3QFS A;  4H9G A;  1M90 D;  3OOC A;  4RD3 A;  2DEU A;  2ZZG A;  3WNB A;  4DQL A;  4HE5 A;  4N3G A;  1YLO A;  3H94 A;  4ACB A;  4TSF A;  1KD1 D;  1WOS A;  1N07 A;  3ZZU A;  1OHH A;  2CBX A;  4U9U A;  1Q86 D;  1VQN B;  1ZUN B;  4TMT A;  5FL7 A;  3Q3A A;  1EP1 B;  1S4M A;  4NCN A;  4XQF A;  3OJW A;  1IJE A;  2XNJ A;  4BPR A;  3B78 A;  3OZV A;  2BMW A;  4X7F A;  3WNC A;  4XLF A;  2ZXH A;  2R9V A;  4AF6 A;  3SJZ A;  2YWG A;  3I55 B;  4AVZ A;  1P4M A;  3A35 A;  3CCQ B;  4B3G A;  5B6I A;  1DDI A;  1Q7Y D;  1WDT A;  4YEJ A;  1ELO A;  4HIZ A;  4C43 A;  2QEX B;  3CCM B;  5GV8 A;  3CC2 B;  4YEL A;  3NE5 B;  1T6Y A;  3WXM A;  2QDX A;  4E0F A;  1YJN B;  1VQ4 B;  4DQK A;  1YJW B;  3A8I A;  4XL9 A;  3SKB A;  2WZP P;  2ZL6 A;  3CP2 A;  1FDR A;  1G7C A;  1AMO A;  2OK8 A;  1DAR A;  1Q9S A;  1M1K D;  1NB0 A;  4P26 A;  4XLA A;  1K8A D;  3PA2 A;  3CTA A;  5IYN A;  4F7D A;  1KJZ A;  1WTH D;  2VNI A;  2X0K A;  4RPD A;  3QFR A;  4XLH A;  1VLO A;  1WSR A;  4RD1 A;  4TMX A;  1VQ8 B;  1JA0 A;  2F1M A;  2B7B A;  1H85 A;  2F43 A;  1K28 D;  3QFT A;  3QSY A;  2C78 A;  1SM4 A;  1UD3 A;  1B2R A;  4UZU A;  3ZUG A;  1N0U A;  2DOG A;  2ZZF A;  2X6X A;  4PC7 A;  2W6J A;  3MCA A;  2GQF A;  2V7T A;  4LBW A;  3CCL B;  2V7Q A;  4WZE A;  2BM0 A;  4XN3 A;  5TRD A;  3G05 A;  3AGQ A;  1UD6 A;  2B5O A;  4PC6 A;  4UZE A;  3D26 A;  5GV7 A;  2WZN A;  3MHP A;  3CPW B;  1YI2 B;  4ZCI A;  2QTL A;  3AVW A;  3Q6R A;  3CCU B;  1KZL A;  2ZBV A;  2CC2 A;  3CMA B;  1HVX A;  2XGJ A;  3CCR B;  2VYQ A;  2RC5 A;  5FO1 A;  2WYR A;  2DYI A;  1CQX A;  1FND A;  1QVG B;  3OW7 A;  1UMK A;  4Z4R A;  3VR6 A;  3OFN A;  2NV4 A;  1VQL B;  2XZO A;  1CNE A;  3GVK A;  1W34 A;  4RD2 A;  2VNH A;  4P1V A;  1Q81 D;  4YAL A;  1KTV A;  2WPD A;  1QFY A;  3OPO A;  1BJK A;  4PC1 A;  2QMU A;  3G4S B;  4WZT A;  4TMZ A;  1TTT A;  2VBS A;  1I7P A;  4RCY A;  3QE2 A;  1GR1 A;  3I56 B;  5TY0 A;  1GO2 A;  2E1B A;  2HDN B;  2CRV A;  1XQB A;  5L46 A;  2DCU A;  1GAQ A;  4NNJ A;  1ZM3 A;  1EFC A;  1SKQ A;  3U6K A;  2BN4 A;  4WZK A;  4B4D A;  2EIX A;  4XOT A;  5FIU A;  1FX0 A;  4TT3 A;  1GJR A;  3LQ6 A;  2XND A;  2C77 A;  4YAO A;  2GK6 A;  3PEN A;  4LBV A;  2C5B A;  1R5B A;  2OYN A;  3CC4 B;  2NPF A;  2X53 S;  2C4U A;  3RY8 A;  1QX4 A;  2BGI A;  1XFO A;  2VBV A;  3ONU A;  3BCF A;  4J0Q A;  5AN9 A;  3LNN A;  3VNU A;  2GK7 A;  1E64 A;  3A8K A;  2BV3 A;  4Z4Y A;  5IYW A;  2QA4 B;  1FNC A;  3BQJ A;  3SLD A;  3W2F A;  1D8T A;  4G7X A;  1YHQ B;  1F20 A;  3I1F A;  2X6Y A;  1UD4 A;  1WP6 A;  4PGO A;  3CCJ B;  2PLF A;  4PC2 A;  1K73 D;  2QE7 A;  3A8J A;  4P22 A;  4XNF A;  2DET A;  1N06 A;  3R6J A;  4XD7 A;  2V7W A;  1KK1 A;  1UD5 A;  1A8P A;  3JQR A;  5HXB A;  1R5N A;  5DS0 A;  1BPL A;  2PMD A;  1WPC A;  3ZC3 A;  2C5H A;  5IYQ A;  3CME B;  1H8H A;  5J3O A;  2OBT A;  4EH1 A;  4M4S A;  3OZU A;  3H9N A;  1WSV A;  5F4M A;  3J81 k;  3MMP A;  4XLE A;  4JMQ A;  1N8R D;  1S0U A;  4GQN A;  2QN6 A;  2JJ1 A;  1BX1 A;  1E1R A;  3P26 A;  4YHB A;  1QGA A;  3AVU A;  1W0J A;  4XOP A;  3BY2 A;  2W6I A;  3JQQ A;  4B47 A;  2V4D A;  1SKY B;  2Q6O A;  1MRZ A;  2C2W A;  2OBS A;  4XM3 A;  4RLZ A;  3W2I A;  4WWV A;  2VJJ A;  4ZGQ B;  1I8D A;  1G7T A;  4XMY A;  4X0C A;  2C4T A;  4TMV A;  4RJL A;  2BGJ A;  1EP2 B;  4KKS A;  4Z4U A;  1UD2 A;  3HAG A;  2D3N A;  4AF7 A;  2D3L A;  4G6I A;  2PE3 A;  4X7D A;  1TUI A;  5KSW B;  3V76 A;  2VZL A;  5THX A;  4CQJ A;  1QGZ A;  1YX2 A;  3GSI A;  3V7A A;  1HZE A;  3JU4 A;  1VQO B;  1OB5 A;  4DNT B;  1V0F A;  1OB0 A;  4OOX A;  4PAA A;  1EFU A;  3AVY A;  2FVG A;  1BX0 A;  4YAF A;  1DDG A;  1E63 A;  1PJ7 A;  3FPP A;  2ZZQ A;  3ZZ0 A;  3QFC A;  3T56 B;  1QVF B;  3A3G A;  2QTZ A;  4PAB A;  1H42 A;  5TV2 A;  4P25 A;  4Z4S A;  1NRK A;  3AVV A;  4PC3 A;  1KK2 A;  3OAA A;  4DNR B;  2JJ2 A;  2V7U A;  1CNF A;  4MYU A;  3ASQ A;  3WND A;  3Q6Q A;  3JQP A;  1K9M D;  1E3X A;  1KC8 D;  4XKV A;  5FA6 A;  4Z4V A;  1IB0 A;  4G1B A;  2XZL A;  2X6W A;  4YAW A;  1GAW A;  1VQ5 B;  5IK2 A;  3VO1 A;  4WZL A;  1W35 A;  3LQE A;  3U6B A;  3BC9 A;  1RQP A;  1KK0 A;  1PKV A;  3W2H A;  1RQR A;  2E1R A;  3ES9 A;  4G7W A;  4X7C A;  3OJX A;  4YAU A;  1YIT B;  1E1Q A;  4P6Y A;  4XR6 A;  3SJP A;  1NDH A;  4LC0 A;  4II2 A;  4Q7J B;  2JDI A;  2I1L A;  3ISX A;  3PUN A;  1WOR A;  3OE7 A;  4P12 A;  4TKO B;  2VBT A;  1FRQ A;  3ZBU A;  2OTJ B;  1GVH A;  4QHY A;  1JA1 A;  1U2R A;  3AVT A;  2X8K A;  1BQE A;  2CK3 A;  1W0K A;  5KW9 A;  2ZTN A;  3A3B A;  1E79 A;  2OK7 A;  3Q38 A;  4XOR A;  2BPO A;  5EMN A;  4II3 A;  1G7S A;  1IHM A;  3E20 A;  3ZIA A;  4OOS A;  3CW2 A;  4B43 A;  1TVC A;  3AGP A;  1FNM A;  2GJK A;  3W5V A;  5FNZ A;  5H59 A;  2X3U A;  4X05 A;  2ZTG A;  1BLI A;  2KVO A;  1W9X A;  2VNJ A;  3ZBT A;  4OPV A;  2D9R A;  1E43 A;  3KL9 A;  4UZF A;  2BF4 A;  4QVA A;  3T53 B;  2BVN A;  1D1N A;  4KKU A;  5F4O A;  5FO0 A;  4Y7C A;  3E1Y E;  3ASS A;  1VQ9 B;  4P3Y A;  4X06 A;  2V7V A;  4RD6 A;  2Q6I A;  1TLL A;  3U2Q A;  4B48 A;  4FK8 A;  1QFJ A;  3WBJ A;  3WY9 A;  1N08 A;  1QFZ A;  3LO8 A;  4Z4Z A;  3ASR A;  2CW5 A;  5TR9 A;  3G71 B;  1KQS B;  2B7C A;  1AIP A;  3GVJ A;  4ZGN B;  3CD6 B;  1E62 A;  1F60 A;  3PVD A;  4P3I A;  4L8J A;  2QGG A;  1HA3 A;  4UAJ A;  4QUZ A;  1V0E A;  1EP3 B;  1QH0 A;  3W2E A;  2GRE A;  4ACA A;  1N05 A;  2HLD A;  1JNY A;  2WR8 A;  1T5E A;  5IYR A;  2ZBU A;  4Z1M A;  3CRZ A;  3VO2 A;  3WBK A;  5HKK A;  1Y0Y A;  1S72 B;  3W2G A;  1COW A;  2GPJ A;  3ZPN A;  2CF4 A;  1VHO A;  3CP8 A;  3A1P A;  2ZXI A;  1VQK B;  3WYA A;  1XB2 A;  1G7R A;  1KMH A;  2J7K A;  1VJS A;  1VLY A;  2VJI A;  5A88 A;  3ZZT A;  1JJ2 B;  1JB9 A;  3OEE A;  5E6T A;  4RDL A;  3CCE B;  3CCS B;  5IYP A;  4DK0 A;  2V31 A;  4ZCM A;  3BH4 A;  4XN0 A;  2ZL7 A;  5HZB A;  1QG0 A;  2PIA A;  1KRH A;  3T51 B;  2XOK A;  4M53 A;  4B3F X;  3DDY A;  4QVJ A;  5A8A A;  2VBU A;  1YJ9 B;  1NBM A;  1I18 A;  3PUM A;  4P2N A;  1VQ6 B;  2WJV A;  2Z6B D;  3OW2 B;  4YXW A;  3BCD A;  2FX3 A;  3P27 A;  4QFM A;  2DER A;  2AHO A;  2DIE A;  2Q6K A;  3KEW A;  4N3N A;  2RC6 A;  4OPS A;  1B23 P;  1QGY A;  1D2E A;  4ASU A;  2YWH A;  3GIR A;  1V5V A;  1NJI D;  3G6E B;  1WU8 A;  5H5J A;  5BSX A;  2JN9 A;  4G1V A;  5CDF A;  1T6X A;  2JIZ A;  4K1X A;  1VQP B;  1VQM B;  1Y0R A;  4KKT A;  4P9S A;  1H8E A;  4IW3 B;  1EFR A;  2WSS A;  1IJF A;  2XZP A;  4TN1 A;  3W5U A;  1ZM2 A;  3VMF A;  3B8H A;  5DSZ A;  3OEH A;  4FN5 A;  2R6H A;  2OBR A;  5HZA A;  1VHE A;  5A89 A;  2Q6L A;  3GVL A;  1KK3 A;  4TMW A;  4X8I A;  2ZL5 A;  4X7E A;  3SLN A;  1UD8 A;  2F1L A;  2HCJ B;  4B44 A;  3CXC B;  1NB9 A;  4OP7 A;  1W2B B;  4MYT A;  1QUF A;  5J35 A;  1FNB A;  1OGJ A;  2BSA A;  3AST A;  3CPX A;  3BY1 A;  3ASP A;  1DG1 G;  1QUE A;  1VQ7 B;  3AVX A;  1BMF A;  2F4N A;  3FKS A;  1Q82 D;  4G5G A;  2EFG A;  1T6Z A;  2GJP A;  5F4J A;  4FXU A;  1E3Z A;  5BSY A;  4LBZ A;  2GJR A;  1N0V C;  1ZM4 A;  1FRN A;  1WOP A;  2OTL B;  4HE6 A;  4DK1 A;  1VF7 A;  3B82 A;  4OPO A;  4RDJ A;  4Y9U A;  2LZJ A;  4RD0 A;  1R5O A;  2CND A;  5LMZ A;  2M5S A;  4RPB A;  1J9Z A;  2VNK A;  2D74 A;  2YWE A;  4C0S A;  3BNW A;  3WQZ A;  2BM1 A;  4OOV A;  3PA1 A;  4M0L A;  2ZZE A;  4X07 A;  5DN6 A;  4ZCL A;  2V7X A;  4P6V F;  3CCV B;  2ZIT A;  3OP1 A;  4WQM A;  3ONY A;  4RDK A;  4Y9R A;  2DY1 A;  1OB2 A;  1W87 A;  4QV2 A;  4NBS A;  4AC9 A;  3Q39 A;  1XE1 A;  5JBQ A;  1MAB A;  4B3X A;  3SEJ A;  3GQB A;  4R71 A;  4XKW A;  3FJO A;  3LVB A;  4M1K A;  4Z4T A;  4RCZ A;  4RD4 A;  4XLC A;  2HMA A;  3CC7 B;  4XON A;  3VNV A;  3W5H A;  2YWF A;  4FWT A;  2X85 A;  1PJ5 A;  2XEX A; 
#chains in the Genus database with same CATH homology
 4ROX A;  4Z4R A;  2ZL7 A;  5HZB A;  4P1V A;  4P25 A;  4Z4S A;  4Z4W A;  4QVJ A;  3R6K A;  4RM0 A;  3PUM A;  4P2N A;  3ASQ A;  4WZT A;  3Q6Q A;  4Z4V A;  4OPS A;  4WZK A;  3Q3A A;  3LQ6 A;  4WZL A;  3LQE A;  5BSX A;  4X7C A;  3RY8 A;  3SJP A;  3PUN A;  4P12 A;  4X7F A;  3ONU A;  4Z4Y A;  2OBR A;  5IYW A;  5HZA A;  5KW9 A;  3BQJ A;  3Q38 A;  3SLD A;  1IHM A;  2ZL5 A;  4X7E A;  4OOS A;  3SLN A;  4OP7 A;  5J35 A;  4X05 A;  3SKB A;  3R6J A;  2ZL6 A;  3AST A;  3BY1 A;  3ASP A;  4OPV A;  4P26 A;  4QVA A;  3PA2 A;  5IYQ A;  5F4O A;  5IYN A;  5F4J A;  3ASS A;  5BSY A;  5J3O A;  4RPD A;  4X06 A;  2OBT A;  5F4M A;  4RDJ A;  4OPO A;  4RPB A;  4Z4Z A;  3ASR A;  4OOV A;  3PVD A;  4X07 A;  3PA1 A;  4P3I A;  3BY2 A;  4QUZ A;  3ONY A;  4WZE A;  4RDK A;  2OBS A;  4RLZ A;  4QV2 A;  5IYR A;  3Q39 A;  4X0C A;  3D26 A;  4Z4U A;  3SEJ A;  4X7D A;  3Q6R A;  4Z4T A;  3V7A A;  4OOX A;  5E6T A;  4RDL A;  5IYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...