3RYDA

Crystal strucutre of ca bound impase family protein from staphylococcus aureus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
263
structure length
261
Chain Sequence
DKTLQQIDKLICSWLKQIDNVIPQLIMEMTTTKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase family protein
publication title Crystal structure of Staphylococcal dual specific inositol monophosphatase/NADP(H) phosphatase (SAS2203) delineates the molecular basis of substrate specificity
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 72
structure length 261
sequence length 263
chains with identical sequence C
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2011-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3rydA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3rydA02
2WBBA 2Y5LA 4GWYA 4GX3A 5ET6A 4KXPA 1FPIA 1NV1A 1K9ZA 2WEFA 2FHYA 5EYGA 1RDZA 1FBEA 1FPBA 1FPDA 1KA1A 1YXIA 3RYDA 1YZ0A 3KC1A 1FBFA 1LEVA 4I40A 4IR8A 4QXDA 5F24A 4GX4A 1G0HA 1SPIA 5J16A 3BIHA 1KZ8A 1FPFA 1IMBA 1XI6A 5EQ9A 1NI9A 5EQAA 1FBCA 2F3DA 3IFCA 1K9YA 3ROJA 2FIEA 2PCRA 4PTKA 1DBZA 1FJ9A 3RPLB 1G0IA 1VDWA 3RPLA 2CZIA 2DDKA 1NV6A 3A29A 1NV2A 2OWZA 1JP4A 1NV4A 5EQ7A 1BK4A 1EYJA 3LV0A 1FPEA 1RDYA 1IMDA 3IFAA 5IZ3B 1LBYA 1YYZA 2FIXA 5IZ3A 1FPGA 2F3BA 4AS4A 4FBPA 2Y5KA 2FBPA 1NV5A 1NV3A 4HE0A 3FBPA 2Q74A 1NV0A 2QFLA 4H45A 2P3NA 2FVZA 5A5LA 1DK4A 4G61A 1NUXA 2QVVA 5FBPA 1RDXA 4I3EA 1FBHA 2CZHA 2VT5A 5ET8A 1INPA 1NUWA 3KC0A 2OX3A 1FPLA 1FPJA 2R8TA 3LUZA 5EYHA 1D9QA 5IZ1A 2QVRA 1NUZA 4O7IA 3D1RA 4MJOA 4GX6A 1FBPA 2JJKA 5I3SA 3QMFA 4GWUA 4GWXA 3BIGA 4HE2A 1FPKA 1AWBA 1IMFA 1NUYA 1FBGA 1IMEA 4GWZA 4I3YA 1LBZA 4GWWA 3B8BA 1QGXA 5LDZA 4HE1A 1FTAA 1KA0A 1Q9DA 4H46A 2BJIA 5EQ8A 2QVUA 1FSAA 4HXVA 2Q8MA 5ET7A 5ET5A 1LBWA 1EYKA 5ESYA 1DCUA 4AS5A 1FRPA 5T3JA 4GBWA 3T0JA 1LBXA 2P3VA 1EYIA 4GBVA 1FBDA 3KBZA 2WBDA 1FJ6A 2CZKA 4N81A 2HHMA 1NV7A 1LBVA 1CNQA 2GQ1A 5DW8A 4GWSA 1IMCA 1IMAA
chains in the Genus database with same CATH superfamily
1JETA 4WXJA 3CSGA 1FPIA 4F22A 3FXQA 3TFLA 1JQFA 1FCKA 5CC2A 1QUIA 4C0RA 1P1NA 3QAXA 2Q2AA 4Z0IA 4F19A 4JSOA 1XI6A 4BLAA 3CR9A 1O7TA 2NUVA 3IFCA 1MDP1 4PTKA 4PFRA 4ZEKA 4KD5A 1NNKA 1A54A 1YCJA 1NV6A 4EXKA 1GVCA 1JP4A 4R9FA 3FJ7A 1RYXA 1FPEA 3P7IA 3VDFA 4LVQA 4AS4A 4YKJA 5DVIA 1LLSA 2I49A 4G8HA 1RDXA 3W15C 1UIVA 2DWIA 4RY1A 4PFTA 4ISUA 4PFUA 3LUZA 4O7IA 1P1QA 1I6BA 5BWJA 5CMCA 1M5CA 3T9HB 4RXLA 3ODBA 4QF9A 1IMFA 5CBSA 3V5AA 4P47A 3B6QA 4GWWA 5EQ8A 2BJIA 4RPNA 5ICTA 3EHUA 4DZ1A 1LCFA 5I84A 3WAFA 1SW4A 4PF6A 3T0JA 4PFBA 2RCAA 3I6VA 4NGUA 3U92A 3O6GA 4QSDA 3A3UA 1LGBC 2ONRA 4PC9A 3QUFA 1N84A 4MF3A 2X7QA 4E0XA 2WBBA 3G3JA 4YB6A 2O69A 3FVGA 4DDDA 2QMXA 1FW0A 1FPBA 3T93B 5AA4A 4IB2A 1FPFA 4F3SA 5JEIA 4NF4A 4ZZEA 1USYE 1MXYA 2O1LA 2OWZA 5AA2A 3O9PA 2PT2A 3C4MA 3K01A 2XXUA 3PPNA 4BDLA 3VFJA 5JTYB 1D4NA 1HSEA 3LC8A 4ELRA 1ZKBA 3IJXB 4F31B 2F3BA 3QSLA 1AL3A 3HN0A 2A5TA 3USDA 1NV5A 3MZBA 4KCCA 1SYIA 1VSOA 1HSLA 4N13A 4XKQA 2UYEA 2W7YA 3OXNA 4NF8B 2HXWA 2R8TA 5IZ1A 5HBCA 4EF2A 3O6HA 3TUSA 4MJOA 2CEXA 4EF1A 4Q5TA 4N91A 4MBPA 1PBPA 4PE3A 1MPBA 1MQIA 1OQGA 3TCGA 4NQ8A 3R6UA 1AH5A 4OESA 5LDZA 4QSEA 2ABHA 2Q8MA 3MPKA 1LFGA 2DWJA 1M5EA 5IM2A 1UTHB 2H25A 3RTWB 3MW0A 4N6PA 1FBDA 3M3FA 2NWJA 1SI0A 4OVPA 1IMCA 2B4MA 4H1XA 2O84X 1M5FA 4GL0A 2RF1A 1Z7ME 1FBEA 1YXIA 2KLFA 2VOZA 3DLNA 4RPOA 3O97A 4MLQA 1RYOA 1FJ9A 1NL5A 3TQLA 3OEKA 4R2BA 1TFDA 5H8FA 3C36A 1B51A 2VD2A 1MXVA 1QKBA 5FHNA 1BTJA 4YKIA 2KQZA 4L17A 3ZKLA 1S50A 4HCYA 2ZNUA 2ZZVA 3IL1B 4F2QA 1BIYA 4BDMA 1SI1A 2RC9A 1FPJA 3K6WA 2O1MA 2DVCA 1ZBMA 4R73A 1POY1 4C1UA 1SW1A 1NMUA 4MCOA 2F35A 1NUYA 4H0WA 4F1YA 1ZLQA 5H8NB 1FTAA 4P0GA 2Y7IA 3UA8A 3FD3A 1B40A 4UACA 1XT8A 4OVSA 1QULA 1WDNA 5ET5A 3PUYE 1I6AA 1MS7A 4OERA 4N6KA 3L6HA 1B7HA 4G68A 1IXHA 4IGTA 4GRKA 1LFHA 2HHMA 4R6YA 4Q8RA 4KCDA 1LAXA 3FV1A 5ET6A 3PD9A 1MQDA 1NV1A 5EYGA 1S7YA 1LAHE 1FQFA 4OTEA 1IXCA 2DXYA 1SPIA 1OLCA 4PCDA 3W9VA 1MXXA 2RC8A 2XWKA 1FBCA 2QPQA 4N8GA 4FE8A 2BJJX 4JBZA 5F1QA 4K3FA 3U93A 1UIUA 2XXXA 2Q8JA 3PUXE 2ZYMA 4NF6B 5IZ3B 1P1UA 4PAFA 1D9VA 3QXMA 4P56A 2B3BA 3VVDA 3KJ7A 1A99A 1TWYA 3U65A 3OO8A 2X7PA 2P0SA 4P11A 2VT5A 2HZLA 3KC0A 4GVOA 4LATA 4YZZA 5IZZA 4JVCA 4NEDA 1B3GA 4PQJA 3KEIA 1BLFA 2V84A 4HTGA 3U1OA 4LZ5A 5TPAB 1FPKA 4N07A 2RINA 4KPTA 4DIGA 4ELOA 4ONYA 5FTHA 4BDNA 4P9KA 4OVQA 5AA1A 3E3KA 2QMWA 4OQOA 1DTGA 1H43A 4THIA 4OETA 1ZJLA 1EYKA 3TQWA 3OD7A 3UP9A 3H6UA 3OSQA 5H8QB 1SQYA 3F11A 3TTRA 4PDHA 3LR1A 3N6TA 1IUDA 3OOAA 4X04A 4AQ4A 5I59B 3IB1A 1SBPA 2XXIA 2DP8A 4HS7A 1D9QA 1Y3QA 5I56A 4YKPA 2XXTA 1POTA 5H8SA 2X26A 2PX1A 2H9BA 3PPOA 1SYHA 3C33A 3R26A 4ZE9A 5A5XB 1M5BA 4I1DA 4F3BA 4XKRA 4TLMB 5K2XA 2RC7A 2I48A 4KR5A 5CMMA 3IFAA 3HSTA 3KSXA 1FPGA 4YICA 2ZYKA 2Y5KA 3RT8A 3FBPA 3PMXA 2DE4A 3K2DA 4G8MA 3IR1A 2Y7WA 1GV8A 3K6XA 4I3EA 4BDOA 3VLVA 4KYSA 1IXIA 4H65A 3HO7A 2Q88A 1LBCA 4JVDA 3HHGA 4GWUA 4XXUA 3H6WA 1YTVA 4JWOA 3TZAA 1A8FA 4XF5A 3C32A 5I5PA 4U1OA 3KG2A 2F97A 3Q28A 3B50A 2I4CA 4EQ9A 1Z7NE 4DLDA 3ZSFA 1H45A 2HQ0A 4GBVA 3S4UA 1A7LA 3TEPA 4KHZE 1B6HA 1MPDA 3L6GA 2M8CA 3C9HA 1WODA 4P8BA 3EQ1A 2D21A 3JYRA 2KR0A 4GX4A 4OFOA 1KZ8A 3PPPA 1NNFA 3H4ZA 2WYPA 2HXRA 4U23A 3KN3A 2XHDA 3FASA 4YB5A 1G0IA 3SZPA 5DYHA 1ZIUA 1QUKA 3TCHA 3K4UA 2XX8A 3DP8A 5L9SA 2XX7A 4FBPA 1Y1MA 1JNFA 4ZZAA 3PTYA 4GXAA 1IXGA 1TT1A 1B4HA 3O2AA 2V93A 2F8DA 2ZNTA 2QVVA 2QS1A 4P1EA 4POWA 1H3DA 2CZHA 4G2ZA 1NUWA 2OX3A 3SERA 1FTOA 1B3FA 4GIZA 3S2VA 4OYVA 2QVRA 1NUZA 3OENA 2DE3A 2XD3A 3QMFA 1DOTA 3JV9A 1FBGA 2YPNA 1J1NA 4PBQA 4F18A 1Q9DA 4NF5B 5M2VA 1URGA 2OWSA 5AA3A 3LSWA 3CFLA 4WEPA 1JW5A 2ZYOA 3HV1A 1GR2A 3KBZA 3VVFA 1T0KA 2E0SA 4OWDA 5KCJB 3MWBA 3Q27A 3O66A 1NFTA 2XD2A 2OPDA 4GX3A 1DTZA 2V4CA 3FV2A 1S9TA 3BFUA 3OEMA 4YKKA 1FPDA 3RYDA 1B46A 4I40A 5J16A 3UN6A 2XXHA 4X8RA 1PEBA 5HPQA 1JW1A 2XA5A 3TODA 3G3IA 1AIVA 3EN3A 2FIEA 3C35A 1MQHA 4TQUQ 2PVUA 1B52A 2CZIA 2UXAA 5IGAA 1ELJA 3ISPA 2AL4A 1FTKA 1BK4A 1SDXA 1EYJA 1IMDA 1UTBA 4GD5A 1LBYA 2UVGA 3CRBA 4O8MA 3N5LA 1NV3A 3V83A 2WX9A 2QFLA 3SKPA 2GH9A 5I58B 5KDTA 2I3WA 1B7UA 3IO4A 5H8QA 5DVFA 2CEYA 3TTNA 5H8HB 4ZEFA 4HW8A 3PD8A 4QBAA 3BIGA 3KZGA 4I62A 1LAFE 5I2NB 3B8BA 5DEXB 2I0CA 1EH3A 3RT6B 1QVSA 2QL3A 5L9OA 3IB0A 3PMWA 4FAJA 4RK2A 5ET7A 3K6UA 1DCUA 4G8NA 4N4UA 4RJZA 2WBDA 4FJPA 4DCXA 4MEVA 4OA4A 1AOVA 5F7VA 2O7IA 1LBVA 1XS5A 2VP1A 1B2HA 3Q25A 4X1BA 2OPEA 3I5OA 1B3EA 4U2RA 4R74A 2ZZWA 4XKPA 4QFNA 2F6GA 2FHYA 1FQEA 5I2KA 1MY0A 4RK9A 5I57A 1FTLA 2H5YA 2AYSA 3SEVA 4MMPA 1EZ9A 1D3KA 2GFEA 3K02A 2YJPA 3ROJA 4U1ZA 2I0BA 1DBZA 4O3AA 3RPLB 3PGFA 4IY6A 1NV2A 2GHBA 4DXUA 5EQ7A 4XTCQ 1XVXA 2Z8DA 4LQ2A 3TAJA 1QUJA 3BFTA 1YYZA 4O3CA 1EU8A 2F78A 3KOTA 1JVYA 2F36A 3E79A 5TP9B 4FEDA 3KN7A 3MP1A 3RTFB 3K6VA 1XHYA 3CG3A 3KOSA 1CE2A 3Q26A 5EYHA 3RLFE 2RKMA 3HHFA 2ANJA 3D1RA 5ELVA 5K2YA 3PUWE 2O68A 1B5IA 3IX1A 1ATGA 4QRZA 1B5HA 2ZNSA 1KA0A 4QFLA 3E4RA 4WEDA 4MAGA 3B6TA 1LBWA 3M8UA 1MXWA 2DXRA 3GXAA 2P3VA 3K00A 3T22A 1LFIA 1P1OA 3GZGA 2UVHA 3TPAA 3RY3A 4N81A 5L8DA 2OLBA 3MSTA 2GQ1A 2PT1A 4H5GA 3GBAA 1OVBA 3KN8A 1YPNA 3O6IA 3IOTA 1KA1A 3ZKKA 3KC1A 3MUQA 1IZ1A 1G0HA 3VV5A 4NWCA 4MFIA 5EQ9A 4OMBA 3MP8A 3T1BA 5TU0A 5IAIA 2PFYA 3MVWA 2G29A 3FATA 1IITA 1MY1A 3KBRA 3D4CA 3ILUB 3IO6A 4R72A 4H6DA 1FTJA 2UYFA 1UQWA 3IK6B 5CBRA 2REGA 3TTLA 1B1XA 1FQDA 4R2FA 1Q35A 4OEUA 2FNCA 2V3QA 4G61A 3TTKA 4NX1A 4MIJA 3MZ9A 4NHBA 4TLLB 4IY5A 5CRYA 3FXUA 3SESA 3FXBA 1LAGE 2F7AA 2RCBA 1NH8A 4PAKA 4JVIA 5I3SA 4JSDA 4MLVA 1MH3A 1QGXA 1N3WA 4ESWA 2I3VA 1O64A 2D3IA 3V89B 1SD3A 1DPPA 3B6WA 2Q2CA 5ESYA 2V25A 3FJMA 2HPGA 2XWOA 3B7DA 4NTLA 2OK2A 2OWTA 3QYTA 3MPLA 1FJ6A 1OVTA 4RYAA 1I69A 2PYYA 3MVYA 3PPQA 1ZMGA 3MC2A 5DT6A 1FQAA 1RDZA 1B1HA 1GGGA 5AA4B 3HCQA 2FYIA 1LEVA 1N7WA 2HAVA 1VR5A 1JW4A 4N8YA 2VHAA 2Z22A 3N94A 3VLWA 3SEXA 3VE1B 2HAUA 5AA2B 4OHNA 4OFLA 3RNNA 2O51A 4ZEBA 3KFMA 3CVGA 5JTYA 4KI0E 3S9LC 2A5TB 1URSA 1B4ZA 2NOOA 2F6PA 3DELB 5B7DA 3G3GA 1DK4A 2DS9A 4NF8A 5ET8A 4LP2B 4M1VA 3DP4A 4H67A 2UVIA 1Y4TA 1B5JA 4JWXA 2ZZXA 2XXRA 1ANFA 5ISUA 1ZU0A 1SW2A 4RNSA 2DYXA 2UVJA 2VPNA 2DWAA 1JEVA 2ALUA 4KYDA 1FSAA 3G3KA 3IJOB 2DE2A 4ZECA 4AS5A 1PBQA 3I3VA 1UTHA 3PV0E 1B0HA 4O94A 3K1PA 1NV7A 1MDQA 1IMAA 4AB6A 3K1NA 4JWYA 3TKDA 1K9ZA 3EPEA 4QXDA 1FBFA 4ZE8A 4X9TA 3W9WA 5F24A 4OEVA 4ECFA 3DM0A 2V3UA 5BUUA 5CMKA 3T66A 1IMBA 2OJTA 3MVZA 3WAEA 1SVXB 1LB9A 4ELPA 5H8FB 4G77A 2ESNA 1Q1KA 1OMPA 2Y7PA 4Q0CA 3LV0A 1RDYA 4ZEIA 1B05A 1N0TA 3V8XB 2PBWA 3FZVA 5CMBA 1JVXA 3TTMA 2XXPA 2VD3A 2QS3A 4ELQA 2XWVA 4I9DA 1INPA 3LUYA 1PC3A 4PBHA 4UA8A 4MX6A 4BDRA 4YMAA 2Q9TA 4PP0A 1FBPA 4OVRA 3RQTA 3TYHA 3RUMA 3FUZA 3MZ1A 4ZS9A 4I3YA 1LBZA 1LSTA 4NN3A 3E78A 5H8NA 4I8CA 5ITOA 3KJTA 2QVUA 4HXVA 2NVUB 1JEUA 1TFAA 2F5XA 2THIA 3HFUA 3FVOA 4H8IA 4O3BA 4PFWA 4X48A 3LSFB 1Y4CA 4R75A 3HPIA 4G68B 2FA7A 3MBPA 2DQVA 2Y7RA 2HFBA 1VE4A 3QK6A 3IOUA 3CI8A 3S9EA 3CHGA 4GLIA 3O29A 5HM4B 2WEFA 1DSNA 3LSXA 4NMYA 3TDJA 1IIWA 1H44A 3PMVA 1EZPA 1AMFA 1VFEA 3S9MC 3K1MA 3IORA 4RA1A 4EQBA 3A3CA 4QSCA 4LUBA 5CI5A 1P99A 1K9YA 3TELA 2PCRA 1B58A 4DXBA 3CFXA 5AA2D 4FECA 4IO2A 3VVEA 3A29A 2XXQA 1B9JA 3IOWA 5FHMA 1FTMA 3VXBA 4QFKA 4R9GA 3H03A 1B3LA 4NF6A 4OVTA 5IZ3A 3OELA 2Q89A 2O6AA 4N6DA 2Q74A 1R6ZA 5EHSA 4EUOA 2ZMBA 2OBGA 1MPCA 1MM6A 3PPRA 2FVZA 1SW5A 4O7MA 3QUJA 1Y3PA 2XXYA 1URDA 1FPLA 3PUZE 1XVYA 3IB2A 2F7CA 4PDDA 4OZ9A 4HCWA 4GWXA 3N26A 5KZTA 2P2AA 4MH5A 1QW0A 5TPAA 1USYH 4POXA 4H46A 4FATA 3CIJA 3T9VA 3U94A 1MH4A 3EKIA 2A5SA 2O7UA 5T3JA 1A8EA 4ND9A 1LB8A 3T9XB 4IO3A 4U4XA 2CZLA 4MHFA 1CB6A 3RN8A 4WKMA 3OMBA 3DP6A 4LZ7A 5I59A 3OO9A 2DSFA 3KSJA 3H7MA 5I56B 3G3FA 4GQOA 3S9NC 4OANA 3MQ9A 1Y1ZA 4IO7A 4JDFA 4DCYA 1MXZA 4X1DA 4PGPA 1MXUA 3BIHA 5EYFA 4PFIA 1ZTYA 3T96B 1MY2A 4C1TA 5A5XA 4OFJA 2WYKA 3UK4A 4QFOA 3GBBA 5EHMA 5FHOA 3ILTB 1GTKA 4JB7A 4F1UA 3ZS6A 4F3PA 2QSXA 3GYYA 1NUXA 1US5A 1RKMA 3THIA 1FBHA 1NH7A 4H5FA 2Y7KA 3MJNA 1HSJA 5IKBA 2CMOA 2HCAA 2F34A 1PB8A 4PF8A 4XKNA 2OZZA 1KWHA 3O28A 2R71A 4FIMA 4LONB 4EXLA 2H99A 1QKAA 2VPOA 3MVXA 4G68C 4YB7A 2HEUA 3CG1A 3E9XA 3RPWA 4MNIA 3UORA 3ONMA 4H8JA 2QJEA 3EHSA 1Y9UA 1EYIA 2R9JA 3C34A 4P0IA 1F9BA 1M5DA 2XWIA 1MQGA 3R7XA 2CZKA 2DVZA 3H6VA 4ESXA 2Z8EA 4FEBA 4PFYA 5DW8A 3TMGA 3SDFA 4NE4A 5CM6A 2OCUA 2Z23A 4GWOA 1YZ0A 3D4GA 1DMBA 4IR8A 5DTBA 4R6HA 4F29A 1N3XA 3FVKA 1NI9A 4GFRA 3LSLA 4IO4A 2F3DA 5ITPA 4LQ5A 1Y20A 3NOHA 2DDKA 4DXCA 4GOTA 1NV4A 2QS4A 2YLNA 4EQ7A 3MP6A 2VGQA 5AE4A 3IAZA 4H45A 3ECRA 3JZJA 2P3NA 4DI4B 2DOJA 1N76A 2H98A 4PE5B 4KQPA 2G93A 3H6TA 4QHQA 4GX6A 3VLUA 1MG1A 1N7XA 2JJKA 3SEUA 4XFEA 4HE2A 4TOZA 4GWZA 1I6QA 1MQJA 1XOCA 2ONSA 4NF5A 4NG7A 3SEYA 4P3LA 3U72A 1Y3NA 4NAPA 5I7IA 1FRPA 4GBWA 3OSRA 2Z8FA 1FQBA 1R1NA 2F7BA 3FIRA 4PETA 3FXRA 4M4GA 2P1SA 5KCJA 1L5TA 2IA4A 4G4PA 3Q29A 3MYUA 4IO6A 2WKYA 2ONKE 2L5VA 2Y84A 3T9UA 4F1VA 2I4BA 1EZOA 4R6KA 3K0VA 4DE8A 2B3FA 4KFQA 4MNPA 3U8QA 1VDWA 4AB5A 5LOMA 5JK4A 1UTBB 4YU0A 2QS2A 1QJMA 1H76A 3CFZA 3UGWA 2B4LA 1MRPA 4NF4B 4EDPA 1OQHA 5A5LA 4GL8A 2ZYNA 2R6GE 3AXFA 1NNPA 5KDTB 3G7WA 4OVJA 4LN5A 5I58A 2XXVA 2XXWA 1VFDA 4Q30B 2PMSA 5DVJA 1II5A 3RGYA 1OIBA 3EHTA 3FGSA 5H8HA 4PGNA 4XIGQ 1A40A 3EF7A 5I2NA 5DEXA 1PB7A 2IEEA 4KYEA 4PAIA 1MM7A 4YAHX 3VXCA 1B7ZA 3PU5A 2XXKA 3SEWA 4YMBA 3LBSA 2AIXA 5ICQA 2ZXTA 4JXIA 3A09A 1NNTA 4QFPA 2I6EA 3G3HA 3IOVA 2B65A 4GXSB 2XX9A 3C31A 1CNQA 3GLBA 4GWSA 1LCTA 4IGRA 1A55A 2Y5LA 4IO5A 4GWYA 1P1WA 4KXPA 3E13X 4U22A 2E1SA 1O63A 4N17A 4GF8A 5I2KB 5I57B 1LBBA 5FTIA 4OENA 3M3KA 4DI3D 4NWDA 5J1DA 1D9YA 5EQAA 1XC1A 4BDQA 1BKAA 1US4A 3OO6A 1R9LA 3H06B 1TXFA 3H3GA 3RPLA 3N6UA 5L9MA 1R9QA 4ZEDA 5B70A 2MKZA 2DWHA 3TCFA 3FJGA 2QRYA 4Z7EA 4F2OA 1BP5A 2FIXA 3FVNA 2FBPA 3KGCA 1WVJA 4HE0A 1NV0A 2AL5A 2NXOA 5TP9A 1MY3A 4U4SA 1FQCA 2D5WA 5FBPA 4LA9A 4NF0A 4OXVA 2I58A 3SETA 3UIFA 3OO7A 1B32A 3CSBA 1YAEA 4U21A 3BBRA 1PDAA 5LTCA 2HZKA 2PFZA 1AWBA 3M3LA 1IMEA 3QIMA 1N04A 2LAOA 4N15A 4HE1A 4LZ8A 2V3TA 1NKXA 4UABA 1PB9A 2REJA 4P1LA 4F39A 2GRVA 1B3HA 2GHAA 1LBXA 4E0WA 4MNCA 1DPEA 3PUVE 1OLAA 1IEJA 1MY4A 4ZDMA 4FORA 3MAMA 4XEQA 4F3GA 1B0LA 1IQ7A 2H4IA 3BKIB
chains in the Genus database with same CATH topology
4OANA 1FPIA 1KA1A 3KC1A 1G0HA 4PGPA 4F19A 3BIHA 1XI6A 5EQ9A 3T1BA 2PFYA 3IFCA 4PFIA 4PTKA 4PFRA 1NV6A 2WYKA 1JP4A 1FPEA 3IFAA 4YICA 1FPGA 4AS4A 2Y5KA 4F1UA 3FBPA 2DE4A 2V3QA 4G61A 3GYYA 1NUXA 1RDXA 4NX1A 4I3EA 4MIJA 1FBHA 4NHBA 3LUZA 4O7IA 4JVDA 3FXBA 4PAKA 4JVIA 5I3SA 4GWUA 4PF8A 1IMFA 4P47A 4GWWA 4XF5A 5I5PA 1QGXA 5EQ8A 2BJIA 2VPOA 3B50A 5ESYA 4MNIA 4PF6A 3T0JA 4PFBA 2HPGA 2XWOA 4NGUA 1EYIA 4GBVA 1FJ6A 2XWIA 2CZKA 2DVZA 4PC9A 5DW8A 4P8BA 2WBBA 5CM6A 1RDZA 1FPBA 2KR0A 1YZ0A 1LEVA 4IR8A 4GX4A 1KZ8A 1FPFA 4N8YA 1NI9A 2WYPA 2F3DA 2HXRA 1G0IA 3NOHA 2DDKA 3SZPA 2OWZA 1NV4A 2F3BA 4FBPA 3PTYA 1NV5A 4H45A 2P3NA 4DI4B 1DK4A 2QVVA 4P1EA 2CZHA 5ET8A 1NUWA 2OX3A 2R8TA 4M1VA 5IZ1A 2QVRA 1NUZA 4MJOA 2CEXA 2DE3A 4GX6A 4N91A 2JJKA 3QMFA 4PE3A 4XFEA 4NQ8A 4HE2A 2ZZXA 1FBGA 4GWZA 4PBQA 5LDZA 2VPNA 4F18A 1Q9DA 1FSAA 2Q8MA 4NG7A 4P3LA 2DE2A 5IM2A 4NAPA 5I7IA 4AS5A 1FRPA 4GBWA 4PETA 1FBDA 3KBZA 4O94A 4OVPA 1NV7A 1IMCA 1IMAA 2B4MA 3MYUA 4GX3A 2V4CA 1K9ZA 2L5VA 1FBEA 1YXIA 1FPDA 3RYDA 4QXDA 1FBFA 3W9WA 4I40A 4X9TA 5F24A 5J16A 4X8RA 4F1VA 1IMBA 2XA5A 2FIEA 1FJ9A 4MNPA 1VDWA 2CZIA 5IGAA 3ISPA 5JK4A 1BK4A 1EYJA 3LV0A 1RDYA 1IMDA 1LBYA 2KQZA 4O8MA 2B4LA 4HCYA 1NV3A 2WX9A 2QFLA 5A5LA 2ZZVA 2XWVA 1INPA 4LN5A 1FPJA 4PBHA 4MX6A 2Q9TA 1FBPA 2CEYA 4OVRA 4MCOA 4QBAA 3BIGA 4PGNA 1NUYA 4I3YA 1LBZA 4NN3A 3B8BA 3E78A 1FTAA 4PAIA 2QVUA 4HXVA 4OVSA 2XXKA 2F5XA 5ET7A 5ET5A 3HFUA 1DCUA 4N4UA 4N6KA 2WBDA 4MEVA 4OA4A 2HHMA 1LBVA 1CNQA 4GWSA 2Y5LA 4GWYA 2ZZWA 3CHGA 5ET6A 4KXPA 1NV1A 4N17A 2WEFA 2FHYA 5EYGA 1SPIA 4DI3D 4MMPA 4PCDA 5J1DA 3W9VA 5EQAA 2XWKA 1FBCA 2QPQA 4N8GA 1K9YA 3ROJA 2PCRA 1DBZA 3RPLB 3RPLA 3A29A 1NV2A 2MKZA 5EQ7A 5IZ3B 1YYZA 2FIXA 4OVTA 5IZ3A 4PAFA 4P56A 2FBPA 3E79A 4HE0A 4N6DA 2Q74A 1NV0A 3U65A 2FVZA 4O7MA 5FBPA 4NF0A 2VT5A 2HZLA 3KC0A 4YZZA 1FPLA 5EYHA 5IZZA 4JVCA 4PDDA 3D1RA 4HCWA 4GWXA 5LTCA 2HZKA 2PFZA 1FPKA 1AWBA 1IMEA 4N15A 4HE1A 1KA0A 4H46A 4UABA 4P9KA 4OVQA 4MAGA 4P1LA 3EKIA 1LBWA 1EYKA 5T3JA 1LBXA 2P3VA 4MNCA 4PDHA 4MHFA 4X04A 4N81A 3MSTA 2GQ1A 4XEQA 1D9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WBB A;  2Y5L A;  4GWY A;  4GX3 A;  5ET6 A;  4KXP A;  1FPI A;  1NV1 A;  1K9Z A;  2WEF A;  2FHY A;  5EYG A;  1RDZ A;  1FBE A;  1FPB A;  1FPD A;  1KA1 A;  1YXI A;  3RYD A;  1YZ0 A;  3KC1 A;  1FBF A;  1LEV A;  4I40 A;  4IR8 A;  4QXD A;  5F24 A;  4GX4 A;  1G0H A;  1SPI A;  5J16 A;  3BIH A;  1KZ8 A;  1FPF A;  1IMB A;  1XI6 A;  5EQ9 A;  1NI9 A;  5EQA A;  1FBC A;  2F3D A;  3IFC A;  1K9Y A;  3ROJ A;  2FIE A;  2PCR A;  4PTK A;  1DBZ A;  1FJ9 A;  3RPL B;  1G0I A;  1VDW A;  3RPL A;  2CZI A;  2DDK A;  1NV6 A;  3A29 A;  1NV2 A;  2OWZ A;  1JP4 A;  1NV4 A;  5EQ7 A;  1BK4 A;  1EYJ A;  3LV0 A;  1FPE A;  1RDY A;  1IMD A;  3IFA A;  5IZ3 B;  1LBY A;  1YYZ A;  2FIX A;  5IZ3 A;  1FPG A;  2F3B A;  4AS4 A;  4FBP A;  2Y5K A;  2FBP A;  1NV5 A;  1NV3 A;  4HE0 A;  3FBP A;  2Q74 A;  1NV0 A;  2QFL A;  4H45 A;  2P3N A;  2FVZ A;  5A5L A;  1DK4 A;  4G61 A;  1NUX A;  2QVV A;  5FBP A;  1RDX A;  4I3E A;  1FBH A;  2CZH A;  2VT5 A;  5ET8 A;  1INP A;  1NUW A;  3KC0 A;  2OX3 A;  1FPL A;  1FPJ A;  2R8T A;  3LUZ A;  5EYH A;  1D9Q A;  5IZ1 A;  2QVR A;  1NUZ A;  4O7I A;  3D1R A;  4MJO A;  4GX6 A;  1FBP A;  2JJK A;  5I3S A;  3QMF A;  4GWU A;  4GWX A;  3BIG A;  4HE2 A;  1FPK A;  1AWB A;  1IMF A;  1NUY A;  1FBG A;  1IME A;  4GWZ A;  4I3Y A;  1LBZ A;  4GWW A;  3B8B A;  1QGX A;  5LDZ A;  4HE1 A;  1FTA A;  1KA0 A;  1Q9D A;  4H46 A;  2BJI A;  5EQ8 A;  2QVU A;  1FSA A;  4HXV A;  2Q8M A;  5ET7 A;  5ET5 A;  1LBW A;  1EYK A;  5ESY A;  1DCU A;  4AS5 A;  1FRP A;  5T3J A;  4GBW A;  3T0J A;  1LBX A;  2P3V A;  1EYI A;  4GBV A;  1FBD A;  3KBZ A;  2WBD A;  1FJ6 A;  2CZK A;  4N81 A;  2HHM A;  1NV7 A;  1LBV A;  1CNQ A;  2GQ1 A;  5DW8 A;  4GWS A;  1IMC A;  1IMA A; 
#chains in the Genus database with same CATH topology
 1JET A;  4WXJ A;  3CSG A;  1FPI A;  4F22 A;  3FXQ A;  3TFL A;  1JQF A;  1FCK A;  5CC2 A;  1QUI A;  4C0R A;  1P1N A;  3QAX A;  2Q2A A;  4Z0I A;  4F19 A;  4JSO A;  1XI6 A;  4BLA A;  3CR9 A;  1O7T A;  2NUV A;  3IFC A;  1MDP 1;  4PTK A;  4PFR A;  4ZEK A;  4KD5 A;  1NNK A;  1A54 A;  1YCJ A;  1NV6 A;  4EXK A;  1GVC A;  1JP4 A;  4R9F A;  3FJ7 A;  1RYX A;  1FPE A;  3P7I A;  3VDF A;  4LVQ A;  4AS4 A;  4YKJ A;  5DVI A;  1LLS A;  2I49 A;  4G8H A;  1RDX A;  3W15 C;  1UIV A;  2DWI A;  4RY1 A;  4PFT A;  4ISU A;  4PFU A;  3LUZ A;  4O7I A;  1P1Q A;  1I6B A;  5BWJ A;  5CMC A;  1M5C A;  3T9H B;  4RXL A;  3ODB A;  4QF9 A;  1IMF A;  5CBS A;  3V5A A;  4P47 A;  3B6Q A;  4GWW A;  5EQ8 A;  2BJI A;  4RPN A;  5ICT A;  3EHU A;  4DZ1 A;  1LCF A;  5I84 A;  3WAF A;  1SW4 A;  4PF6 A;  3T0J A;  4PFB A;  2RCA A;  3I6V A;  4NGU A;  3U92 A;  3O6G A;  4QSD A;  3A3U A;  1LGB C;  2ONR A;  4PC9 A;  3QUF A;  1N84 A;  4MF3 A;  2X7Q A;  4E0X A;  2WBB A;  3G3J A;  4YB6 A;  2O69 A;  3FVG A;  4DDD A;  2QMX A;  1FW0 A;  1FPB A;  3T93 B;  5AA4 A;  4IB2 A;  1FPF A;  4F3S A;  5JEI A;  4NF4 A;  4ZZE A;  1USY E;  1MXY A;  2O1L A;  2OWZ A;  5AA2 A;  3O9P A;  2PT2 A;  3C4M A;  3K01 A;  2XXU A;  3PPN A;  4BDL A;  3VFJ A;  5JTY B;  1D4N A;  1HSE A;  3LC8 A;  4ELR A;  1ZKB A;  3IJX B;  4F31 B;  2F3B A;  3QSL A;  1AL3 A;  3HN0 A;  2A5T A;  3USD A;  1NV5 A;  3MZB A;  4KCC A;  1SYI A;  1VSO A;  1HSL A;  4N13 A;  4XKQ A;  2UYE A;  2W7Y A;  3OXN A;  4NF8 B;  2HXW A;  2R8T A;  5IZ1 A;  5HBC A;  4EF2 A;  3O6H A;  3TUS A;  4MJO A;  2CEX A;  4EF1 A;  4Q5T A;  4N91 A;  4MBP A;  1PBP A;  4PE3 A;  1MPB A;  1MQI A;  1OQG A;  3TCG A;  4NQ8 A;  3R6U A;  1AH5 A;  4OES A;  5LDZ A;  4QSE A;  2ABH A;  2Q8M A;  3MPK A;  1LFG A;  2DWJ A;  1M5E A;  5IM2 A;  1UTH B;  2H25 A;  3RTW B;  3MW0 A;  4N6P A;  1FBD A;  3M3F A;  2NWJ A;  1SI0 A;  4OVP A;  1IMC A;  2B4M A;  4H1X A;  2O84 X;  1M5F A;  4GL0 A;  2RF1 A;  1Z7M E;  1FBE A;  1YXI A;  2KLF A;  2VOZ A;  3DLN A;  4RPO A;  3O97 A;  4MLQ A;  1RYO A;  1FJ9 A;  1NL5 A;  3TQL A;  3OEK A;  4R2B A;  1TFD A;  5H8F A;  3C36 A;  1B51 A;  2VD2 A;  1MXV A;  1QKB A;  5FHN A;  1BTJ A;  4YKI A;  2KQZ A;  4L17 A;  3ZKL A;  1S50 A;  4HCY A;  2ZNU A;  2ZZV A;  3IL1 B;  4F2Q A;  1BIY A;  4BDM A;  1SI1 A;  2RC9 A;  1FPJ A;  3K6W A;  2O1M A;  2DVC A;  1ZBM A;  4R73 A;  1POY 1;  4C1U A;  1SW1 A;  1NMU A;  4MCO A;  2F35 A;  1NUY A;  4H0W A;  4F1Y A;  1ZLQ A;  5H8N B;  1FTA A;  4P0G A;  2Y7I A;  3UA8 A;  3FD3 A;  1B40 A;  4UAC A;  1XT8 A;  4OVS A;  1QUL A;  1WDN A;  5ET5 A;  3PUY E;  1I6A A;  1MS7 A;  4OER A;  4N6K A;  3L6H A;  1B7H A;  4G68 A;  1IXH A;  4IGT A;  4GRK A;  1LFH A;  2HHM A;  4R6Y A;  4Q8R A;  4KCD A;  1LAX A;  3FV1 A;  5ET6 A;  3PD9 A;  1MQD A;  1NV1 A;  5EYG A;  1S7Y A;  1LAH E;  1FQF A;  4OTE A;  1IXC A;  2DXY A;  1SPI A;  1OLC A;  4PCD A;  3W9V A;  1MXX A;  2RC8 A;  2XWK A;  1FBC A;  2QPQ A;  4N8G A;  4FE8 A;  2BJJ X;  4JBZ A;  5F1Q A;  4K3F A;  3U93 A;  1UIU A;  2XXX A;  2Q8J A;  3PUX E;  2ZYM A;  4NF6 B;  5IZ3 B;  1P1U A;  4PAF A;  1D9V A;  3QXM A;  4P56 A;  2B3B A;  3VVD A;  3KJ7 A;  1A99 A;  1TWY A;  3U65 A;  3OO8 A;  2X7P A;  2P0S A;  4P11 A;  2VT5 A;  2HZL A;  3KC0 A;  4GVO A;  4LAT A;  4YZZ A;  5IZZ A;  4JVC A;  4NED A;  1B3G A;  4PQJ A;  3KEI A;  1BLF A;  2V84 A;  4HTG A;  3U1O A;  4LZ5 A;  5TPA B;  1FPK A;  4N07 A;  2RIN A;  4KPT A;  4DIG A;  4ELO A;  4ONY A;  5FTH A;  4BDN A;  4P9K A;  4OVQ A;  5AA1 A;  3E3K A;  2QMW A;  4OQO A;  1DTG A;  1H43 A;  4THI A;  4OET A;  1ZJL A;  1EYK A;  3TQW A;  3OD7 A;  3UP9 A;  3H6U A;  3OSQ A;  5H8Q B;  1SQY A;  3F11 A;  3TTR A;  4PDH A;  3LR1 A;  3N6T A;  1IUD A;  3OOA A;  4X04 A;  4AQ4 A;  5I59 B;  3IB1 A;  1SBP A;  2XXI A;  2DP8 A;  4HS7 A;  1D9Q A;  1Y3Q A;  5I56 A;  4YKP A;  2XXT A;  1POT A;  5H8S A;  2X26 A;  2PX1 A;  2H9B A;  3PPO A;  1SYH A;  3C33 A;  3R26 A;  4ZE9 A;  5A5X B;  1M5B A;  4I1D A;  4F3B A;  4XKR A;  4TLM B;  5K2X A;  2RC7 A;  2I48 A;  4KR5 A;  5CMM A;  3IFA A;  3HST A;  3KSX A;  1FPG A;  4YIC A;  2ZYK A;  2Y5K A;  3RT8 A;  3FBP A;  3PMX A;  2DE4 A;  3K2D A;  4G8M A;  3IR1 A;  2Y7W A;  1GV8 A;  3K6X A;  4I3E A;  4BDO A;  3VLV A;  4KYS A;  1IXI A;  4H65 A;  3HO7 A;  2Q88 A;  1LBC A;  4JVD A;  3HHG A;  4GWU A;  4XXU A;  3H6W A;  1YTV A;  4JWO A;  3TZA A;  1A8F A;  4XF5 A;  3C32 A;  5I5P A;  4U1O A;  3KG2 A;  2F97 A;  3Q28 A;  3B50 A;  2I4C A;  4EQ9 A;  1Z7N E;  4DLD A;  3ZSF A;  1H45 A;  2HQ0 A;  4GBV A;  3S4U A;  1A7L A;  3TEP A;  4KHZ E;  1B6H A;  1MPD A;  3L6G A;  2M8C A;  3C9H A;  1WOD A;  4P8B A;  3EQ1 A;  2D21 A;  3JYR A;  2KR0 A;  4GX4 A;  4OFO A;  1KZ8 A;  3PPP A;  1NNF A;  3H4Z A;  2WYP A;  2HXR A;  4U23 A;  3KN3 A;  2XHD A;  3FAS A;  4YB5 A;  1G0I A;  3SZP A;  5DYH A;  1ZIU A;  1QUK A;  3TCH A;  3K4U A;  2XX8 A;  3DP8 A;  5L9S A;  2XX7 A;  4FBP A;  1Y1M A;  1JNF A;  4ZZA A;  3PTY A;  4GXA A;  1IXG A;  1TT1 A;  1B4H A;  3O2A A;  2V93 A;  2F8D A;  2ZNT A;  2QVV A;  2QS1 A;  4P1E A;  4POW A;  1H3D A;  2CZH A;  4G2Z A;  1NUW A;  2OX3 A;  3SER A;  1FTO A;  1B3F A;  4GIZ A;  3S2V A;  4OYV A;  2QVR A;  1NUZ A;  3OEN A;  2DE3 A;  2XD3 A;  3QMF A;  1DOT A;  3JV9 A;  1FBG A;  2YPN A;  1J1N A;  4PBQ A;  4F18 A;  1Q9D A;  4NF5 B;  5M2V A;  1URG A;  2OWS A;  5AA3 A;  3LSW A;  3CFL A;  4WEP A;  1JW5 A;  2ZYO A;  3HV1 A;  1GR2 A;  3KBZ A;  3VVF A;  1T0K A;  2E0S A;  4OWD A;  5KCJ B;  3MWB A;  3Q27 A;  3O66 A;  1NFT A;  2XD2 A;  2OPD A;  4GX3 A;  1DTZ A;  2V4C A;  3FV2 A;  1S9T A;  3BFU A;  3OEM A;  4YKK A;  1FPD A;  3RYD A;  1B46 A;  4I40 A;  5J16 A;  3UN6 A;  2XXH A;  4X8R A;  1PEB A;  5HPQ A;  1JW1 A;  2XA5 A;  3TOD A;  3G3I A;  1AIV A;  3EN3 A;  2FIE A;  3C35 A;  1MQH A;  4TQU Q;  2PVU A;  1B52 A;  2CZI A;  2UXA A;  5IGA A;  1ELJ A;  3ISP A;  2AL4 A;  1FTK A;  1BK4 A;  1SDX A;  1EYJ A;  1IMD A;  1UTB A;  4GD5 A;  1LBY A;  2UVG A;  3CRB A;  4O8M A;  3N5L A;  1NV3 A;  3V83 A;  2WX9 A;  2QFL A;  3SKP A;  2GH9 A;  5I58 B;  5KDT A;  2I3W A;  1B7U A;  3IO4 A;  5H8Q A;  5DVF A;  2CEY A;  3TTN A;  5H8H B;  4ZEF A;  4HW8 A;  3PD8 A;  4QBA A;  3BIG A;  3KZG A;  4I62 A;  1LAF E;  5I2N B;  3B8B A;  5DEX B;  2I0C A;  1EH3 A;  3RT6 B;  1QVS A;  2QL3 A;  5L9O A;  3IB0 A;  3PMW A;  4FAJ A;  4RK2 A;  5ET7 A;  3K6U A;  1DCU A;  4G8N A;  4N4U A;  4RJZ A;  2WBD A;  4FJP A;  4DCX A;  4MEV A;  4OA4 A;  1AOV A;  5F7V A;  2O7I A;  1LBV A;  1XS5 A;  2VP1 A;  1B2H A;  3Q25 A;  4X1B A;  2OPE A;  3I5O A;  1B3E A;  4U2R A;  4R74 A;  2ZZW A;  4XKP A;  4QFN A;  2F6G A;  2FHY A;  1FQE A;  5I2K A;  1MY0 A;  4RK9 A;  5I57 A;  1FTL A;  2H5Y A;  2AYS A;  3SEV A;  4MMP A;  1EZ9 A;  1D3K A;  2GFE A;  3K02 A;  2YJP A;  3ROJ A;  4U1Z A;  2I0B A;  1DBZ A;  4O3A A;  3RPL B;  3PGF A;  4IY6 A;  1NV2 A;  2GHB A;  4DXU A;  5EQ7 A;  4XTC Q;  1XVX A;  2Z8D A;  4LQ2 A;  3TAJ A;  1QUJ A;  3BFT A;  1YYZ A;  4O3C A;  1EU8 A;  2F78 A;  3KOT A;  1JVY A;  2F36 A;  3E79 A;  5TP9 B;  4FED A;  3KN7 A;  3MP1 A;  3RTF B;  3K6V A;  1XHY A;  3CG3 A;  3KOS A;  1CE2 A;  3Q26 A;  5EYH A;  3RLF E;  2RKM A;  3HHF A;  2ANJ A;  3D1R A;  5ELV A;  5K2Y A;  3PUW E;  2O68 A;  1B5I A;  3IX1 A;  1ATG A;  4QRZ A;  1B5H A;  2ZNS A;  1KA0 A;  4QFL A;  3E4R A;  4WED A;  4MAG A;  3B6T A;  1LBW A;  3M8U A;  1MXW A;  2DXR A;  3GXA A;  2P3V A;  3K00 A;  3T22 A;  1LFI A;  1P1O A;  3GZG A;  2UVH A;  3TPA A;  3RY3 A;  4N81 A;  5L8D A;  2OLB A;  3MST A;  2GQ1 A;  2PT1 A;  4H5G A;  3GBA A;  1OVB A;  3KN8 A;  1YPN A;  3O6I A;  3IOT A;  1KA1 A;  3ZKK A;  3KC1 A;  3MUQ A;  1IZ1 A;  1G0H A;  3VV5 A;  4NWC A;  4MFI A;  5EQ9 A;  4OMB A;  3MP8 A;  3T1B A;  5TU0 A;  5IAI A;  2PFY A;  3MVW A;  2G29 A;  3FAT A;  1IIT A;  1MY1 A;  3KBR A;  3D4C A;  3ILU B;  3IO6 A;  4R72 A;  4H6D A;  1FTJ A;  2UYF A;  1UQW A;  3IK6 B;  5CBR A;  2REG A;  3TTL A;  1B1X A;  1FQD A;  4R2F A;  1Q35 A;  4OEU A;  2FNC A;  2V3Q A;  4G61 A;  3TTK A;  4NX1 A;  4MIJ A;  3MZ9 A;  4NHB A;  4TLL B;  4IY5 A;  5CRY A;  3FXU A;  3SES A;  3FXB A;  1LAG E;  2F7A A;  2RCB A;  1NH8 A;  4PAK A;  4JVI A;  5I3S A;  4JSD A;  4MLV A;  1MH3 A;  1QGX A;  1N3W A;  4ESW A;  2I3V A;  1O64 A;  2D3I A;  3V89 B;  1SD3 A;  1DPP A;  3B6W A;  2Q2C A;  5ESY A;  2V25 A;  3FJM A;  2HPG A;  2XWO A;  3B7D A;  4NTL A;  2OK2 A;  2OWT A;  3QYT A;  3MPL A;  1FJ6 A;  1OVT A;  4RYA A;  1I69 A;  2PYY A;  3MVY A;  3PPQ A;  1ZMG A;  3MC2 A;  5DT6 A;  1FQA A;  1RDZ A;  1B1H A;  1GGG A;  5AA4 B;  3HCQ A;  2FYI A;  1LEV A;  1N7W A;  2HAV A;  1VR5 A;  1JW4 A;  4N8Y A;  2VHA A;  2Z22 A;  3N94 A;  3VLW A;  3SEX A;  3VE1 B;  2HAU A;  5AA2 B;  4OHN A;  4OFL A;  3RNN A;  2O51 A;  4ZEB A;  3KFM A;  3CVG A;  5JTY A;  4KI0 E;  3S9L C;  2A5T B;  1URS A;  1B4Z A;  2NOO A;  2F6P A;  3DEL B;  5B7D A;  3G3G A;  1DK4 A;  2DS9 A;  4NF8 A;  5ET8 A;  4LP2 B;  4M1V A;  3DP4 A;  4H67 A;  2UVI A;  1Y4T A;  1B5J A;  4JWX A;  2ZZX A;  2XXR A;  1ANF A;  5ISU A;  1ZU0 A;  1SW2 A;  4RNS A;  2DYX A;  2UVJ A;  2VPN A;  2DWA A;  1JEV A;  2ALU A;  4KYD A;  1FSA A;  3G3K A;  3IJO B;  2DE2 A;  4ZEC A;  4AS5 A;  1PBQ A;  3I3V A;  1UTH A;  3PV0 E;  1B0H A;  4O94 A;  3K1P A;  1NV7 A;  1MDQ A;  1IMA A;  4AB6 A;  3K1N A;  4JWY A;  3TKD A;  1K9Z A;  3EPE A;  4QXD A;  1FBF A;  4ZE8 A;  4X9T A;  3W9W A;  5F24 A;  4OEV A;  4ECF A;  3DM0 A;  2V3U A;  5BUU A;  5CMK A;  3T66 A;  1IMB A;  2OJT A;  3MVZ A;  3WAE A;  1SVX B;  1LB9 A;  4ELP A;  5H8F B;  4G77 A;  2ESN A;  1Q1K A;  1OMP A;  2Y7P A;  4Q0C A;  3LV0 A;  1RDY A;  4ZEI A;  1B05 A;  1N0T A;  3V8X B;  2PBW A;  3FZV A;  5CMB A;  1JVX A;  3TTM A;  2XXP A;  2VD3 A;  2QS3 A;  4ELQ A;  2XWV A;  4I9D A;  1INP A;  3LUY A;  1PC3 A;  4PBH A;  4UA8 A;  4MX6 A;  4BDR A;  4YMA A;  2Q9T A;  4PP0 A;  1FBP A;  4OVR A;  3RQT A;  3TYH A;  3RUM A;  3FUZ A;  3MZ1 A;  4ZS9 A;  4I3Y A;  1LBZ A;  1LST A;  4NN3 A;  3E78 A;  5H8N A;  4I8C A;  5ITO A;  3KJT A;  2QVU A;  4HXV A;  2NVU B;  1JEU A;  1TFA A;  2F5X A;  2THI A;  3HFU A;  3FVO A;  4H8I A;  4O3B A;  4PFW A;  4X48 A;  3LSF B;  1Y4C A;  4R75 A;  3HPI A;  4G68 B;  2FA7 A;  3MBP A;  2DQV A;  2Y7R A;  2HFB A;  1VE4 A;  3QK6 A;  3IOU A;  3CI8 A;  3S9E A;  3CHG A;  4GLI A;  3O29 A;  5HM4 B;  2WEF A;  1DSN A;  3LSX A;  4NMY A;  3TDJ A;  1IIW A;  1H44 A;  3PMV A;  1EZP A;  1AMF A;  1VFE A;  3S9M C;  3K1M A;  3IOR A;  4RA1 A;  4EQB A;  3A3C A;  4QSC A;  4LUB A;  5CI5 A;  1P99 A;  1K9Y A;  3TEL A;  2PCR A;  1B58 A;  4DXB A;  3CFX A;  5AA2 D;  4FEC A;  4IO2 A;  3VVE A;  3A29 A;  2XXQ A;  1B9J A;  3IOW A;  5FHM A;  1FTM A;  3VXB A;  4QFK A;  4R9G A;  3H03 A;  1B3L A;  4NF6 A;  4OVT A;  5IZ3 A;  3OEL A;  2Q89 A;  2O6A A;  4N6D A;  2Q74 A;  1R6Z A;  5EHS A;  4EUO A;  2ZMB A;  2OBG A;  1MPC A;  1MM6 A;  3PPR A;  2FVZ A;  1SW5 A;  4O7M A;  3QUJ A;  1Y3P A;  2XXY A;  1URD A;  1FPL A;  3PUZ E;  1XVY A;  3IB2 A;  2F7C A;  4PDD A;  4OZ9 A;  4HCW A;  4GWX A;  3N26 A;  5KZT A;  2P2A A;  4MH5 A;  1QW0 A;  5TPA A;  1USY H;  4POX A;  4H46 A;  4FAT A;  3CIJ A;  3T9V A;  3U94 A;  1MH4 A;  3EKI A;  2A5S A;  2O7U A;  5T3J A;  1A8E A;  4ND9 A;  1LB8 A;  3T9X B;  4IO3 A;  4U4X A;  2CZL A;  4MHF A;  1CB6 A;  3RN8 A;  4WKM A;  3OMB A;  3DP6 A;  4LZ7 A;  5I59 A;  3OO9 A;  2DSF A;  3KSJ A;  3H7M A;  5I56 B;  3G3F A;  4GQO A;  3S9N C;  4OAN A;  3MQ9 A;  1Y1Z A;  4IO7 A;  4JDF A;  4DCY A;  1MXZ A;  4X1D A;  4PGP A;  1MXU A;  3BIH A;  5EYF A;  4PFI A;  1ZTY A;  3T96 B;  1MY2 A;  4C1T A;  5A5X A;  4OFJ A;  2WYK A;  3UK4 A;  4QFO A;  3GBB A;  5EHM A;  5FHO A;  3ILT B;  1GTK A;  4JB7 A;  4F1U A;  3ZS6 A;  4F3P A;  2QSX A;  3GYY A;  1NUX A;  1US5 A;  1RKM A;  3THI A;  1FBH A;  1NH7 A;  4H5F A;  2Y7K A;  3MJN A;  1HSJ A;  5IKB A;  2CMO A;  2HCA A;  2F34 A;  1PB8 A;  4PF8 A;  4XKN A;  2OZZ A;  1KWH A;  3O28 A;  2R71 A;  4FIM A;  4LON B;  4EXL A;  2H99 A;  1QKA A;  2VPO A;  3MVX A;  4G68 C;  4YB7 A;  2HEU A;  3CG1 A;  3E9X A;  3RPW A;  4MNI A;  3UOR A;  3ONM A;  4H8J A;  2QJE A;  3EHS A;  1Y9U A;  1EYI A;  2R9J A;  3C34 A;  4P0I A;  1F9B A;  1M5D A;  2XWI A;  1MQG A;  3R7X A;  2CZK A;  2DVZ A;  3H6V A;  4ESX A;  2Z8E A;  4FEB A;  4PFY A;  5DW8 A;  3TMG A;  3SDF A;  4NE4 A;  5CM6 A;  2OCU A;  2Z23 A;  4GWO A;  1YZ0 A;  3D4G A;  1DMB A;  4IR8 A;  5DTB A;  4R6H A;  4F29 A;  1N3X A;  3FVK A;  1NI9 A;  4GFR A;  3LSL A;  4IO4 A;  2F3D A;  5ITP A;  4LQ5 A;  1Y20 A;  3NOH A;  2DDK A;  4DXC A;  4GOT A;  1NV4 A;  2QS4 A;  2YLN A;  4EQ7 A;  3MP6 A;  2VGQ A;  5AE4 A;  3IAZ A;  4H45 A;  3ECR A;  3JZJ A;  2P3N A;  4DI4 B;  2DOJ A;  1N76 A;  2H98 A;  4PE5 B;  4KQP A;  2G93 A;  3H6T A;  4QHQ A;  4GX6 A;  3VLU A;  1MG1 A;  1N7X A;  2JJK A;  3SEU A;  4XFE A;  4HE2 A;  4TOZ A;  4GWZ A;  1I6Q A;  1MQJ A;  1XOC A;  2ONS A;  4NF5 A;  4NG7 A;  3SEY A;  4P3L A;  3U72 A;  1Y3N A;  4NAP A;  5I7I A;  1FRP A;  4GBW A;  3OSR A;  2Z8F A;  1FQB A;  1R1N A;  2F7B A;  3FIR A;  4PET A;  3FXR A;  4M4G A;  2P1S A;  5KCJ A;  1L5T A;  2IA4 A;  4G4P A;  3Q29 A;  3MYU A;  4IO6 A;  2WKY A;  2ONK E;  2L5V A;  2Y84 A;  3T9U A;  4F1V A;  2I4B A;  1EZO A;  4R6K A;  3K0V A;  4DE8 A;  2B3F A;  4KFQ A;  4MNP A;  3U8Q A;  1VDW A;  4AB5 A;  5LOM A;  5JK4 A;  1UTB B;  4YU0 A;  2QS2 A;  1QJM A;  1H76 A;  3CFZ A;  3UGW A;  2B4L A;  1MRP A;  4NF4 B;  4EDP A;  1OQH A;  5A5L A;  4GL8 A;  2ZYN A;  2R6G E;  3AXF A;  1NNP A;  5KDT B;  3G7W A;  4OVJ A;  4LN5 A;  5I58 A;  2XXV A;  2XXW A;  1VFD A;  4Q30 B;  2PMS A;  5DVJ A;  1II5 A;  3RGY A;  1OIB A;  3EHT A;  3FGS A;  5H8H A;  4PGN A;  4XIG Q;  1A40 A;  3EF7 A;  5I2N A;  5DEX A;  1PB7 A;  2IEE A;  4KYE A;  4PAI A;  1MM7 A;  4YAH X;  3VXC A;  1B7Z A;  3PU5 A;  2XXK A;  3SEW A;  4YMB A;  3LBS A;  2AIX A;  5ICQ A;  2ZXT A;  4JXI A;  3A09 A;  1NNT A;  4QFP A;  2I6E A;  3G3H A;  3IOV A;  2B65 A;  4GXS B;  2XX9 A;  3C31 A;  1CNQ A;  3GLB A;  4GWS A;  1LCT A;  4IGR A;  1A55 A;  2Y5L A;  4IO5 A;  4GWY A;  1P1W A;  4KXP A;  3E13 X;  4U22 A;  2E1S A;  1O63 A;  4N17 A;  4GF8 A;  5I2K B;  5I57 B;  1LBB A;  5FTI A;  4OEN A;  3M3K A;  4DI3 D;  4NWD A;  5J1D A;  1D9Y A;  5EQA A;  1XC1 A;  4BDQ A;  1BKA A;  1US4 A;  3OO6 A;  1R9L A;  3H06 B;  1TXF A;  3H3G A;  3RPL A;  3N6U A;  5L9M A;  1R9Q A;  4ZED A;  5B70 A;  2MKZ A;  2DWH A;  3TCF A;  3FJG A;  2QRY A;  4Z7E A;  4F2O A;  1BP5 A;  2FIX A;  3FVN A;  2FBP A;  3KGC A;  1WVJ A;  4HE0 A;  1NV0 A;  2AL5 A;  2NXO A;  5TP9 A;  1MY3 A;  4U4S A;  1FQC A;  2D5W A;  5FBP A;  4LA9 A;  4NF0 A;  4OXV A;  2I58 A;  3SET A;  3UIF A;  3OO7 A;  1B32 A;  3CSB A;  1YAE A;  4U21 A;  3BBR A;  1PDA A;  5LTC A;  2HZK A;  2PFZ A;  1AWB A;  3M3L A;  1IME A;  3QIM A;  1N04 A;  2LAO A;  4N15 A;  4HE1 A;  4LZ8 A;  2V3T A;  1NKX A;  4UAB A;  1PB9 A;  2REJ A;  4P1L A;  4F39 A;  2GRV A;  1B3H A;  2GHA A;  1LBX A;  4E0W A;  4MNC A;  1DPE A;  3PUV E;  1OLA A;  1IEJ A;  1MY4 A;  4ZDM A;  4FOR A;  3MAM A;  4XEQ A;  4F3G A;  1B0L A;  1IQ7 A;  2H4I A;  3BKI B; 
#chains in the Genus database with same CATH homology
 4OAN A;  1FPI A;  1KA1 A;  3KC1 A;  1G0H A;  4PGP A;  4F19 A;  3BIH A;  1XI6 A;  5EQ9 A;  3T1B A;  2PFY A;  3IFC A;  4PFI A;  4PTK A;  4PFR A;  1NV6 A;  2WYK A;  1JP4 A;  1FPE A;  3IFA A;  4YIC A;  1FPG A;  4AS4 A;  2Y5K A;  4F1U A;  3FBP A;  2DE4 A;  2V3Q A;  4G61 A;  3GYY A;  1NUX A;  1RDX A;  4NX1 A;  4I3E A;  4MIJ A;  1FBH A;  4NHB A;  3LUZ A;  4O7I A;  4JVD A;  3FXB A;  4PAK A;  4JVI A;  5I3S A;  4GWU A;  4PF8 A;  1IMF A;  4P47 A;  4GWW A;  4XF5 A;  5I5P A;  1QGX A;  5EQ8 A;  2BJI A;  2VPO A;  3B50 A;  5ESY A;  4MNI A;  4PF6 A;  3T0J A;  4PFB A;  2HPG A;  2XWO A;  4NGU A;  1EYI A;  4GBV A;  1FJ6 A;  2XWI A;  2CZK A;  2DVZ A;  4PC9 A;  5DW8 A;  4P8B A;  2WBB A;  5CM6 A;  1RDZ A;  1FPB A;  2KR0 A;  1YZ0 A;  1LEV A;  4IR8 A;  4GX4 A;  1KZ8 A;  1FPF A;  4N8Y A;  1NI9 A;  2WYP A;  2F3D A;  2HXR A;  1G0I A;  3NOH A;  2DDK A;  3SZP A;  2OWZ A;  1NV4 A;  2F3B A;  4FBP A;  3PTY A;  1NV5 A;  4H45 A;  2P3N A;  4DI4 B;  1DK4 A;  2QVV A;  4P1E A;  2CZH A;  5ET8 A;  1NUW A;  2OX3 A;  2R8T A;  4M1V A;  5IZ1 A;  2QVR A;  1NUZ A;  4MJO A;  2CEX A;  2DE3 A;  4GX6 A;  4N91 A;  2JJK A;  3QMF A;  4PE3 A;  4XFE A;  4NQ8 A;  4HE2 A;  2ZZX A;  1FBG A;  4GWZ A;  4PBQ A;  5LDZ A;  2VPN A;  4F18 A;  1Q9D A;  1FSA A;  2Q8M A;  4NG7 A;  4P3L A;  2DE2 A;  5IM2 A;  4NAP A;  5I7I A;  4AS5 A;  1FRP A;  4GBW A;  4PET A;  1FBD A;  3KBZ A;  4O94 A;  4OVP A;  1NV7 A;  1IMC A;  1IMA A;  2B4M A;  3MYU A;  4GX3 A;  2V4C A;  1K9Z A;  2L5V A;  1FBE A;  1YXI A;  1FPD A;  3RYD A;  4QXD A;  1FBF A;  3W9W A;  4I40 A;  4X9T A;  5F24 A;  5J16 A;  4X8R A;  4F1V A;  1IMB A;  2XA5 A;  2FIE A;  1FJ9 A;  4MNP A;  1VDW A;  2CZI A;  5IGA A;  3ISP A;  5JK4 A;  1BK4 A;  1EYJ A;  3LV0 A;  1RDY A;  1IMD A;  1LBY A;  2KQZ A;  4O8M A;  2B4L A;  4HCY A;  1NV3 A;  2WX9 A;  2QFL A;  5A5L A;  2ZZV A;  2XWV A;  1INP A;  4LN5 A;  1FPJ A;  4PBH A;  4MX6 A;  2Q9T A;  1FBP A;  2CEY A;  4OVR A;  4MCO A;  4QBA A;  3BIG A;  4PGN A;  1NUY A;  4I3Y A;  1LBZ A;  4NN3 A;  3B8B A;  3E78 A;  1FTA A;  4PAI A;  2QVU A;  4HXV A;  4OVS A;  2XXK A;  2F5X A;  5ET7 A;  5ET5 A;  3HFU A;  1DCU A;  4N4U A;  4N6K A;  2WBD A;  4MEV A;  4OA4 A;  2HHM A;  1LBV A;  1CNQ A;  4GWS A;  2Y5L A;  4GWY A;  2ZZW A;  3CHG A;  5ET6 A;  4KXP A;  1NV1 A;  4N17 A;  2WEF A;  2FHY A;  5EYG A;  1SPI A;  4DI3 D;  4MMP A;  4PCD A;  5J1D A;  3W9V A;  5EQA A;  2XWK A;  1FBC A;  2QPQ A;  4N8G A;  1K9Y A;  3ROJ A;  2PCR A;  1DBZ A;  3RPL B;  3RPL A;  3A29 A;  1NV2 A;  2MKZ A;  5EQ7 A;  5IZ3 B;  1YYZ A;  2FIX A;  4OVT A;  5IZ3 A;  4PAF A;  4P56 A;  2FBP A;  3E79 A;  4HE0 A;  4N6D A;  2Q74 A;  1NV0 A;  3U65 A;  2FVZ A;  4O7M A;  5FBP A;  4NF0 A;  2VT5 A;  2HZL A;  3KC0 A;  4YZZ A;  1FPL A;  5EYH A;  5IZZ A;  4JVC A;  4PDD A;  3D1R A;  4HCW A;  4GWX A;  5LTC A;  2HZK A;  2PFZ A;  1FPK A;  1AWB A;  1IME A;  4N15 A;  4HE1 A;  1KA0 A;  4H46 A;  4UAB A;  4P9K A;  4OVQ A;  4MAG A;  4P1L A;  3EKI A;  1LBW A;  1EYK A;  5T3J A;  1LBX A;  2P3V A;  4MNC A;  4PDH A;  4MHF A;  4X04 A;  4N81 A;  3MST A;  2GQ1 A;  4XEQ A;  1D9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...