3RYDA

Crystal strucutre of ca bound impase family protein from staphylococcus aureus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
263
structure length
261
Chain Sequence
DKTLQQIDKLICSWLKQIDNVIPQLIMEMTTTKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal dual specific inositol monophosphatase/NADP(H) phosphatase (SAS2203) delineates the molecular basis of substrate specificity
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 72
structure length 261
sequence length 263
chains with identical sequence C
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2011-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3rydA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3rydA02
2P3NA 1D9QA 2HHMA 5J16A 1LBXA 1FTAA 1NUXA 1NUZA 5ET5A 2QFLA 5EQ8A 4GWYA 3QMFA 1NI9A 4I3EA 2Y5KA 2F3DA 2FBPA 1AWBA 4N81A 4I3YA 5EQ7A 2FVZA 4KXPA 5IZ3B 1LBYA 1G0IA 4GWXA 1FJ9A 1VDWA 1G0HA 4GX4A 2PCRA 4AS4A 2R8TA 1BK4A 1KA0A 1NV1A 2CZIA 2Q74A 1FPDA 5LDZA 4GWSA 1LEVA 1FBGA 2DDKA 1DK4A 3B8BA 1IMAA 1FPJA 1IMCA 3RPLA 2OX3A 4GBVA 4GWZA 3RPLB 5EQ9A 1IMFA 1FSAA 1KZ8A 4HE2A 1CNQA 3IFCA 2QVRA 4O7IA 3LUZA 2WBBA 1RDZA 5ET7A 4H46A 2WBDA 1NV5A 4I40A 1INPA 1XI6A 3D1RA 3FBPA 1DCUA 5FBPA 1FJ6A 4HE0A 4GWWA 4AS5A 1NV3A 1NV2A 3RYDA 2JJKA 4HE1A 1FPBA 1FRPA 4IR8A 1SPIA 3BIHA 5EYHA 3KBZA 2OWZA 1YZ0A 2GQ1A 1NUWA 1YYZA 1NV4A 2CZHA 1RDYA 1YXIA 4GBWA 1IMDA 2Q8MA 1FPLA 3LV0A 4GWUA 4H45A 1FBPA 1K9ZA 1FBCA 4HXVA 1EYJA 1EYKA 1FPIA 2CZKA 2Y5LA 1LBZA 4PTKA 2WEFA 1FBEA 3IFAA 5DW8A 1FPGA 2P3VA 3BIGA 5IZ3A 5EQAA 1NUYA 5F24A 3KC0A 2QVVA 1NV7A 1JP4A 1Q9DA 2F3BA 2FHYA 1FPFA 4FBPA 4GX6A 4GX3A 1FBHA 5ET8A 5IZ1A 3KC1A 1LBVA 1IMEA 1FPEA 2BJIA 1NV0A 1IMBA 2QVUA 2VT5A 2FIXA 5EYGA 1FBDA 1LBWA 2FIEA 1NV6A 1RDXA 1FPKA 3A29A 4MJOA 1K9YA 5T3JA 5A5LA 1QGXA 1EYIA 3T0JA 1KA1A 4QXDA 5ESYA 1DBZA 4G61A 5ET6A 5I3SA 1FBFA 3ROJA
chains in the Genus database with same CATH superfamily
1A8FA 3C4MA 1NNTA 5ET5A 1RKMA 5TPAB 1JVXA 3MVYA 4DLDA 1UQWA 1S50A 2ALUA 1IXHA 2R8TA 4AB5A 4Q0CA 3CIJA 3CRBA 1BIYA 2ESNA 1P1UA 1HSEA 3FIRA 3M8UA 3UK4A 2OJTA 4XKPA 3K2DA 4GXSB 4BDRA 1RDZA 1EZ9A 1B51A 3MZ9A 4NF6B 3PUXE 1UIUA 5HBCA 2V93A 4N8YA 3CVGA 3B50A 3ZS6A 4PF8A 4QF9A 2Y7IA 3U65A 4GOTA 4QFOA 1Y20A 1IUDA 3PPQA 1ZU0A 1XC1A 3FXRA 1GVCA 1Q1KA 3KC0A 2ZNTA 1ATGA 5DVIA 1MPBA 5I57A 2Z8FA 5IZZA 4I9DA 4OETA 3SERA 1SYIA 2BJIA 2VT5A 2LAOA 2Y84A 4U4SA 3RNNA 2FIEA 1N0TA 4ZEKA 2DE2A 4OFOA 3S9LC 1SW4A 4PFBA 4MNCA 1DTZA 1TFAA 3ISPA 4OVRA 2P3NA 1LSTA 3O6HA 4UABA 1SW5A 1LBXA 4PFUA 1JVYA 3M3FA 2Z8DA 3TTNA 3OENA 4YMAA 4G68B 3IB0A 1FJ9A 4QFPA 4U4XA 3FJ7A 2F78A 3AXFA 2Q9TA 4KR5A 2I48A 2IEEA 3KZGA 4F29A 1MH3A 3B8BA 1IMCA 4BDMA 2PX1A 4G68A 5J1DA 4ELOA 1MM6A 4OMBA 4MX6A 1ANFA 4PCDA 5BUUA 3C34A 2NWJA 1NKXA 5I56A 3IB2A 4LQ5A 1USYH 4MHFA 1Y1MA 2F6PA 1FPBA 4G8HA 4GL0A 4OERA 4NE4A 4HW8A 3B7DA 4LATA 1PEBA 4ND9A 1FBCA 1EYKA 1WODA 3PUWE 4Q8RA 4NTLA 2XXHA 5CBSA 4XKQA 2X7PA 4FATA 1IMBA 5AA4B 4FORA 3RGYA 3ECRA 3SEXA 4OFJA 5I2KB 4ZE9A 1I6QA 1SDXA 4MIJA 3R26A 4O94A 1NL5A 3PD9A 2XWIA 2IA4A 4NF6A 3TTMA 1I6BA 1NI9A 4GVOA 2B3FA 3TUSA 4TLLB 4XFEA 5JK4A 2A5TA 2Y7PA 4NX1A 1VDWA 4EUOA 4LVQA 1UTBB 4PFTA 3TCFA 4EQBA 2DOJA 4GWSA 4KYEA 3W9WA 2V3UA 4XTCQ 2XWOA 4KFQA 1IMAA 4N6DA 4GWZA 5H8HA 3A3UA 3VDFA 1Z7NE 4DI4B 1UIVA 3V5AA 5ET7A 1NV5A 4EQ7A 2O51A 1PB7A 2Q2AA 4MF3A 1HSJA 2A5TB 5EYHA 5DTBA 3KGCA 4P1LA 3O97A 4AB6A 5BWJA 2Q8MA 3ILTB 3UN6A 3LV0A 3H6TA 3K0VA 1FPIA 4PTKA 3MZBA 1FBEA 4DDDA 1YAEA 4NF5A 2F6GA 4O3CA 4LZ7A 2V3QA 1JP4A 4U1ZA 5H8QB 2UVGA 2O84X 4IO4A 1FBDA 1I6AA 4KCDA 4GL8A 4PF6A 3CSBA 1QGXA 1B7ZA 3T0JA 1B1XA 4LP2B 1Y9UA 1JW5A 3G3KA 4PGNA 3FD3A 2WYPA 3GBBA 3I3VA 4I3YA 1ZLQA 1POY1 1MY2A 5L9SA 4YKPA 5H8NA 1US4A 4EF1A 4JB7A 1LAHE 4ELRA 1NV1A 4ONYA 1NFTA 2H9BA 4Z7EA 4LZ5A 3IB1A 2RINA 4NHBA 1R1NA 2ONSA 3H3GA 4OYVA 2HAUA 3QSLA 1JEUA 4YMBA 2YJPA 3PU5A 1BP5A 3K01A 2MKZA 3PMVA 3CHGA 2GQ1A 4OVPA 3A09A 4YKJA 4FJPA 3S4UA 2XXXA 5CMCA 1DOTA 2DWIA 3QAXA 3TTLA 4O7MA 3KN7A 1B0HA 5K2YA 1H43A 4UA8A 2WEFA 4GIZA 5DW8A 5IZ3A 1QUIA 2XX7A 3GYYA 3TQLA 5KCJB 3MVWA 1B0LA 2VOZA 1TT1A 4F39A 1AMFA 1ZMGA 4ZEFA 3H4ZA 4MAGA 4ELPA 1FTOA 2R71A 3SEWA 2OK2A 1NV6A 1FPKA 3JYRA 1VE4A 2G93A 1R9LA 1UTHA 5IAIA 1UTHB 5F7VA 4R6YA 1FTAA 3O6GA 4R6HA 4X8RA 4I3EA 2QRYA 4PBHA 5KZTA 2FBPA 3EQ1A 3W9VA 2PT1A 5FHOA 2CEYA 4F18A 1YTVA 1LBYA 1ZJLA 2UVJA 2DWAA 2PCRA 2AIXA 4N4UA 2DP8A 1FQFA 3KBRA 1MY4A 1MG1A 1FTLA 2B65A 1DK4A 4P9KA 4GBVA 3HSTA 1MDP1 3GZGA 5HPQA 1LFHA 2GFEA 4EXLA 1XHYA 1QUKA 1SW1A 4PFRA 2XXKA 4IY5A 5JTYB 1ZKBA 4XEQA 5H8NB 4TOZA 4HE1A 3FXBA 3PUZE 3KBZA 2FA7A 3VV5A 4BLAA 5CC2A 4G4PA 4GWUA 4DXUA 5AA1A 3DP4A 1K9ZA 4H5GA 3C33A 1LGBC 4BDQA 4PE3A 2DQVA 3C36A 4MBPA 4U1OA 5AA4A 4FBPA 4GX6A 2XX9A 4ESWA 4KCCA 2QMXA 1EZPA 3MZ1A 4EF2A 4WXJA 2UVHA 4BDOA 4RK9A 1IXCA 3UGWA 4ELQA 1O64A 3VXBA 2VPNA 1H45A 1AIVA 1KA1A 5ESYA 4P1EA 4PE5B 1QW0A 2QMWA 2UXAA 1B46A 4NF8A 4M4GA 2F35A 3OMBA 2GHAA 4GWOA 4F22A 1M5CA 1OLAA 4C1TA 3V8XB 4N81A 3RT8A 3U72A 1MXZA 1KA0A 4X1DA 3EF7A 1UTBA 5ITOA 4H8JA 4N15A 3G3JA 3QIMA 5EQ9A 1IMFA 1XS5A 4R72A 4IY6A 4E0XA 3TYHA 5CRYA 1N04A 4H46A 2F7BA 3THIA 5A5XB 4YU0A 1N3XA 1XVXA 2P1SA 1FQDA 1XOCA 2RCAA 1N7WA 4F19A 4EQ9A 2I4BA 4WEDA 1RYXA 3TQWA 2XD2A 2Q2CA 4TQUQ 2VPOA 3T66A 2OBGA 5DEXA 5FTHA 2I58A 3TZAA 2B4MA 3FUZA 4OVTA 2FHYA 2WYKA 5ET8A 3OXNA 3F11A 1FPEA 4JVDA 1MH4A 5I58A 4OXVA 2VP1A 4QXDA 1D4NA 4ZZAA 3V83A 4R6KA 1H76A 1B3GA 3QUFA 4MEVA 2OCUA 1D9QA 4Q5TA 3N6UA 3E9XA 4F3PA 3E4RA 4DE8A 3MAMA 4IO7A 4MH5A 3TDJA 4F3SA 4OQOA 4G2ZA 4PGPA 3U1OA 4U22A 4GX4A 2O7IA 3VVFA 3FV2A 5H8SA 3HHGA 2W7YA 2I4CA 2XD3A 5EHSA 1LAXA 5L8DA 4O3BA 4LONB 4YB7A 1MY3A 3B6QA 4XIGQ 1URDA 3LSWA 1LB9A 4DIGA 1XT8A 5B70A 3IJOB 3KN3A 1KZ8A 3SZPA 1MXUA 2X26A 4U23A 3TPAA 5FHNA 4O7IA 2QS2A 3VVDA 4I40A 3PPOA 1BLFA 5ISUA 1MXVA 1OIBA 3FBPA 1FJ6A 4N07A 4GWWA 2O1MA 1NV3A 2D3IA 4GLIA 1AOVA 4KHZE 3FZVA 1Y3QA 3IOWA 3EHSA 1A7LA 1I69A 2ABHA 3K00A 4H67A 1FBPA 3PMXA 3U93A 4ZEIA 5I2NA 1WVJA 4H8IA 1FPGA 2OWTA 4EDPA 3IAZA 2O7UA 3HN0A 1ZIUA 1B9JA 2HPGA 3RT6B 1VSOA 2XXWA 3KG2A 1B05A 4E0WA 4QFKA 2I0CA 4OHNA 4MJOA 5AA3A 1B32A 3VLVA 4PP0A 2XA5A 2P2AA 3KN8A 4N13A 3Q28A 3I6VA 3FXQA 4YB6A 3H7MA 2CMOA 1QKBA 1WDNA 1B3EA 1MPCA 4RY1A 1OMPA 2DWJA 2H25A 1QVSA 4GRKA 1B5HA 4ZS9A 1J1NA 3OELA 2Y7RA 4KQPA 2RC9A 2Q89A 1IXIA 4MFIA 1B52A 1IZ1A 1MQJA 4HTGA 3T9HB 2OZZA 2F36A 5H8QA 1FSAA 1EU8A 4LUBA 1B2HA 1VFDA 4EXKA 2XWVA 3A3CA 3MPLA 4OENA 1B7HA 5ELVA 1T0KA 3S9NC 3E78A 1B6HA 5LTCA 5I58B 3MPKA 4Z0IA 4BDNA 3PGFA 2I6EA 3MJNA 3G3HA 4QBAA 3T9UA 3GBAA 5DEXB 1S7YA 4R2BA 3G7WA 2XX8A 2O69A 3ODBA 1B3HA 4OEUA 5DVJA 3KC1A 4R75A 1NV0A 4HS7A 5IKBA 3OSQA 3IX1A 3SDFA 1Y4CA 2O1LA 5CI5A 5M2VA 3H6UA 1JETA 5I3SA 2RKMA 3K6WA 1LLSA 4JWYA 3RUMA 4F1YA 4OEVA 1GTKA 2ZZVA 2HHMA 3ZKKA 3D4GA 1NUZA 3IR1A 1B4ZA 2Y5KA 2NOOA 4ISUA 1ZTYA 4RPOA 1TFDA 3QK6A 4IGRA 1DSNA 2QS3A 5JEIA 2L5VA 4U21A 3FJGA 3G3IA 1B58A 5K2XA 4K3FA 3H03A 3TCHA 2DS9A 5I84A 2UVIA 2I0BA 1TXFA 5FTIA 3LUZA 5L9OA 3I5OA 2XXUA 1B7UA 2P0SA 3E13X 4NEDA 2KQZA 1INPA 1R9QA 1A8EA 5IM2A 2NVUB 1URSA 3EPEA 4I62A 4DXBA 2FNCA 1FRPA 4IR8A 3RN8A 1DPPA 5I5PA 4G8NA 4GFRA 4H45A 3KJTA 3VE1B 3N6TA 3OO8A 1MPDA 2D5WA 4GQOA 3TELA 4OVSA 4FAJA 3T96B 3ZSFA 2KR0A 3SEVA 3IFAA 1FQEA 1AL3A 2P3VA 1MQDA 4G8MA 1YCJA 3L6HA 4JVIA 1NV7A 2V84A 4UACA 1II5A 5IZ1A 3QYTA 1US5A 1IMEA 3OO9A 4RJZA 3U94A 5A5LA 5H8HB 3E79A 4PQJA 1DBZA 3K1MA 3WAEA 4G61A 2O68A 3S2VA 4F1UA 3ROJA 3C35A 4LA9A 4NF4B 1P1WA 3VLUA 1OQGA 2HAVA 3QMFA 1N3WA 3USDA 3HO7A 4H1XA 2RF1A 3HHFA 3MP6A 4NG7A 1AWBA 5DT6A 4KXPA 3LBSA 4O3AA 4X04A 3HFUA 2OWSA 1G0HA 2ANJA 1FTMA 2YPNA 1JQFA 3UIFA 1SQYA 3V89B 3NOHA 1BK4A 2QS4A 4JVCA 4JWOA 1IXGA 2QJEA 2Q74A 1FPDA 3TCGA 5LDZA 4JXIA 4GF8A 3B6WA 5FHMA 3RPLA 3IJXB 1MQGA 1B5IA 4I1DA 4JSDA 4N6PA 4P56A 2WBBA 1MM7A 1XVYA 3RTFB 1Y1ZA 4FECA 2UYFA 3KOSA 3G3GA 1MS7A 1PC3A 2F7CA 1JEVA 4I8CA 3Q26A 1B40A 1GR2A 3IK6B 1BKAA 4N8GA 2HEUA 1IIWA 2H4IA 1RDYA 1IMDA 5KDTB 1FPLA 4HCYA 1P1QA 4HXVA 2CZKA 1FQAA 1Y4TA 1LBZA 4P0GA 1M5FA 1LAGE 3TTRA 2QVVA 4JWXA 1JNFA 3M3LA 4GX3A 2AL4A 2Q8JA 4PC9A 1YPNA 2FIXA 2ZNSA 1ZBMA 5EYGA 3SEUA 1POTA 3A29A 5T3JA 3TTKA 1PDAA 1B3LA 3R7XA 4PAIA 3FGSA 3OSRA 1NH8A 3RPWA 3OD7A 2Y7WA 1ELJA 1R6ZA 2F8DA 3N94A 3PPNA 3OO7A 3H6VA 3C32A 4GXAA 2BJJX 5J16A 2RC8A 4BDLA 5TPAA 4QSDA 4JSOA 1N7XA 3RQTA 4P47A 3CFXA 4H0WA 4MMPA 2ZYKA 4AQ4A 4ZE8A 3R6UA 1LBCA 3CSGA 3MBPA 2REJA 3E3KA 1JW4A 1LCFA 2DXYA 4U2RA 1M5BA 4IGTA 1EH3A 4IO2A 3WAFA 4HE2A 1LFGA 3IFCA 2QVRA 3O2AA 1FQBA 5I7IA 2F34A 4X9TA 3HCQA 2GH9A 5CBRA 2B4LA 3B6TA 3O29A 2E1SA 1MXYA 5B7DA 3RYDA 4NMYA 4OVJA 2I3VA 3SEYA 2HXWA 1KWHA 1NMUA 2WKYA 4H65A 3FATA 2DSFA 2AYSA 3LC8A 4MNPA 2DVZA 3O6IA 2ZYNA 3DELB 1FPFA 3KEIA 4H6DA 1S9TA 3ILUB 1JW1A 4X1BA 3Q25A 3IL1B 2HZKA 3K4UA 4PETA 3CFLA 2QVUA 3OEKA 4IO5A 4DI3D 1RDXA 4YKKA 4DXCA 4P11A 5A5XA 2NXOA 1GV8A 4RNSA 2F5XA 1MY1A 3T93B 5EQ8A 5H8FA 1USYE 2H99A 3QXMA 3G3FA 4NN3A 4XKRA 3DLNA 4YZZA 3GXAA 4AS4A 2H5YA 3KSXA 2ONKE 1FTKA 1SYHA 3FVNA 3BBRA 3IOTA 4G68C 4KYSA 5ICTA 2PYYA 4IO3A 4XXUA 2M8CA 2XXRA 3RPLB 3Q29A 1GGGA 4YAHX 4POXA 2HXRA 4IO6A 5EYFA 2RCBA 5KDTA 1QKAA 2WBDA 4F2QA 3BFUA 4PFIA 1XI6A 2HCAA 1F9BA 1NH7A 1EZOA 4N91A 4YKIA 5CMBA 1M5DA 1NUWA 2ZZWA 3KFMA 2F97A 2PVUA 4HCWA 2QL3A 2CZLA 4F3BA 4KD5A 4OANA 2DE4A 3RTWB 3FJMA 2DWHA 1FW0A 3MWBA 3PD8A 3MP8A 4RXLA 4F1VA 1IITA 5EQAA 4M1VA 1PB8A 3MVXA 1QUJA 2XHDA 4X48A 5ICQA 1FCKA 2XXPA 1PBQA 4WEPA 4JDFA 3FVGA 3DP6A 1SW2A 4NF8B 4PAKA 2CEXA 2VD3A 1L5TA 4R74A 4YICA 5EHMA 1URGA 1HSLA 3ZKLA 4QSEA 4PBQA 3DM0A 3IOVA 5CMMA 1NUXA 1N76A 3M3KA 3O9PA 2PFYA 1MXWA 3H6WA 2F3DA 3CFZA 1B3FA 1D3KA 4OWDA 3MUQA 4MNIA 4PFWA 3LSLA 4LZ8A 3O28A 2UYEA 4KPTA 3HV1A 3KJ7A 2PBWA 2OLBA 1FBGA 2V25A 3QUJA 4OZ9A 4ZDMA 3VXCA 3UP9A 3IOUA 4C1UA 5AA2B 2DVCA 1LFIA 2H98A 1OLCA 1P1OA 2I49A 1MQIA 1H44A 4RK2A 2Q88A 5JTYA 1LB8A 1FQCA 3D1RA 3FVKA 4HE0A 4DZ1A 1NV2A 3FXUA 3BIHA 5AA2D 2ZYOA 4FE8A 4P8BA 2CZHA 1Z7ME 2OPEA 3K1PA 4R73A 4N6KA 5KCJA 1SI0A 1SI1A 2HFBA 4NGUA 1DMBA 5CM6A 2XXTA 1QULA 3K02A 3MYUA 1MY0A 3C31A 4FEBA 4ESXA 1NUYA 5F24A 1D9YA 1Q9DA 3MC2A 1A99A 2HQ0A 3PPRA 3LUYA 1M5EA 5LOMA 1MQHA 2R9JA 5H8FB 3UA8A 3MVZA 4G77A 1Y3PA 1K9YA 3T22A 4N17A 3TEPA 2DYXA 4FIMA 4O8MA 1NNKA 1TWYA 3VLWA 4ZEBA 2FYIA 2G29A 3SKPA 2QPQA 1PB9A 3U92A 4H5FA 4YB5A 2V3TA 4WKMA 1G0IA 2E0SA 1O7TA 4OESA 3L6GA 2ZNUA 1VFEA 3MSTA 3VVEA 1A55A 1LEVA 4MLVA 1MRPA 2Z22A 1VR5A 2PMSA 3Q27A 4RPNA 4OVQA 2YLNA 1CE2A 2AL5A 4L17A 1OVBA 3MQ9A 3W15C 5IGAA 1YZ0A 4NAPA 4ZEDA 1NV4A 1YXIA 2NUVA 1OQHA 1DPEA 2Y7KA 4OTEA 3VFJA 1O63A 1EYJA 4NF5B 1RYOA 2THIA 3EN3A 3CI8A 4OFLA 3KSJA 3BIGA 2VGQA 3IO6A 5AA2A 2F3BA 4LQ2A 3N26A 3OO6A 3TMGA 4NWDA 5DVFA 3FASA 4R9GA 1OVTA 5L9MA 4R2FA 2ONRA 4GD5A 3PV0E 4OA4A 1AH5A 1EYIA 4NQ8A 3H06B 4P3LA 4LN5A 1IEJA 1NNFA 5I2NB 1MXXA 3CR9A 3FVOA 3RLFE 4KI0E 3DP8A 3TFLA 1PBPA 2I3WA 2ZXTA 4GWYA 4ECFA 1MDQA 1B5JA 1SBPA 2GHBA 3K6UA 4DCXA 5EQ7A 3IORA 1IQ7A 3JZJA 2QSXA 3LSXA 4R9FA 4PAFA 2XXQA 2XXIA 1LBBA 5TP9A 1A40A 3U8QA 4XKNA 2VHAA 2DDKA 3ONMA 2F7AA 2OX3A 1Q35A 4F31B 3BFTA 4TLMB 3TAJA 5I56B 3LR1A 2ZYMA 1H3DA 5F1QA 3PTYA 3P7IA 3EHTA 1SVXB 5I2KA 4FEDA 4QHQA 4NF4A 1CB6A 4AS5A 4QFNA 2JJKA 1Y3NA 1SPIA 1NNPA 2OWZA 3K6XA 3K6VA 5I59B 4GBWA 1N84A 2REGA 2A5SA 2OPDA 2ZZXA 2HZLA 3CG1A 3BKIB 1LCTA 1B4HA 3PMWA 3GLBA 1BTJA 1FBHA 2D21A 2X7QA 3SETA 4MCOA 2DXRA 4THIA 4F3GA 3CG3A 2ZMBA 4NF0A 2Z23A 2V4CA 5ET6A 2O6AA 1FBFA 3PUVE 2XWKA 1P1NA 5CMKA 4PFYA 2DE3A 3PUYE 3RY3A 3TODA 5AE4A 2QFLA 3HPIA 4JBZA 3T1BA 3IO4A 2FVZA 5I59A 5IZ3B 4GWXA 1LAFE 5TU0A 1P99A 2KLFA 1SD3A 4QFLA 3C9HA 4XF5A 1D9VA 5DYHA 3O66A 4NWCA 2CZIA 3TKDA 2QS1A 3SESA 4F2OA 2PT2A 3KOTA 4MLQA 4QSCA 3LSFB 1FPJA 4POWA 4DCYA 1CNQA 4QRZA 3JV9A 3OEMA 3EKIA 4P0IA 5ITPA 2R6GE 3K1NA 4Q30B 4IB2A 1FTJA 5FBPA 1DCUA 4C0RA 2B3BA 1B1HA 3EHUA 4ZZEA 1YYZA 3PPPA 4RA1A 5TP9B 3FV1A 3T9XB 3S9EA 2Y5LA 1A54A 1QJMA 2GRVA 3S9MC 3N5LA 4RYAA 4ZECA 3UORA 2RC7A 1LBVA 3MP1A 3OOAA 5HM4B 3D4CA 4PDDA 1LBWA 2XXVA 2Z8EA 2PFZA 5I57B 2XXYA 2WX9A 1DTGA 3T9VA 3MW0A 4KYDA 2VD2A 4PDHA
chains in the Genus database with same CATH topology
2P3NA 2F5XA 1D9QA 2ZZVA 2HHMA 4PGNA 4UABA 5J16A 1LBXA 1FTAA 1NUXA 1NUZA 5ET5A 2XWIA 2PFYA 2QFLA 2WYPA 5EQ8A 4GWYA 4P47A 3QMFA 1NI9A 4PF6A 4I3EA 4X8RA 2Y5KA 2QPQA 4MMPA 4PBHA 2F3DA 3T1BA 2FBPA 4NG7A 4XFEA 3W9VA 2CEYA 1AWBA 4N81A 4F18A 4I3YA 5EQ7A 5JK4A 2FVZA 4KXPA 5IZ3B 1LBYA 4NN3A 1G0IA 4NX1A 4GWXA 3HFUA 1FJ9A 4MNIA 4PGPA 1VDWA 4X04A 4YZZA 1G0HA 4GX4A 2PCRA 4AS4A 4N4UA 2R8TA 4PAFA 2L5VA 4XF5A 3NOHA 1BK4A 1KA0A 1NV1A 2CZIA 2Q9TA 4JVCA 3MSTA 2Q74A 1FPDA 5LDZA 4GWSA 1LEVA 3W9WA 1FBGA 2DDKA 1DK4A 3B8BA 2XWOA 4N15A 4P9KA 1IMAA 1FPJA 1IMCA 3RPLA 2OX3A 4GBVA 4N6DA 4GWZA 3RPLB 4PAKA 5EQ9A 4NHBA 1IMFA 1FSAA 1KZ8A 4HE2A 3SZPA 1CNQA 4DI4B 2HXRA 3IFCA 2QVRA 4O7IA 2XWVA 4P56A 4PFRA 5I7IA 5J1DA 4X9TA 3LUZA 2WBBA 1RDZA 5ET7A 4OVQA 2XXKA 3EKIA 4H46A 2WBDA 1NV5A 4YICA 4I40A 4MX6A 2B4LA 4PCDA 4PDHA 3PTYA 4PFIA 2KQZA 1INPA 1XI6A 3D1RA 3FBPA 1DCUA 5FBPA 1FJ6A 4OVRA 4XEQA 4HE0A 3E78A 4GWWA 4AS5A 1NV3A 5IM2A 1NV2A 5LTCA 4MHFA 3RYDA 2JJKA 4HE1A 4N8YA 1FPBA 1FRPA 4IR8A 2MKZA 3FXBA 4N91A 1SPIA 3BIHA 5EYHA 4N8GA 3KBZA 2OWZA 3B50A 4P1LA 5IGAA 4PF8A 1YZ0A 4NAPA 3CHGA 2GQ1A 1NUWA 4OVPA 2ZZWA 4F19A 1YYZA 5I5PA 3U65A 1NV4A 4P8BA 2CZHA 1RDYA 1YXIA 4GBWA 1IMDA 2Q8MA 4HCWA 1FPLA 3LV0A 4GWUA 4H45A 4OANA 4HCYA 1FBPA 1K9ZA 4N6KA 2DE4A 4O7MA 4QBAA 1FBCA 4HXVA 1EYJA 1EYKA 1FPIA 2CZKA 4PE3A 4OVSA 2VPOA 4MNPA 2Y5LA 1LBZA 4PTKA 4NGUA 5CM6A 2WEFA 1FBEA 2DVZA 2HZLA 3IFAA 5DW8A 1FPGA 2P3VA 2KR0A 2ZZXA 3BIGA 3MYUA 4F1VA 5IZ3A 5EQAA 4M1VA 1NUYA 5F24A 3KC0A 2QVVA 2B4MA 3GYYA 4OVTA 4JVIA 1NV7A 2V3QA 1JP4A 1Q9DA 2F3BA 2FHYA 1FPFA 2HPGA 2WYKA 4FBPA 4GX6A 4DI3D 4GX3A 1FBHA 5ET8A 5IZZA 5IZ1A 3KC1A 1LBVA 2HZKA 1IMEA 1FPEA 2BJIA 1NV0A 4JVDA 4MCOA 1IMBA 2QVUA 2VT5A 4PETA 4PC9A 2FIXA 4OA4A 5EYGA 4MAGA 1FBDA 4PDDA 1LBWA 2FIEA 2VPNA 1NV6A 1RDXA 1FPKA 3A29A 4MJOA 1K9YA 5T3JA 5A5LA 1QGXA 2CEXA 1EYIA 2DE2A 2PFZA 3T0JA 3E79A 1KA1A 4QXDA 5ESYA 4N17A 4NF0A 4NQ8A 4P1EA 4PAIA 1DBZA 2WX9A 2V4CA 4P3LA 4LN5A 4G61A 2XA5A 5ET6A 5I3SA 1FBFA 4PBQA 4PFBA 2XWKA 3ROJA 4MIJA 4MEVA 3ISPA 4MNCA 4O8MA 2DE3A 4F1UA 4O94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P3N A;  1D9Q A;  2HHM A;  5J16 A;  1LBX A;  1FTA A;  1NUX A;  1NUZ A;  5ET5 A;  2QFL A;  5EQ8 A;  4GWY A;  3QMF A;  1NI9 A;  4I3E A;  2Y5K A;  2F3D A;  2FBP A;  1AWB A;  4N81 A;  4I3Y A;  5EQ7 A;  2FVZ A;  4KXP A;  5IZ3 B;  1LBY A;  1G0I A;  4GWX A;  1FJ9 A;  1VDW A;  1G0H A;  4GX4 A;  2PCR A;  4AS4 A;  2R8T A;  1BK4 A;  1KA0 A;  1NV1 A;  2CZI A;  2Q74 A;  1FPD A;  5LDZ A;  4GWS A;  1LEV A;  1FBG A;  2DDK A;  1DK4 A;  3B8B A;  1IMA A;  1FPJ A;  1IMC A;  3RPL A;  2OX3 A;  4GBV A;  4GWZ A;  3RPL B;  5EQ9 A;  1IMF A;  1FSA A;  1KZ8 A;  4HE2 A;  1CNQ A;  3IFC A;  2QVR A;  4O7I A;  3LUZ A;  2WBB A;  1RDZ A;  5ET7 A;  4H46 A;  2WBD A;  1NV5 A;  4I40 A;  1INP A;  1XI6 A;  3D1R A;  3FBP A;  1DCU A;  5FBP A;  1FJ6 A;  4HE0 A;  4GWW A;  4AS5 A;  1NV3 A;  1NV2 A;  3RYD A;  2JJK A;  4HE1 A;  1FPB A;  1FRP A;  4IR8 A;  1SPI A;  3BIH A;  5EYH A;  3KBZ A;  2OWZ A;  1YZ0 A;  2GQ1 A;  1NUW A;  1YYZ A;  1NV4 A;  2CZH A;  1RDY A;  1YXI A;  4GBW A;  1IMD A;  2Q8M A;  1FPL A;  3LV0 A;  4GWU A;  4H45 A;  1FBP A;  1K9Z A;  1FBC A;  4HXV A;  1EYJ A;  1EYK A;  1FPI A;  2CZK A;  2Y5L A;  1LBZ A;  4PTK A;  2WEF A;  1FBE A;  3IFA A;  5DW8 A;  1FPG A;  2P3V A;  3BIG A;  5IZ3 A;  5EQA A;  1NUY A;  5F24 A;  3KC0 A;  2QVV A;  1NV7 A;  1JP4 A;  1Q9D A;  2F3B A;  2FHY A;  1FPF A;  4FBP A;  4GX6 A;  4GX3 A;  1FBH A;  5ET8 A;  5IZ1 A;  3KC1 A;  1LBV A;  1IME A;  1FPE A;  2BJI A;  1NV0 A;  1IMB A;  2QVU A;  2VT5 A;  2FIX A;  5EYG A;  1FBD A;  1LBW A;  2FIE A;  1NV6 A;  1RDX A;  1FPK A;  3A29 A;  4MJO A;  1K9Y A;  5T3J A;  5A5L A;  1QGX A;  1EYI A;  3T0J A;  1KA1 A;  4QXD A;  5ESY A;  1DBZ A;  4G61 A;  5ET6 A;  5I3S A;  1FBF A;  3ROJ A; 
#chains in the Genus database with same CATH topology
 1A8F A;  3C4M A;  1NNT A;  5ET5 A;  1RKM A;  5TPA B;  1JVX A;  3MVY A;  4DLD A;  1UQW A;  1S50 A;  2ALU A;  1IXH A;  2R8T A;  4AB5 A;  4Q0C A;  3CIJ A;  3CRB A;  1BIY A;  2ESN A;  1P1U A;  1HSE A;  3FIR A;  3M8U A;  3UK4 A;  2OJT A;  4XKP A;  3K2D A;  4GXS B;  4BDR A;  1RDZ A;  1EZ9 A;  1B51 A;  3MZ9 A;  4NF6 B;  3PUX E;  1UIU A;  5HBC A;  2V93 A;  4N8Y A;  3CVG A;  3B50 A;  3ZS6 A;  4PF8 A;  4QF9 A;  2Y7I A;  3U65 A;  4GOT A;  4QFO A;  1Y20 A;  1IUD A;  3PPQ A;  1ZU0 A;  1XC1 A;  3FXR A;  1GVC A;  1Q1K A;  3KC0 A;  2ZNT A;  1ATG A;  5DVI A;  1MPB A;  5I57 A;  2Z8F A;  5IZZ A;  4I9D A;  4OET A;  3SER A;  1SYI A;  2BJI A;  2VT5 A;  2LAO A;  2Y84 A;  4U4S A;  3RNN A;  2FIE A;  1N0T A;  4ZEK A;  2DE2 A;  4OFO A;  3S9L C;  1SW4 A;  4PFB A;  4MNC A;  1DTZ A;  1TFA A;  3ISP A;  4OVR A;  2P3N A;  1LST A;  3O6H A;  4UAB A;  1SW5 A;  1LBX A;  4PFU A;  1JVY A;  3M3F A;  2Z8D A;  3TTN A;  3OEN A;  4YMA A;  4G68 B;  3IB0 A;  1FJ9 A;  4QFP A;  4U4X A;  3FJ7 A;  2F78 A;  3AXF A;  2Q9T A;  4KR5 A;  2I48 A;  2IEE A;  3KZG A;  4F29 A;  1MH3 A;  3B8B A;  1IMC A;  4BDM A;  2PX1 A;  4G68 A;  5J1D A;  4ELO A;  1MM6 A;  4OMB A;  4MX6 A;  1ANF A;  4PCD A;  5BUU A;  3C34 A;  2NWJ A;  1NKX A;  5I56 A;  3IB2 A;  4LQ5 A;  1USY H;  4MHF A;  1Y1M A;  2F6P A;  1FPB A;  4G8H A;  4GL0 A;  4OER A;  4NE4 A;  4HW8 A;  3B7D A;  4LAT A;  1PEB A;  4ND9 A;  1FBC A;  1EYK A;  1WOD A;  3PUW E;  4Q8R A;  4NTL A;  2XXH A;  5CBS A;  4XKQ A;  2X7P A;  4FAT A;  1IMB A;  5AA4 B;  4FOR A;  3RGY A;  3ECR A;  3SEX A;  4OFJ A;  5I2K B;  4ZE9 A;  1I6Q A;  1SDX A;  4MIJ A;  3R26 A;  4O94 A;  1NL5 A;  3PD9 A;  2XWI A;  2IA4 A;  4NF6 A;  3TTM A;  1I6B A;  1NI9 A;  4GVO A;  2B3F A;  3TUS A;  4TLL B;  4XFE A;  5JK4 A;  2A5T A;  2Y7P A;  4NX1 A;  1VDW A;  4EUO A;  4LVQ A;  1UTB B;  4PFT A;  3TCF A;  4EQB A;  2DOJ A;  4GWS A;  4KYE A;  3W9W A;  2V3U A;  4XTC Q;  2XWO A;  4KFQ A;  1IMA A;  4N6D A;  4GWZ A;  5H8H A;  3A3U A;  3VDF A;  1Z7N E;  4DI4 B;  1UIV A;  3V5A A;  5ET7 A;  1NV5 A;  4EQ7 A;  2O51 A;  1PB7 A;  2Q2A A;  4MF3 A;  1HSJ A;  2A5T B;  5EYH A;  5DTB A;  3KGC A;  4P1L A;  3O97 A;  4AB6 A;  5BWJ A;  2Q8M A;  3ILT B;  3UN6 A;  3LV0 A;  3H6T A;  3K0V A;  1FPI A;  4PTK A;  3MZB A;  1FBE A;  4DDD A;  1YAE A;  4NF5 A;  2F6G A;  4O3C A;  4LZ7 A;  2V3Q A;  1JP4 A;  4U1Z A;  5H8Q B;  2UVG A;  2O84 X;  4IO4 A;  1FBD A;  1I6A A;  4KCD A;  4GL8 A;  4PF6 A;  3CSB A;  1QGX A;  1B7Z A;  3T0J A;  1B1X A;  4LP2 B;  1Y9U A;  1JW5 A;  3G3K A;  4PGN A;  3FD3 A;  2WYP A;  3GBB A;  3I3V A;  4I3Y A;  1ZLQ A;  1POY 1;  1MY2 A;  5L9S A;  4YKP A;  5H8N A;  1US4 A;  4EF1 A;  4JB7 A;  1LAH E;  4ELR A;  1NV1 A;  4ONY A;  1NFT A;  2H9B A;  4Z7E A;  4LZ5 A;  3IB1 A;  2RIN A;  4NHB A;  1R1N A;  2ONS A;  3H3G A;  4OYV A;  2HAU A;  3QSL A;  1JEU A;  4YMB A;  2YJP A;  3PU5 A;  1BP5 A;  3K01 A;  2MKZ A;  3PMV A;  3CHG A;  2GQ1 A;  4OVP A;  3A09 A;  4YKJ A;  4FJP A;  3S4U A;  2XXX A;  5CMC A;  1DOT A;  2DWI A;  3QAX A;  3TTL A;  4O7M A;  3KN7 A;  1B0H A;  5K2Y A;  1H43 A;  4UA8 A;  2WEF A;  4GIZ A;  5DW8 A;  5IZ3 A;  1QUI A;  2XX7 A;  3GYY A;  3TQL A;  5KCJ B;  3MVW A;  1B0L A;  2VOZ A;  1TT1 A;  4F39 A;  1AMF A;  1ZMG A;  4ZEF A;  3H4Z A;  4MAG A;  4ELP A;  1FTO A;  2R71 A;  3SEW A;  2OK2 A;  1NV6 A;  1FPK A;  3JYR A;  1VE4 A;  2G93 A;  1R9L A;  1UTH A;  5IAI A;  1UTH B;  5F7V A;  4R6Y A;  1FTA A;  3O6G A;  4R6H A;  4X8R A;  4I3E A;  2QRY A;  4PBH A;  5KZT A;  2FBP A;  3EQ1 A;  3W9V A;  2PT1 A;  5FHO A;  2CEY A;  4F18 A;  1YTV A;  1LBY A;  1ZJL A;  2UVJ A;  2DWA A;  2PCR A;  2AIX A;  4N4U A;  2DP8 A;  1FQF A;  3KBR A;  1MY4 A;  1MG1 A;  1FTL A;  2B65 A;  1DK4 A;  4P9K A;  4GBV A;  3HST A;  1MDP 1;  3GZG A;  5HPQ A;  1LFH A;  2GFE A;  4EXL A;  1XHY A;  1QUK A;  1SW1 A;  4PFR A;  2XXK A;  4IY5 A;  5JTY B;  1ZKB A;  4XEQ A;  5H8N B;  4TOZ A;  4HE1 A;  3FXB A;  3PUZ E;  3KBZ A;  2FA7 A;  3VV5 A;  4BLA A;  5CC2 A;  4G4P A;  4GWU A;  4DXU A;  5AA1 A;  3DP4 A;  1K9Z A;  4H5G A;  3C33 A;  1LGB C;  4BDQ A;  4PE3 A;  2DQV A;  3C36 A;  4MBP A;  4U1O A;  5AA4 A;  4FBP A;  4GX6 A;  2XX9 A;  4ESW A;  4KCC A;  2QMX A;  1EZP A;  3MZ1 A;  4EF2 A;  4WXJ A;  2UVH A;  4BDO A;  4RK9 A;  1IXC A;  3UGW A;  4ELQ A;  1O64 A;  3VXB A;  2VPN A;  1H45 A;  1AIV A;  1KA1 A;  5ESY A;  4P1E A;  4PE5 B;  1QW0 A;  2QMW A;  2UXA A;  1B46 A;  4NF8 A;  4M4G A;  2F35 A;  3OMB A;  2GHA A;  4GWO A;  4F22 A;  1M5C A;  1OLA A;  4C1T A;  3V8X B;  4N81 A;  3RT8 A;  3U72 A;  1MXZ A;  1KA0 A;  4X1D A;  3EF7 A;  1UTB A;  5ITO A;  4H8J A;  4N15 A;  3G3J A;  3QIM A;  5EQ9 A;  1IMF A;  1XS5 A;  4R72 A;  4IY6 A;  4E0X A;  3TYH A;  5CRY A;  1N04 A;  4H46 A;  2F7B A;  3THI A;  5A5X B;  4YU0 A;  1N3X A;  1XVX A;  2P1S A;  1FQD A;  1XOC A;  2RCA A;  1N7W A;  4F19 A;  4EQ9 A;  2I4B A;  4WED A;  1RYX A;  3TQW A;  2XD2 A;  2Q2C A;  4TQU Q;  2VPO A;  3T66 A;  2OBG A;  5DEX A;  5FTH A;  2I58 A;  3TZA A;  2B4M A;  3FUZ A;  4OVT A;  2FHY A;  2WYK A;  5ET8 A;  3OXN A;  3F11 A;  1FPE A;  4JVD A;  1MH4 A;  5I58 A;  4OXV A;  2VP1 A;  4QXD A;  1D4N A;  4ZZA A;  3V83 A;  4R6K A;  1H76 A;  1B3G A;  3QUF A;  4MEV A;  2OCU A;  1D9Q A;  4Q5T A;  3N6U A;  3E9X A;  4F3P A;  3E4R A;  4DE8 A;  3MAM A;  4IO7 A;  4MH5 A;  3TDJ A;  4F3S A;  4OQO A;  4G2Z A;  4PGP A;  3U1O A;  4U22 A;  4GX4 A;  2O7I A;  3VVF A;  3FV2 A;  5H8S A;  3HHG A;  2W7Y A;  2I4C A;  2XD3 A;  5EHS A;  1LAX A;  5L8D A;  4O3B A;  4LON B;  4YB7 A;  1MY3 A;  3B6Q A;  4XIG Q;  1URD A;  3LSW A;  1LB9 A;  4DIG A;  1XT8 A;  5B70 A;  3IJO B;  3KN3 A;  1KZ8 A;  3SZP A;  1MXU A;  2X26 A;  4U23 A;  3TPA A;  5FHN A;  4O7I A;  2QS2 A;  3VVD A;  4I40 A;  3PPO A;  1BLF A;  5ISU A;  1MXV A;  1OIB A;  3FBP A;  1FJ6 A;  4N07 A;  4GWW A;  2O1M A;  1NV3 A;  2D3I A;  4GLI A;  1AOV A;  4KHZ E;  3FZV A;  1Y3Q A;  3IOW A;  3EHS A;  1A7L A;  1I69 A;  2ABH A;  3K00 A;  4H67 A;  1FBP A;  3PMX A;  3U93 A;  4ZEI A;  5I2N A;  1WVJ A;  4H8I A;  1FPG A;  2OWT A;  4EDP A;  3IAZ A;  2O7U A;  3HN0 A;  1ZIU A;  1B9J A;  2HPG A;  3RT6 B;  1VSO A;  2XXW A;  3KG2 A;  1B05 A;  4E0W A;  4QFK A;  2I0C A;  4OHN A;  4MJO A;  5AA3 A;  1B32 A;  3VLV A;  4PP0 A;  2XA5 A;  2P2A A;  3KN8 A;  4N13 A;  3Q28 A;  3I6V A;  3FXQ A;  4YB6 A;  3H7M A;  2CMO A;  1QKB A;  1WDN A;  1B3E A;  1MPC A;  4RY1 A;  1OMP A;  2DWJ A;  2H25 A;  1QVS A;  4GRK A;  1B5H A;  4ZS9 A;  1J1N A;  3OEL A;  2Y7R A;  4KQP A;  2RC9 A;  2Q89 A;  1IXI A;  4MFI A;  1B52 A;  1IZ1 A;  1MQJ A;  4HTG A;  3T9H B;  2OZZ A;  2F36 A;  5H8Q A;  1FSA A;  1EU8 A;  4LUB A;  1B2H A;  1VFD A;  4EXK A;  2XWV A;  3A3C A;  3MPL A;  4OEN A;  1B7H A;  5ELV A;  1T0K A;  3S9N C;  3E78 A;  1B6H A;  5LTC A;  5I58 B;  3MPK A;  4Z0I A;  4BDN A;  3PGF A;  2I6E A;  3MJN A;  3G3H A;  4QBA A;  3T9U A;  3GBA A;  5DEX B;  1S7Y A;  4R2B A;  3G7W A;  2XX8 A;  2O69 A;  3ODB A;  1B3H A;  4OEU A;  5DVJ A;  3KC1 A;  4R75 A;  1NV0 A;  4HS7 A;  5IKB A;  3OSQ A;  3IX1 A;  3SDF A;  1Y4C A;  2O1L A;  5CI5 A;  5M2V A;  3H6U A;  1JET A;  5I3S A;  2RKM A;  3K6W A;  1LLS A;  4JWY A;  3RUM A;  4F1Y A;  4OEV A;  1GTK A;  2ZZV A;  2HHM A;  3ZKK A;  3D4G A;  1NUZ A;  3IR1 A;  1B4Z A;  2Y5K A;  2NOO A;  4ISU A;  1ZTY A;  4RPO A;  1TFD A;  3QK6 A;  4IGR A;  1DSN A;  2QS3 A;  5JEI A;  2L5V A;  4U21 A;  3FJG A;  3G3I A;  1B58 A;  5K2X A;  4K3F A;  3H03 A;  3TCH A;  2DS9 A;  5I84 A;  2UVI A;  2I0B A;  1TXF A;  5FTI A;  3LUZ A;  5L9O A;  3I5O A;  2XXU A;  1B7U A;  2P0S A;  3E13 X;  4NED A;  2KQZ A;  1INP A;  1R9Q A;  1A8E A;  5IM2 A;  2NVU B;  1URS A;  3EPE A;  4I62 A;  4DXB A;  2FNC A;  1FRP A;  4IR8 A;  3RN8 A;  1DPP A;  5I5P A;  4G8N A;  4GFR A;  4H45 A;  3KJT A;  3VE1 B;  3N6T A;  3OO8 A;  1MPD A;  2D5W A;  4GQO A;  3TEL A;  4OVS A;  4FAJ A;  3T96 B;  3ZSF A;  2KR0 A;  3SEV A;  3IFA A;  1FQE A;  1AL3 A;  2P3V A;  1MQD A;  4G8M A;  1YCJ A;  3L6H A;  4JVI A;  1NV7 A;  2V84 A;  4UAC A;  1II5 A;  5IZ1 A;  3QYT A;  1US5 A;  1IME A;  3OO9 A;  4RJZ A;  3U94 A;  5A5L A;  5H8H B;  3E79 A;  4PQJ A;  1DBZ A;  3K1M A;  3WAE A;  4G61 A;  2O68 A;  3S2V A;  4F1U A;  3ROJ A;  3C35 A;  4LA9 A;  4NF4 B;  1P1W A;  3VLU A;  1OQG A;  2HAV A;  3QMF A;  1N3W A;  3USD A;  3HO7 A;  4H1X A;  2RF1 A;  3HHF A;  3MP6 A;  4NG7 A;  1AWB A;  5DT6 A;  4KXP A;  3LBS A;  4O3A A;  4X04 A;  3HFU A;  2OWS A;  1G0H A;  2ANJ A;  1FTM A;  2YPN A;  1JQF A;  3UIF A;  1SQY A;  3V89 B;  3NOH A;  1BK4 A;  2QS4 A;  4JVC A;  4JWO A;  1IXG A;  2QJE A;  2Q74 A;  1FPD A;  3TCG A;  5LDZ A;  4JXI A;  4GF8 A;  3B6W A;  5FHM A;  3RPL A;  3IJX B;  1MQG A;  1B5I A;  4I1D A;  4JSD A;  4N6P A;  4P56 A;  2WBB A;  1MM7 A;  1XVY A;  3RTF B;  1Y1Z A;  4FEC A;  2UYF A;  3KOS A;  3G3G A;  1MS7 A;  1PC3 A;  2F7C A;  1JEV A;  4I8C A;  3Q26 A;  1B40 A;  1GR2 A;  3IK6 B;  1BKA A;  4N8G A;  2HEU A;  1IIW A;  2H4I A;  1RDY A;  1IMD A;  5KDT B;  1FPL A;  4HCY A;  1P1Q A;  4HXV A;  2CZK A;  1FQA A;  1Y4T A;  1LBZ A;  4P0G A;  1M5F A;  1LAG E;  3TTR A;  2QVV A;  4JWX A;  1JNF A;  3M3L A;  4GX3 A;  2AL4 A;  2Q8J A;  4PC9 A;  1YPN A;  2FIX A;  2ZNS A;  1ZBM A;  5EYG A;  3SEU A;  1POT A;  3A29 A;  5T3J A;  3TTK A;  1PDA A;  1B3L A;  3R7X A;  4PAI A;  3FGS A;  3OSR A;  1NH8 A;  3RPW A;  3OD7 A;  2Y7W A;  1ELJ A;  1R6Z A;  2F8D A;  3N94 A;  3PPN A;  3OO7 A;  3H6V A;  3C32 A;  4GXA A;  2BJJ X;  5J16 A;  2RC8 A;  4BDL A;  5TPA A;  4QSD A;  4JSO A;  1N7X A;  3RQT A;  4P47 A;  3CFX A;  4H0W A;  4MMP A;  2ZYK A;  4AQ4 A;  4ZE8 A;  3R6U A;  1LBC A;  3CSG A;  3MBP A;  2REJ A;  3E3K A;  1JW4 A;  1LCF A;  2DXY A;  4U2R A;  1M5B A;  4IGT A;  1EH3 A;  4IO2 A;  3WAF A;  4HE2 A;  1LFG A;  3IFC A;  2QVR A;  3O2A A;  1FQB A;  5I7I A;  2F34 A;  4X9T A;  3HCQ A;  2GH9 A;  5CBR A;  2B4L A;  3B6T A;  3O29 A;  2E1S A;  1MXY A;  5B7D A;  3RYD A;  4NMY A;  4OVJ A;  2I3V A;  3SEY A;  2HXW A;  1KWH A;  1NMU A;  2WKY A;  4H65 A;  3FAT A;  2DSF A;  2AYS A;  3LC8 A;  4MNP A;  2DVZ A;  3O6I A;  2ZYN A;  3DEL B;  1FPF A;  3KEI A;  4H6D A;  1S9T A;  3ILU B;  1JW1 A;  4X1B A;  3Q25 A;  3IL1 B;  2HZK A;  3K4U A;  4PET A;  3CFL A;  2QVU A;  3OEK A;  4IO5 A;  4DI3 D;  1RDX A;  4YKK A;  4DXC A;  4P11 A;  5A5X A;  2NXO A;  1GV8 A;  4RNS A;  2F5X A;  1MY1 A;  3T93 B;  5EQ8 A;  5H8F A;  1USY E;  2H99 A;  3QXM A;  3G3F A;  4NN3 A;  4XKR A;  3DLN A;  4YZZ A;  3GXA A;  4AS4 A;  2H5Y A;  3KSX A;  2ONK E;  1FTK A;  1SYH A;  3FVN A;  3BBR A;  3IOT A;  4G68 C;  4KYS A;  5ICT A;  2PYY A;  4IO3 A;  4XXU A;  2M8C A;  2XXR A;  3RPL B;  3Q29 A;  1GGG A;  4YAH X;  4POX A;  2HXR A;  4IO6 A;  5EYF A;  2RCB A;  5KDT A;  1QKA A;  2WBD A;  4F2Q A;  3BFU A;  4PFI A;  1XI6 A;  2HCA A;  1F9B A;  1NH7 A;  1EZO A;  4N91 A;  4YKI A;  5CMB A;  1M5D A;  1NUW A;  2ZZW A;  3KFM A;  2F97 A;  2PVU A;  4HCW A;  2QL3 A;  2CZL A;  4F3B A;  4KD5 A;  4OAN A;  2DE4 A;  3RTW B;  3FJM A;  2DWH A;  1FW0 A;  3MWB A;  3PD8 A;  3MP8 A;  4RXL A;  4F1V A;  1IIT A;  5EQA A;  4M1V A;  1PB8 A;  3MVX A;  1QUJ A;  2XHD A;  4X48 A;  5ICQ A;  1FCK A;  2XXP A;  1PBQ A;  4WEP A;  4JDF A;  3FVG A;  3DP6 A;  1SW2 A;  4NF8 B;  4PAK A;  2CEX A;  2VD3 A;  1L5T A;  4R74 A;  4YIC A;  5EHM A;  1URG A;  1HSL A;  3ZKL A;  4QSE A;  4PBQ A;  3DM0 A;  3IOV A;  5CMM A;  1NUX A;  1N76 A;  3M3K A;  3O9P A;  2PFY A;  1MXW A;  3H6W A;  2F3D A;  3CFZ A;  1B3F A;  1D3K A;  4OWD A;  3MUQ A;  4MNI A;  4PFW A;  3LSL A;  4LZ8 A;  3O28 A;  2UYE A;  4KPT A;  3HV1 A;  3KJ7 A;  2PBW A;  2OLB A;  1FBG A;  2V25 A;  3QUJ A;  4OZ9 A;  4ZDM A;  3VXC A;  3UP9 A;  3IOU A;  4C1U A;  5AA2 B;  2DVC A;  1LFI A;  2H98 A;  1OLC A;  1P1O A;  2I49 A;  1MQI A;  1H44 A;  4RK2 A;  2Q88 A;  5JTY A;  1LB8 A;  1FQC A;  3D1R A;  3FVK A;  4HE0 A;  4DZ1 A;  1NV2 A;  3FXU A;  3BIH A;  5AA2 D;  2ZYO A;  4FE8 A;  4P8B A;  2CZH A;  1Z7M E;  2OPE A;  3K1P A;  4R73 A;  4N6K A;  5KCJ A;  1SI0 A;  1SI1 A;  2HFB A;  4NGU A;  1DMB A;  5CM6 A;  2XXT A;  1QUL A;  3K02 A;  3MYU A;  1MY0 A;  3C31 A;  4FEB A;  4ESX A;  1NUY A;  5F24 A;  1D9Y A;  1Q9D A;  3MC2 A;  1A99 A;  2HQ0 A;  3PPR A;  3LUY A;  1M5E A;  5LOM A;  1MQH A;  2R9J A;  5H8F B;  3UA8 A;  3MVZ A;  4G77 A;  1Y3P A;  1K9Y A;  3T22 A;  4N17 A;  3TEP A;  2DYX A;  4FIM A;  4O8M A;  1NNK A;  1TWY A;  3VLW A;  4ZEB A;  2FYI A;  2G29 A;  3SKP A;  2QPQ A;  1PB9 A;  3U92 A;  4H5F A;  4YB5 A;  2V3T A;  4WKM A;  1G0I A;  2E0S A;  1O7T A;  4OES A;  3L6G A;  2ZNU A;  1VFE A;  3MST A;  3VVE A;  1A55 A;  1LEV A;  4MLV A;  1MRP A;  2Z22 A;  1VR5 A;  2PMS A;  3Q27 A;  4RPN A;  4OVQ A;  2YLN A;  1CE2 A;  2AL5 A;  4L17 A;  1OVB A;  3MQ9 A;  3W15 C;  5IGA A;  1YZ0 A;  4NAP A;  4ZED A;  1NV4 A;  1YXI A;  2NUV A;  1OQH A;  1DPE A;  2Y7K A;  4OTE A;  3VFJ A;  1O63 A;  1EYJ A;  4NF5 B;  1RYO A;  2THI A;  3EN3 A;  3CI8 A;  4OFL A;  3KSJ A;  3BIG A;  2VGQ A;  3IO6 A;  5AA2 A;  2F3B A;  4LQ2 A;  3N26 A;  3OO6 A;  3TMG A;  4NWD A;  5DVF A;  3FAS A;  4R9G A;  1OVT A;  5L9M A;  4R2F A;  2ONR A;  4GD5 A;  3PV0 E;  4OA4 A;  1AH5 A;  1EYI A;  4NQ8 A;  3H06 B;  4P3L A;  4LN5 A;  1IEJ A;  1NNF A;  5I2N B;  1MXX A;  3CR9 A;  3FVO A;  3RLF E;  4KI0 E;  3DP8 A;  3TFL A;  1PBP A;  2I3W A;  2ZXT A;  4GWY A;  4ECF A;  1MDQ A;  1B5J A;  1SBP A;  2GHB A;  3K6U A;  4DCX A;  5EQ7 A;  3IOR A;  1IQ7 A;  3JZJ A;  2QSX A;  3LSX A;  4R9F A;  4PAF A;  2XXQ A;  2XXI A;  1LBB A;  5TP9 A;  1A40 A;  3U8Q A;  4XKN A;  2VHA A;  2DDK A;  3ONM A;  2F7A A;  2OX3 A;  1Q35 A;  4F31 B;  3BFT A;  4TLM B;  3TAJ A;  5I56 B;  3LR1 A;  2ZYM A;  1H3D A;  5F1Q A;  3PTY A;  3P7I A;  3EHT A;  1SVX B;  5I2K A;  4FED A;  4QHQ A;  4NF4 A;  1CB6 A;  4AS5 A;  4QFN A;  2JJK A;  1Y3N A;  1SPI A;  1NNP A;  2OWZ A;  3K6X A;  3K6V A;  5I59 B;  4GBW A;  1N84 A;  2REG A;  2A5S A;  2OPD A;  2ZZX A;  2HZL A;  3CG1 A;  3BKI B;  1LCT A;  1B4H A;  3PMW A;  3GLB A;  1BTJ A;  1FBH A;  2D21 A;  2X7Q A;  3SET A;  4MCO A;  2DXR A;  4THI A;  4F3G A;  3CG3 A;  2ZMB A;  4NF0 A;  2Z23 A;  2V4C A;  5ET6 A;  2O6A A;  1FBF A;  3PUV E;  2XWK A;  1P1N A;  5CMK A;  4PFY A;  2DE3 A;  3PUY E;  3RY3 A;  3TOD A;  5AE4 A;  2QFL A;  3HPI A;  4JBZ A;  3T1B A;  3IO4 A;  2FVZ A;  5I59 A;  5IZ3 B;  4GWX A;  1LAF E;  5TU0 A;  1P99 A;  2KLF A;  1SD3 A;  4QFL A;  3C9H A;  4XF5 A;  1D9V A;  5DYH A;  3O66 A;  4NWC A;  2CZI A;  3TKD A;  2QS1 A;  3SES A;  4F2O A;  2PT2 A;  3KOT A;  4MLQ A;  4QSC A;  3LSF B;  1FPJ A;  4POW A;  4DCY A;  1CNQ A;  4QRZ A;  3JV9 A;  3OEM A;  3EKI A;  4P0I A;  5ITP A;  2R6G E;  3K1N A;  4Q30 B;  4IB2 A;  1FTJ A;  5FBP A;  1DCU A;  4C0R A;  2B3B A;  1B1H A;  3EHU A;  4ZZE A;  1YYZ A;  3PPP A;  4RA1 A;  5TP9 B;  3FV1 A;  3T9X B;  3S9E A;  2Y5L A;  1A54 A;  1QJM A;  2GRV A;  3S9M C;  3N5L A;  4RYA A;  4ZEC A;  3UOR A;  2RC7 A;  1LBV A;  3MP1 A;  3OOA A;  5HM4 B;  3D4C A;  4PDD A;  1LBW A;  2XXV A;  2Z8E A;  2PFZ A;  5I57 B;  2XXY A;  2WX9 A;  1DTG A;  3T9V A;  3MW0 A;  4KYD A;  2VD2 A;  4PDH A; 
#chains in the Genus database with same CATH homology
 2P3N A;  2F5X A;  1D9Q A;  2ZZV A;  2HHM A;  4PGN A;  4UAB A;  5J16 A;  1LBX A;  1FTA A;  1NUX A;  1NUZ A;  5ET5 A;  2XWI A;  2PFY A;  2QFL A;  2WYP A;  5EQ8 A;  4GWY A;  4P47 A;  3QMF A;  1NI9 A;  4PF6 A;  4I3E A;  4X8R A;  2Y5K A;  2QPQ A;  4MMP A;  4PBH A;  2F3D A;  3T1B A;  2FBP A;  4NG7 A;  4XFE A;  3W9V A;  2CEY A;  1AWB A;  4N81 A;  4F18 A;  4I3Y A;  5EQ7 A;  5JK4 A;  2FVZ A;  4KXP A;  5IZ3 B;  1LBY A;  4NN3 A;  1G0I A;  4NX1 A;  4GWX A;  3HFU A;  1FJ9 A;  4MNI A;  4PGP A;  1VDW A;  4X04 A;  4YZZ A;  1G0H A;  4GX4 A;  2PCR A;  4AS4 A;  4N4U A;  2R8T A;  4PAF A;  2L5V A;  4XF5 A;  3NOH A;  1BK4 A;  1KA0 A;  1NV1 A;  2CZI A;  2Q9T A;  4JVC A;  3MST A;  2Q74 A;  1FPD A;  5LDZ A;  4GWS A;  1LEV A;  3W9W A;  1FBG A;  2DDK A;  1DK4 A;  3B8B A;  2XWO A;  4N15 A;  4P9K A;  1IMA A;  1FPJ A;  1IMC A;  3RPL A;  2OX3 A;  4GBV A;  4N6D A;  4GWZ A;  3RPL B;  4PAK A;  5EQ9 A;  4NHB A;  1IMF A;  1FSA A;  1KZ8 A;  4HE2 A;  3SZP A;  1CNQ A;  4DI4 B;  2HXR A;  3IFC A;  2QVR A;  4O7I A;  2XWV A;  4P56 A;  4PFR A;  5I7I A;  5J1D A;  4X9T A;  3LUZ A;  2WBB A;  1RDZ A;  5ET7 A;  4OVQ A;  2XXK A;  3EKI A;  4H46 A;  2WBD A;  1NV5 A;  4YIC A;  4I40 A;  4MX6 A;  2B4L A;  4PCD A;  4PDH A;  3PTY A;  4PFI A;  2KQZ A;  1INP A;  1XI6 A;  3D1R A;  3FBP A;  1DCU A;  5FBP A;  1FJ6 A;  4OVR A;  4XEQ A;  4HE0 A;  3E78 A;  4GWW A;  4AS5 A;  1NV3 A;  5IM2 A;  1NV2 A;  5LTC A;  4MHF A;  3RYD A;  2JJK A;  4HE1 A;  4N8Y A;  1FPB A;  1FRP A;  4IR8 A;  2MKZ A;  3FXB A;  4N91 A;  1SPI A;  3BIH A;  5EYH A;  4N8G A;  3KBZ A;  2OWZ A;  3B50 A;  4P1L A;  5IGA A;  4PF8 A;  1YZ0 A;  4NAP A;  3CHG A;  2GQ1 A;  1NUW A;  4OVP A;  2ZZW A;  4F19 A;  1YYZ A;  5I5P A;  3U65 A;  1NV4 A;  4P8B A;  2CZH A;  1RDY A;  1YXI A;  4GBW A;  1IMD A;  2Q8M A;  4HCW A;  1FPL A;  3LV0 A;  4GWU A;  4H45 A;  4OAN A;  4HCY A;  1FBP A;  1K9Z A;  4N6K A;  2DE4 A;  4O7M A;  4QBA A;  1FBC A;  4HXV A;  1EYJ A;  1EYK A;  1FPI A;  2CZK A;  4PE3 A;  4OVS A;  2VPO A;  4MNP A;  2Y5L A;  1LBZ A;  4PTK A;  4NGU A;  5CM6 A;  2WEF A;  1FBE A;  2DVZ A;  2HZL A;  3IFA A;  5DW8 A;  1FPG A;  2P3V A;  2KR0 A;  2ZZX A;  3BIG A;  3MYU A;  4F1V A;  5IZ3 A;  5EQA A;  4M1V A;  1NUY A;  5F24 A;  3KC0 A;  2QVV A;  2B4M A;  3GYY A;  4OVT A;  4JVI A;  1NV7 A;  2V3Q A;  1JP4 A;  1Q9D A;  2F3B A;  2FHY A;  1FPF A;  2HPG A;  2WYK A;  4FBP A;  4GX6 A;  4DI3 D;  4GX3 A;  1FBH A;  5ET8 A;  5IZZ A;  5IZ1 A;  3KC1 A;  1LBV A;  2HZK A;  1IME A;  1FPE A;  2BJI A;  1NV0 A;  4JVD A;  4MCO A;  1IMB A;  2QVU A;  2VT5 A;  4PET A;  4PC9 A;  2FIX A;  4OA4 A;  5EYG A;  4MAG A;  1FBD A;  4PDD A;  1LBW A;  2FIE A;  2VPN A;  1NV6 A;  1RDX A;  1FPK A;  3A29 A;  4MJO A;  1K9Y A;  5T3J A;  5A5L A;  1QGX A;  2CEX A;  1EYI A;  2DE2 A;  2PFZ A;  3T0J A;  3E79 A;  1KA1 A;  4QXD A;  5ESY A;  4N17 A;  4NF0 A;  4NQ8 A;  4P1E A;  4PAI A;  1DBZ A;  2WX9 A;  2V4C A;  4P3L A;  4LN5 A;  4G61 A;  2XA5 A;  5ET6 A;  5I3S A;  1FBF A;  4PBQ A;  4PFB A;  2XWK A;  3ROJ A;  4MIJ A;  4MEV A;  3ISP A;  4MNC A;  4O8M A;  2DE3 A;  4F1U A;  4O94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...