3RYDA

Crystal strucutre of ca bound impase family protein from staphylococcus aureus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
263
structure length
261
Chain Sequence
DKTLQQIDKLICSWLKQIDNVIPQLIMEMTTTKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGIKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal dual specific inositol monophosphatase/NADP(H) phosphatase (SAS2203) delineates the molecular basis of substrate specificity
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 72
structure length 261
sequence length 263
chains with identical sequence C
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2011-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3rydA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3rydA02
1FBCA 1LBWA 1DK4A 1NV1A 1AWBA 2OWZA 2P3VA 3FBPA 3T0JA 2HHMA 1NUZA 2CZHA 1IMAA 1EYKA 4FBPA 1NV0A 4PTKA 1Q9DA 3D1RA 1RDZA 1FPFA 4GWZA 1FPDA 5ESYA 5IZ1A 4GX3A 1FBFA 2F3BA 1G0HA 4HE2A 3RPLA 5LDZA 1K9YA 2CZKA 4I40A 2Q8MA 2QVRA 5A5LA 2VT5A 4GWSA 1LBVA 5IZ3B 1INPA 2FHYA 1NUYA 5FBPA 1FPEA 5I3SA 3LUZA 1LBZA 4AS5A 1NV6A 1LBXA 3IFAA 3KBZA 4MJOA 2DDKA 5EQ9A 2WEFA 4GWXA 4AS4A 1KA1A 4GBWA 3ROJA 1RDXA 2Y5LA 1FTAA 2GQ1A 1EYJA 3BIGA 5IZ3A 2PCRA 1FBDA 5EQAA 1NUXA 4GX6A 4O7IA 3A29A 4I3EA 1IMEA 1FPKA 4I3YA 1EYIA 5EQ8A 4H45A 1BK4A 4QXDA 3B8BA 4IR8A 1NV4A 1NI9A 1FBGA 1FPLA 4GX4A 1FBPA 2R8TA 3KC0A 3LV0A 4GWYA 2BJIA 1NV7A 2WBDA 4GWUA 1LEVA 1NUWA 4GWWA 1FPIA 5EQ7A 5T3JA 1FRPA 1YZ0A 2Q74A 2OX3A 1FBEA 5ET8A 4GBVA 4N81A 5EYHA 4H46A 1CNQA 2QFLA 1FBHA 1FJ6A 1KZ8A 2CZIA 1DBZA 1IMCA 4G61A 2WBBA 1YYZA 1IMBA 1JP4A 1NV2A 4HXVA 3BIHA 1SPIA 2Y5KA 2JJKA 4HE0A 2FVZA 2FIEA 1KA0A 1K9ZA 5DW8A 5ET5A 1IMDA 4HE1A 1FPGA 3IFCA 1XI6A 5ET6A 5EYGA 5J16A 3RPLB 2F3DA 1NV3A 5F24A 1DCUA 1YXIA 1D9QA 1FJ9A 1G0IA 3KC1A 3RYDA 1LBYA 2QVVA 2FIXA 1FPJA 2P3NA 1QGXA 1RDYA 1VDWA 2FBPA 4KXPA 1IMFA 2QVUA 5ET7A 3QMFA 1FPBA 1NV5A 1FSAA
chains in the Genus database with same CATH superfamily
3LSFB 1FTOA 3PPRA 3VLUA 1ELJA 2I0CA 4IGRA 3TODA 1N7WA 1OQHA 4GOTA 3VXCA 3QUJA 5IKBA 1Y3PA 1OIBA 4X04A 1B46A 4HW8A 2OJTA 4PFWA 4ESWA 1ANFA 4C1UA 1WODA 1FPEA 2O51A 5FHNA 1EH3A 4OTEA 4N4UA 3USDA 4NF5A 2WEFA 4P9KA 1Y4CA 4GWXA 3VDFA 5EYFA 4L17A 4WXJA 2KR0A 2XXUA 2QS4A 4R2FA 1SI0A 1EYIA 3U93A 5CMKA 1LFHA 1FQDA 4GX4A 3LV0A 3S2VA 4H65A 1B3FA 5DVIA 1EU8A 2ESNA 3HO7A 2DE2A 3K1PA 1PBPA 5J1DA 1KWHA 3PMWA 1OQGA 4ZDMA 1TXFA 3MVXA 2X7QA 2XXWA 2YJPA 3CR9A 2B65A 4FORA 1JW4A 5DW8A 2VOZA 4MLVA 1JW1A 2KQZA 1BLFA 4PFRA 5IZZA 1RDYA 3QK6A 5I56A 3KOSA 5ET7A 3FJGA 3KBRA 3O6HA 3N6UA 4O7MA 1LBWA 4RYAA 4XXUA 3E4RA 2DWAA 4GRKA 5DTBA 4PQJA 3D1RA 5I57B 3IOWA 3WAFA 4ZS9A 3H03A 2CZLA 3ILUB 1L5TA 4LZ8A 3EPEA 5H8FA 3H7MA 4OWDA 4THIA 4GXAA 4ZEBA 3E3KA 2YLNA 2B3FA 5AA2B 5B7DA 1NL5A 1AIVA 4KFQA 2OBGA 2CEYA 2PMSA 4C0RA 2DE3A 2ONRA 3HV1A 3SEVA 2Y5LA 2LAOA 1JEUA 2Y7RA 3DP4A 4P0IA 3A29A 1QKBA 1MS7A 3VVDA 3HCQA 1LB9A 4IO5A 2M8CA 1FPLA 2R71A 4JBZA 2XX9A 4BDLA 4JVIA 4GBVA 4N8GA 1NFTA 4DZ1A 4QSEA 4IY6A 1VR5A 5DEXA 1DBZA 3VVFA 4G61A 4QFPA 4UACA 4G8MA 1TT1A 4MH5A 3S9NC 1MH4A 4E0XA 4NF6A 2AIXA 4G2ZA 5EYGA 2Y7IA 5J16A 3RPLB 4OEVA 2ZNUA 2ZYNA 4P11A 4EDPA 3K6UA 4JSOA 3OO7A 4H8IA 1UTHB 3G3FA 4ZE8A 5TPAA 1M5FA 4BDQA 1URSA 1MY0A 3H6UA 4PE5B 3MQ9A 3L6GA 3T0JA 3LSWA 3FXUA 4PTKA 2UVHA 5AA4A 3T9VA 4DXCA 3U1OA 1FPDA 1NNFA 4GD5A 3VLWA 1FBFA 1UTHA 4OQOA 3O9PA 3TCHA 1IITA 2F6GA 2QSXA 1QUIA 4MHFA 1IIWA 3T22A 1B3HA 2XD2A 1IEJA 2I0BA 4MJOA 2DDKA 2OCUA 2DOJA 1KA1A 3EHTA 2X7PA 3JV9A 1O63A 5IZ3A 4GX6A 1I69A 4I3EA 1JETA 2B4LA 4I3YA 2RINA 4QXDA 5DEXB 3KJ7A 3IJOB 5TP9B 3RUMA 4OFLA 4ELRA 2ZYMA 2MKZA 5H8NB 4R2BA 4ELOA 4P47A 4MX6A 3M8UA 4X1DA 1MQDA 1VE4A 1GGGA 2WBBA 3IO6A 2RCBA 3BBRA 3SKPA 4ELPA 5I2KB 1Q35A 4MNCA 2ZXTA 4LATA 4KI0E 3GBBA 4OETA 1P1UA 1IMDA 4QBAA 3BFUA 3VFJA 4XKNA 2X26A 1BKAA 5AA3A 3K1NA 3V5AA 3FJMA 1A54A 3O6IA 2FA7A 3T1BA 2QMXA 1FPJA 2F36A 3MC2A 4F1YA 3GZGA 4R74A 3K0VA 3T96B 4O8MA 1MPDA 1URDA 3ZSFA 3C9HA 3MPKA 1DK4A 3M3KA 3PUXE 1RDZA 4F31B 3PU5A 3B6TA 3M3FA 3G3HA 4EF1A 3IB0A 4OYVA 2B4MA 3P7IA 1TWYA 4KHZE 4ELQA 3RTWB 3TTKA 1USYE 5I59A 4HCWA 1MY4A 1MQIA 2R9JA 4MCOA 1OLAA 4POWA 1SD3A 3OSQA 3BKIB 1D9YA 4YAHX 1NH8A 2W7YA 1B40A 4PGNA 4YB7A 1H3DA 4GXSB 4MAGA 5AE4A 3TUSA 3MVZA 5M2VA 1SDXA 3IL1B 2CZIA 4ZZEA 3TDJA 2DS9A 1RYOA 1QJMA 1QVSA 3TCFA 4X48A 2O7IA 5DVJA 1WVJA 2XXHA 2XWIA 2DXYA 3OO9A 1B6HA 3Q29A 1YXIA 1D9QA 4P1EA 3H6TA 3IO4A 1YTVA 5HPQA 2UVGA 3CVGA 3TMGA 5H8HB 4G8HA 3PUWE 2FYIA 3Q27A 2O7UA 1FTKA 4YKKA 4PE3A 4Z7EA 1JNFA 1SW1A 1B1XA 1MPBA 3HHFA 3K2DA 4NF6B 3RPLA 4HS7A 1OVTA 4PF8A 4I9DA 1M5DA 4LVQA 4GWSA 5CMMA 4F39A 3FV1A 3C34A 5ELVA 3I3VA 4NQ8A 4NE4A 3QXMA 3K02A 4U4SA 4MIJA 4HTGA 3BIGA 1MXXA 5IAIA 4TQUQ 1USYH 1IXIA 2GHAA 4H45A 4ESXA 2B3BA 2ZYKA 3DP6A 1JVXA 1B51A 1P1QA 4NWCA 2OK2A 3DLNA 5DT6A 5CMBA 4BDOA 4NTLA 3FGSA 1FBEA 3CG3A 4IB2A 3IOVA 2ZNTA 1MRPA 2XX7A 4IO3A 4XKQA 2D21A 1N3XA 3KN3A 3MAMA 4GLIA 1UIVA 1YCJA 1K9ZA 3V89B 3RT8A 4PFYA 2REJA 5AA2D 1XI6A 1B7UA 5F7VA 4K3FA 1XC1A 3BFTA 3MBPA 4NHBA 4MMPA 4U4XA 4JVDA 4BLAA 2DWHA 1G0IA 3O66A 4OVTA 2V25A 3IOUA 1IXHA 4PBHA 1IMFA 3LSXA 4R72A 3FVKA 1NV5A 2CEXA 1FSAA 3TELA 3FBPA 4P56A 3C36A 4FBPA 4JVCA 2HXWA 2KLFA 4LZ7A 1FPFA 1ZTYA 1Y9UA 1P1NA 2Y7WA 1ZLQA 2UVJA 3S9LC 2G29A 4U1ZA 4OVPA 3O28A 1MY2A 3O6GA 4I1DA 5I3SA 3OEMA 3CFLA 3EHUA 2VD3A 4AS5A 5K2XA 3N5LA 4HCYA 2HAVA 4R75A 4IO2A 1M5EA 2XXTA 4U1OA 4FJPA 4N6DA 2AL4A 5IGAA 5CM6A 5H8SA 1YPNA 3U92A 4H5GA 4G68C 1Z7NE 1VSOA 3KOTA 1CE2A 1P1OA 2H99A 1FCKA 3FVNA 2XXKA 1MY3A 1B0LA 3OD7A 4IY5A 1MDP1 3IAZA 1QUKA 3K1MA 1IXCA 1KZ8A 2A5TB 5H8HA 1B2HA 2Z22A 4HXVA 2P2AA 4ONYA 4N07A 2FVZA 4YU0A 3TYHA 2H5YA 4ND9A 1S7YA 5I56B 3LUYA 2THIA 1BIYA 4N13A 3DP8A 5F24A 4R73A 4F19A 1B5JA 2DVZA 3CRBA 5A5XB 2QVUA 4P1LA 1DMBA 1FBCA 2XXPA 2DSFA 3SEYA 1FQFA 4YZZA 1N7XA 4BDNA 4OHNA 2CZHA 1DPEA 4PETA 2E0SA 3TFLA 2Z8FA 5IM2A 5ITOA 1K9YA 2VT5A 1FQEA 1INPA 1ZU0A 1XVXA 3LUZA 4EQBA 3IFAA 1NNTA 4G77A 1N76A 1XOCA 4FATA 2HQ0A 5K2YA 1SW2A 4WEPA 1NUXA 4OEUA 1LB8A 1FTJA 1SYIA 1NNKA 1B32A 1NKXA 3LR1A 1TFAA 1FQAA 2AYSA 2WYPA 3R6UA 2A5TA 4H67A 2OZZA 3PMXA 4XIGQ 2O6AA 5EQ7A 3JZJA 4YKPA 3KG2A 5LOMA 5I7IA 4F3PA 2VPOA 3W15C 4ZEDA 4QSDA 3CHGA 4M4GA 1FJ6A 1A55A 1IMCA 2XD3A 5DYHA 1H76A 4ZE9A 5TU0A 5KCJB 4NMYA 2XXRA 3TTMA 5JK4A 4RXLA 3B6QA 2F7BA 2HPGA 1M5CA 4N91A 3CI8A 1R1NA 1N0TA 1SQYA 2PT2A 4F2OA 1QKAA 4P3LA 1FTMA 5BUUA 2AL5A 2G93A 2P3VA 3FJ7A 1FQBA 3RPWA 4U22A 1AH5A 1DPPA 3MZ9A 5ESYA 5LDZA 3OSRA 2BJJX 3ILTB 3RY3A 5IZ3B 5L8DA 3UGWA 1I6BA 3FXBA 3A09A 1HSJA 5HBCA 4FEBA 1LBXA 4XTCQ 2XXXA 4NF4A 1MM6A 4GBWA 4XEQA 1B7HA 4NX1A 5EQAA 2RKMA 4O7IA 2ZYOA 1B05A 4DI4B 1Y1MA 4PFTA 2GFEA 4LONB 4P0GA 4MEVA 1AL3A 2PT1A 1A8EA 2WBDA 3Q28A 4WEDA 1B3EA 1O64A 3A3CA 4JWXA 1QUJA 5ET8A 3ECRA 3O29A 3MP6A 2PYYA 1YYZA 3PPNA 3KSXA 4YB5A 1IUDA 3PV0E 5ICTA 4LZ5A 5ET6A 5ISUA 3FIRA 2DVCA 1EZ9A 3L6HA 4H5FA 1LBYA 1Q1KA 3EKIA 2P3NA 1BTJA 1UQWA 2V4CA 1RKMA 3N94A 4R9GA 5FTHA 3E9XA 3H3GA 4JWOA 3FUZA 3U8QA 4DE8A 3CFXA 2QJEA 3OEKA 3TTRA 4N8YA 2D5WA 3U72A 4GWZA 3E79A 4NF8A 5I57A 4JSDA 4GX3A 1S50A 4ZEIA 4I40A 1A8FA 3PPPA 2Y7PA 2A5SA 1LBZA 2I3WA 4UABA 2H9BA 2Z8DA 2PFZA 2HXRA 3CFZA 3ZS6A 1R9QA 3CSBA 5DVFA 3MSTA 4N6KA 5L9OA 5BWJA 1LSTA 3THIA 1FBDA 3VVEA 4RY1A 3IR1A 1B9JA 2OPEA 1PBQA 2HFBA 3PPOA 2VPNA 5KCJA 1LAFE 3B50A 3RT6B 3VV5A 3JYRA 1FBPA 1AMFA 1MQJA 1RYXA 1A99A 3FVOA 2R6GE 4NF0A 4GVOA 5CC2A 4RJZA 1FBHA 1A7LA 2JJKA 4LA9A 4WKMA 1SVXB 4ZEFA 3DELB 2Y84A 4RNSA 3KEIA 1US4A 1B7ZA 1HSEA 3H6VA 3LC8A 4JWYA 1DCUA 4OFJA 3HPIA 1DTGA 3MYUA 3UA8A 3PTYA 1LGBC 2F35A 4NF8B 3ZKKA 1ZIUA 2I58A 1MDQA 4GWOA 5CBSA 3H06B 3SDFA 4TLMB 2HHMA 4QSCA 3I6VA 1SBPA 1XT8A 2F5XA 1LCFA 5I84A 4R6YA 2H25A 2I6EA 3LBSA 4OANA 5H8QA 5HM4B 1D9VA 3ONMA 1XVYA 4E0WA 1POY1 3MVYA 4KQPA 3RLFE 1MH3A 3IJXB 2I48A 3PUYE 4EQ9A 1JW5A 3MZ1A 3UN6A 1O7TA 1FTAA 3S9EA 4P8BA 1ZBMA 4DI3D 3MZBA 1LAHE 3MP8A 4PDHA 1MPCA 3B8BA 3IORA 3K6VA 3F11A 2ABHA 3QSLA 2BJIA 3EHSA 3OENA 1FPIA 4O94A 4QFNA 4GF8A 4TOZA 4N81A 2IA4A 4LQ5A 2IEEA 1CNQA 1MXYA 2NOOA 1I6QA 2RC8A 3RGYA 1FTLA 5I59B 3QAXA 4POXA 4NF4B 1UTBA 1QULA 2UYEA 2F97A 4IO7A 3RQTA 1R6ZA 3MWBA 2F7CA 2RC7A 1SI1A 4G4PA 1PC3A 3PD9A 1PEBA 4ZZAA 4EUOA 4RK2A 3RYDA 3ZKLA 4NGUA 1QGXA 4QHQA 3TTLA 3SERA 1B5IA 1PDAA 1UTBB 5I2NB 4YKJA 3FATA 3PUZE 2YPNA 2O84X 3R26A 1NH7A 1ZMGA 4FEDA 1ZJLA 2QS3A 1NUZA 1NV0A 2GH9A 1CB6A 3RTFB 2XWKA 3B7DA 1BP5A 3G3KA 1N04A 2ZZXA 4KYEA 1VFEA 4RK9A 2F34A 4QFLA 4EQ7A 2Q8MA 2QVRA 1J1NA 4MBPA 5CMCA 2ZZVA 2HZLA 3TAJA 3UORA 1Y4TA 4PCDA 4PP0A 2QPQA 3M3LA 3C4MA 1SW5A 4OXVA 2FNCA 1MXVA 1RDXA 2XXYA 4OESA 2PCRA 1PB7A 2NXOA 1NMUA 5AA1A 3D4CA 2V93A 1FPKA 4MFIA 3VLVA 5EQ8A 1MQGA 4OVJA 1OMPA 3KJTA 2PFYA 4X8RA 3KC0A 1IXGA 3S4UA 4GWYA 1D3KA 4GWUA 1FQCA 1NUWA 4GWWA 3FVGA 1LCTA 3V8XB 3TTNA 1OLCA 1LAGE 2F6PA 1MXWA 4H46A 4OENA 1LBBA 4NN3A 5I2KA 4ZEKA 2DQVA 4NWDA 4PDDA 3HFUA 1B5HA 1NV2A 3BIHA 4QFOA 2UYFA 1PB9A 3FXQA 1XHYA 2NUVA 5ET5A 4GL8A 2F3DA 5JTYB 1NV3A 2OPDA 1FJ9A 2F78A 3KC1A 3FASA 1ZKBA 5AA2A 1VDWA 3GBAA 2I4CA 1M5BA 3IK6B 2F8DA 2UXAA 5ICQA 2Q88A 1AWBA 4R6HA 3Q25A 2I3VA 1B0HA 3H6WA 4F3GA 3H4ZA 1I6AA 1G0HA 4ISUA 4RA1A 4DCYA 2O69A 4DCXA 5FBPA 1DOTA 5FTIA 1ATGA 4XKPA 3ROJA 2HCAA 2GQ1A 3UIFA 5FHMA 4NG7A 3TKDA 1IMEA 4QRZA 4YKIA 5L9SA 4XF5A 4EXLA 4IR8A 2Q9TA 3EF7A 4YMBA 5TP9A 3Q26A 2DYXA 3QIMA 4KR5A 1FRPA 1YZ0A 3E78A 4LN5A 1LFIA 3R7XA 5I58B 4PFUA 2XWOA 2XXIA 1Y1ZA 2V3QA 4HE0A 3SZPA 1MXZA 1B3GA 2WX9A 1KA0A 3PGFA 4NEDA 3K00A 4MF3A 3PMVA 5I5PA 1T0KA 3MVWA 1HSLA 1LAXA 1POTA 2E1SA 1QW0A 4ZECA 3KGCA 2O1LA 4O3CA 4PAKA 3KZGA 1B4HA 4FAJA 4U2RA 2P1SA 2I4BA 4QF9A 4KXPA 2NWJA 3OELA 2QMWA 3SESA 1VFDA 4OVRA 1NV1A 1F9BA 3NOHA 3QUFA 3PUVE 1IMAA 4PBQA 1FW0A 3S9MC 3EQ1A 4G68B 4KCCA 2XHDA 5IZ1A 1H43A 1XS5A 2F3BA 2DXRA 4MLQA 4F18A 3B6WA 4GIZA 4X1BA 4DLDA 2CZKA 4H6DA 2XA5A 4MNPA 1B52A 2HAUA 2XX8A 2ZNSA 5FHOA 3D4GA 2ZMBA 4JXIA 3KSJA 3VXBA 1URGA 4OERA 2D3IA 5H8FB 1EZPA 2DWIA 3TQLA 4O3AA 4NF5B 1JEVA 3C35A 4OFOA 2QL3A 1LLSA 3UP9A 1JQFA 1NV4A 3TEPA 1NV7A 3PPQA 1MXUA 3GXAA 4N6PA 3K6WA 4BDMA 2CMOA 4PFIA 3GYYA 3LSLA 3G7WA 3FV2A 1B3LA 4O3BA 3N26A 3T9UA 4G8NA 3IOTA 4FECA 2Y5KA 4N15A 4Z0IA 1AOVA 4JB7A 3SEWA 2OLBA 1PB8A 1SYHA 3E13X 5EHMA 2GRVA 2P0SA 3W9WA 1B1HA 2ZZWA 4PF6A 1II5A 2FBPA 1Y20A 2HZKA 4F2QA 3FZVA 1GV8A 4OMBA 1IZ1A 3CIJA 4F1VA 3FD3A 1GVCA 5H8QB 3OMBA 4OA4A 4Q5TA 1Q9DA 5KDTA 1B58A 5EHSA 4H0WA 5JTYA 3MJNA 4LQ2A 4GQOA 2QS2A 3IX1A 1DTZA 4JDFA 1MY1A 2OWTA 3SETA 2O68A 5F1QA 1S9TA 1NV6A 5KDTB 3G3JA 5CRYA 3HN0A 3I5OA 4PGPA 3KN7A 3RN8A 4U23A 3G3GA 4F3BA 2XWVA 3HSTA 3C31A 4DXUA 3KFMA 1A40A 3C32A 5LTCA 2DE4A 2Y7KA 3TCGA 4EF2A 4LP2B 4NAPA 3EN3A 4H1XA 4F3SA 4KYSA 3VE1B 3PD8A 4AQ4A 5T3JA 3O97A 5JEIA 4YMAA 2OX3A 1H44A 3OXNA 4DIGA 4R9FA 4H8JA 2WKYA 2O1MA 4FIMA 4XFEA 2QS1A 4PFBA 2RF1A 1JP4A 2V84A 1US5A 4HE1A 4IO4A 2XXQA 4F22A 1DSNA 1Z7ME 2H98A 5I2NA 3AXFA 1IQ7A 1MM7A 4IO6A 4KPTA 3T66A 2UVIA 4XKRA 3SEUA 4MNIA 3QMFA 2PX1A 4R6KA 2VHAA 1N84A 3ODBA 5TPAB 2NVUB 3W9VA 3TZAA 4I62A 4AB5A 1EYKA 3CG1A 4PC9A 3DM0A 4I8CA 3CSGA 4YB6A 2Z8EA 5A5LA 1MQHA 5ITPA 1LBVA 3U94A 4Q8RA 1TFDA 1NUYA 1Y3QA 3MW0A 1SW4A 1EZOA 5AA4B 4RPOA 2WYKA 4AS4A 2Q2CA 3OO6A 1P99A 1R9LA 2XXVA 1EYJA 2Q89A 3T9HB 4AB6A 2VP1A 4KD5A 3T93B 1BK4A 4OVQA 4LUBA 4DDDA 5KZTA 1FBGA 3IB1A 3IB2A 4U21A 2RC9A 2Q74A 2L5VA 2REGA 3TPAA 3UK4A 1OVBA 2ALUA 2QFLA 3U65A 1H45A 3HHGA 4IGTA 3A3UA 3MPLA 2ONSA 1SPIA 3K4UA 3N6TA 1B4ZA 2FIEA 3GLBA 4RPNA 4FE8A 4GL0A 4Q0CA 3TQWA 1UIUA 1YAEA 4N17A 1GTKA 4BDRA 2QVVA 1LBCA 3QYTA 3MUQA 4UA8A 4KCDA 4PAIA 3V83A 5L9MA 4DXBA 2OWZA 4PAFA 4X9TA 4QFKA 4OVSA 2I49A 2RCAA 2VGQA 3MP1A 5B70A 5H8NA 2DWJA 4HE2A 5I58A 3FXRA 4Q30B 4EXKA 4M1VA 2FHYA 3OOAA 1N3WA 1MG1A 1GR2A 2V3TA 1WDNA 3KBZA 5EQ9A 1D4NA 3G3IA 1LFGA 2F7AA 2ONKE 4F1UA 5CI5A 4OZ9A 2DP8A 3KN8A 1NI9A 2R8TA 3RNNA 3K6XA 2PBWA 1LEVA 4GFRA 2Q2AA 4F29A 2VD2A 4G68A 1Y3NA 5A5XA 3ISPA 1NNPA 4KYDA 5EYHA 3O2AA 3SEXA 2Z23A 1IMBA 1P1WA 4ECFA 3WAEA 3T9XB 2QRYA 1FPGA 5CBRA 3IFCA 2GHBA 2OWSA 2H4IA 2Q8JA 3C33A 4C1TA 4TLLB 2V3UA 2FIXA 2PVUA 4YICA 2ANJA 1JVYA 2HEUA 3K01A 3OO8A 1FPBA
chains in the Genus database with same CATH topology
1FBCA 3W9VA 4O7MA 1LBWA 1DK4A 1NV1A 1AWBA 2OWZA 4YZZA 4F1VA 2P3VA 3FBPA 3T0JA 3NOHA 2HHMA 4P56A 1NUZA 4N8YA 4PAFA 2CZHA 4PBQA 1IMAA 1EYKA 4FBPA 4JVCA 4OA4A 1NV0A 4PE3A 4X9TA 4PTKA 2F5XA 1Q9DA 3D1RA 1RDZA 4OVSA 4PETA 4PC9A 1FPFA 4GWZA 2XWKA 3E79A 1FPDA 2ZZXA 5ESYA 5IZ1A 4GX3A 1FBFA 2F3BA 1G0HA 4HE2A 4OANA 5IM2A 4F18A 3RPLA 5LDZA 2B4MA 1K9YA 2CZKA 4UABA 4I40A 2Q8MA 4PF8A 2QVRA 2XA5A 4MNPA 4X04A 5A5LA 2VT5A 4GWSA 4M1VA 1LBVA 4OVPA 4MHFA 5I7IA 5IZ3B 1INPA 2FHYA 1NUYA 2ZZVA 5FBPA 2HZLA 1FPEA 5I3SA 3FXBA 3LUZA 1LBZA 2CEYA 4HCWA 4AS5A 1NV6A 1LBXA 3IFAA 3KBZA 4MJOA 2DDKA 5EQ9A 2QPQA 2WEFA 4HCYA 4N4UA 4NQ8A 4P9KA 2DE3A 2WYKA 4GWXA 4AS4A 4MIJA 2PFZA 1KA1A 2HXRA 4GBWA 3ROJA 1RDXA 2Y5LA 4PGPA 4MCOA 4XEQA 4NX1A 1FTAA 3MSTA 2GQ1A 1EYJA 4N6DA 4N6KA 2XWVA 4P8BA 3BIGA 5IZ3A 2PCRA 1FBDA 5EQAA 1NUXA 4GX6A 2KR0A 4DI3D 5CM6A 4O7IA 5IGAA 3A29A 4I3EA 4NG7A 4F1UA 5LTCA 2B4LA 2DE4A 1IMEA 1FPKA 4I3YA 1EYIA 5EQ8A 4H45A 4DI4B 4XF5A 2VPNA 4PDHA 1BK4A 4NAPA 4QXDA 3B8BA 4IR8A 4OVQA 2Q9TA 1NV4A 1NI9A 3B50A 4MEVA 2WYPA 1FBGA 2PFYA 1FPLA 4GX4A 4X8RA 1FBPA 2R8TA 3KC0A 3LV0A 4GWYA 2BJIA 1NV7A 2WBDA 4GWUA 1LEVA 1NUWA 4GWWA 4PGNA 1FPIA 5EQ7A 2XXKA 5T3JA 2MKZA 4JVIA 3ISPA 1FRPA 1YZ0A 2Q74A 2DE2A 2L5VA 2VPOA 2OX3A 4O94A 4PFIA 1FBEA 5ET8A 4GBVA 4N81A 4MAGA 4P47A 3GYYA 4N8GA 4NF0A 5J1DA 4MX6A 5EYHA 4H46A 3CHGA 1CNQA 2QFLA 1FBHA 4LN5A 3U65A 1FJ6A 4NN3A 1KZ8A 2CZIA 1DBZA 1IMCA 4XFEA 2XWOA 4PFBA 4G61A 2WBBA 4PDDA 3HFUA 1YYZA 1IMBA 1JP4A 1NV2A 4HXVA 3BIHA 1SPIA 2Y5KA 4N15A 2JJKA 4PCDA 2V3QA 4HE0A 2FVZA 3SZPA 2FIEA 1KA0A 1K9ZA 2WX9A 5DW8A 4MNCA 5ET5A 2XWIA 1IMDA 4HE1A 1FPGA 4QBAA 3IFCA 1XI6A 5JK4A 5ET6A 5EYGA 5J16A 3RPLB 2F3DA 5I5PA 4NHBA 1NV3A 4MMPA 4JVDA 4N17A 5F24A 1DCUA 2KQZA 4F19A 1YXIA 1D9QA 1FJ9A 2HPGA 4P1EA 1G0IA 4N91A 3KC1A 4PAKA 3RYDA 3W9WA 2DVZA 1LBYA 2ZZWA 3EKIA 3MYUA 2QVVA 4PF6A 3T1BA 3PTYA 2FIXA 1FPJA 2P3NA 1QGXA 1RDYA 4NGUA 4OVTA 1VDWA 4PFRA 5IZZA 4YICA 4PAIA 2FBPA 4PBHA 3E78A 2V4CA 4KXPA 2HZKA 1IMFA 2QVUA 4P3LA 4MNIA 5ET7A 3QMFA 4P1LA 4O8MA 1FPBA 1NV5A 2CEXA 4OVRA 1FSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBC A;  1LBW A;  1DK4 A;  1NV1 A;  1AWB A;  2OWZ A;  2P3V A;  3FBP A;  3T0J A;  2HHM A;  1NUZ A;  2CZH A;  1IMA A;  1EYK A;  4FBP A;  1NV0 A;  4PTK A;  1Q9D A;  3D1R A;  1RDZ A;  1FPF A;  4GWZ A;  1FPD A;  5ESY A;  5IZ1 A;  4GX3 A;  1FBF A;  2F3B A;  1G0H A;  4HE2 A;  3RPL A;  5LDZ A;  1K9Y A;  2CZK A;  4I40 A;  2Q8M A;  2QVR A;  5A5L A;  2VT5 A;  4GWS A;  1LBV A;  5IZ3 B;  1INP A;  2FHY A;  1NUY A;  5FBP A;  1FPE A;  5I3S A;  3LUZ A;  1LBZ A;  4AS5 A;  1NV6 A;  1LBX A;  3IFA A;  3KBZ A;  4MJO A;  2DDK A;  5EQ9 A;  2WEF A;  4GWX A;  4AS4 A;  1KA1 A;  4GBW A;  3ROJ A;  1RDX A;  2Y5L A;  1FTA A;  2GQ1 A;  1EYJ A;  3BIG A;  5IZ3 A;  2PCR A;  1FBD A;  5EQA A;  1NUX A;  4GX6 A;  4O7I A;  3A29 A;  4I3E A;  1IME A;  1FPK A;  4I3Y A;  1EYI A;  5EQ8 A;  4H45 A;  1BK4 A;  4QXD A;  3B8B A;  4IR8 A;  1NV4 A;  1NI9 A;  1FBG A;  1FPL A;  4GX4 A;  1FBP A;  2R8T A;  3KC0 A;  3LV0 A;  4GWY A;  2BJI A;  1NV7 A;  2WBD A;  4GWU A;  1LEV A;  1NUW A;  4GWW A;  1FPI A;  5EQ7 A;  5T3J A;  1FRP A;  1YZ0 A;  2Q74 A;  2OX3 A;  1FBE A;  5ET8 A;  4GBV A;  4N81 A;  5EYH A;  4H46 A;  1CNQ A;  2QFL A;  1FBH A;  1FJ6 A;  1KZ8 A;  2CZI A;  1DBZ A;  1IMC A;  4G61 A;  2WBB A;  1YYZ A;  1IMB A;  1JP4 A;  1NV2 A;  4HXV A;  3BIH A;  1SPI A;  2Y5K A;  2JJK A;  4HE0 A;  2FVZ A;  2FIE A;  1KA0 A;  1K9Z A;  5DW8 A;  5ET5 A;  1IMD A;  4HE1 A;  1FPG A;  3IFC A;  1XI6 A;  5ET6 A;  5EYG A;  5J16 A;  3RPL B;  2F3D A;  1NV3 A;  5F24 A;  1DCU A;  1YXI A;  1D9Q A;  1FJ9 A;  1G0I A;  3KC1 A;  3RYD A;  1LBY A;  2QVV A;  2FIX A;  1FPJ A;  2P3N A;  1QGX A;  1RDY A;  1VDW A;  2FBP A;  4KXP A;  1IMF A;  2QVU A;  5ET7 A;  3QMF A;  1FPB A;  1NV5 A;  1FSA A; 
#chains in the Genus database with same CATH topology
 3LSF B;  1FTO A;  3PPR A;  3VLU A;  1ELJ A;  2I0C A;  4IGR A;  3TOD A;  1N7W A;  1OQH A;  4GOT A;  3VXC A;  3QUJ A;  5IKB A;  1Y3P A;  1OIB A;  4X04 A;  1B46 A;  4HW8 A;  2OJT A;  4PFW A;  4ESW A;  1ANF A;  4C1U A;  1WOD A;  1FPE A;  2O51 A;  5FHN A;  1EH3 A;  4OTE A;  4N4U A;  3USD A;  4NF5 A;  2WEF A;  4P9K A;  1Y4C A;  4GWX A;  3VDF A;  5EYF A;  4L17 A;  4WXJ A;  2KR0 A;  2XXU A;  2QS4 A;  4R2F A;  1SI0 A;  1EYI A;  3U93 A;  5CMK A;  1LFH A;  1FQD A;  4GX4 A;  3LV0 A;  3S2V A;  4H65 A;  1B3F A;  5DVI A;  1EU8 A;  2ESN A;  3HO7 A;  2DE2 A;  3K1P A;  1PBP A;  5J1D A;  1KWH A;  3PMW A;  1OQG A;  4ZDM A;  1TXF A;  3MVX A;  2X7Q A;  2XXW A;  2YJP A;  3CR9 A;  2B65 A;  4FOR A;  1JW4 A;  5DW8 A;  2VOZ A;  4MLV A;  1JW1 A;  2KQZ A;  1BLF A;  4PFR A;  5IZZ A;  1RDY A;  3QK6 A;  5I56 A;  3KOS A;  5ET7 A;  3FJG A;  3KBR A;  3O6H A;  3N6U A;  4O7M A;  1LBW A;  4RYA A;  4XXU A;  3E4R A;  2DWA A;  4GRK A;  5DTB A;  4PQJ A;  3D1R A;  5I57 B;  3IOW A;  3WAF A;  4ZS9 A;  3H03 A;  2CZL A;  3ILU B;  1L5T A;  4LZ8 A;  3EPE A;  5H8F A;  3H7M A;  4OWD A;  4THI A;  4GXA A;  4ZEB A;  3E3K A;  2YLN A;  2B3F A;  5AA2 B;  5B7D A;  1NL5 A;  1AIV A;  4KFQ A;  2OBG A;  2CEY A;  2PMS A;  4C0R A;  2DE3 A;  2ONR A;  3HV1 A;  3SEV A;  2Y5L A;  2LAO A;  1JEU A;  2Y7R A;  3DP4 A;  4P0I A;  3A29 A;  1QKB A;  1MS7 A;  3VVD A;  3HCQ A;  1LB9 A;  4IO5 A;  2M8C A;  1FPL A;  2R71 A;  4JBZ A;  2XX9 A;  4BDL A;  4JVI A;  4GBV A;  4N8G A;  1NFT A;  4DZ1 A;  4QSE A;  4IY6 A;  1VR5 A;  5DEX A;  1DBZ A;  3VVF A;  4G61 A;  4QFP A;  4UAC A;  4G8M A;  1TT1 A;  4MH5 A;  3S9N C;  1MH4 A;  4E0X A;  4NF6 A;  2AIX A;  4G2Z A;  5EYG A;  2Y7I A;  5J16 A;  3RPL B;  4OEV A;  2ZNU A;  2ZYN A;  4P11 A;  4EDP A;  3K6U A;  4JSO A;  3OO7 A;  4H8I A;  1UTH B;  3G3F A;  4ZE8 A;  5TPA A;  1M5F A;  4BDQ A;  1URS A;  1MY0 A;  3H6U A;  4PE5 B;  3MQ9 A;  3L6G A;  3T0J A;  3LSW A;  3FXU A;  4PTK A;  2UVH A;  5AA4 A;  3T9V A;  4DXC A;  3U1O A;  1FPD A;  1NNF A;  4GD5 A;  3VLW A;  1FBF A;  1UTH A;  4OQO A;  3O9P A;  3TCH A;  1IIT A;  2F6G A;  2QSX A;  1QUI A;  4MHF A;  1IIW A;  3T22 A;  1B3H A;  2XD2 A;  1IEJ A;  2I0B A;  4MJO A;  2DDK A;  2OCU A;  2DOJ A;  1KA1 A;  3EHT A;  2X7P A;  3JV9 A;  1O63 A;  5IZ3 A;  4GX6 A;  1I69 A;  4I3E A;  1JET A;  2B4L A;  4I3Y A;  2RIN A;  4QXD A;  5DEX B;  3KJ7 A;  3IJO B;  5TP9 B;  3RUM A;  4OFL A;  4ELR A;  2ZYM A;  2MKZ A;  5H8N B;  4R2B A;  4ELO A;  4P47 A;  4MX6 A;  3M8U A;  4X1D A;  1MQD A;  1VE4 A;  1GGG A;  2WBB A;  3IO6 A;  2RCB A;  3BBR A;  3SKP A;  4ELP A;  5I2K B;  1Q35 A;  4MNC A;  2ZXT A;  4LAT A;  4KI0 E;  3GBB A;  4OET A;  1P1U A;  1IMD A;  4QBA A;  3BFU A;  3VFJ A;  4XKN A;  2X26 A;  1BKA A;  5AA3 A;  3K1N A;  3V5A A;  3FJM A;  1A54 A;  3O6I A;  2FA7 A;  3T1B A;  2QMX A;  1FPJ A;  2F36 A;  3MC2 A;  4F1Y A;  3GZG A;  4R74 A;  3K0V A;  3T96 B;  4O8M A;  1MPD A;  1URD A;  3ZSF A;  3C9H A;  3MPK A;  1DK4 A;  3M3K A;  3PUX E;  1RDZ A;  4F31 B;  3PU5 A;  3B6T A;  3M3F A;  3G3H A;  4EF1 A;  3IB0 A;  4OYV A;  2B4M A;  3P7I A;  1TWY A;  4KHZ E;  4ELQ A;  3RTW B;  3TTK A;  1USY E;  5I59 A;  4HCW A;  1MY4 A;  1MQI A;  2R9J A;  4MCO A;  1OLA A;  4POW A;  1SD3 A;  3OSQ A;  3BKI B;  1D9Y A;  4YAH X;  1NH8 A;  2W7Y A;  1B40 A;  4PGN A;  4YB7 A;  1H3D A;  4GXS B;  4MAG A;  5AE4 A;  3TUS A;  3MVZ A;  5M2V A;  1SDX A;  3IL1 B;  2CZI A;  4ZZE A;  3TDJ A;  2DS9 A;  1RYO A;  1QJM A;  1QVS A;  3TCF A;  4X48 A;  2O7I A;  5DVJ A;  1WVJ A;  2XXH A;  2XWI A;  2DXY A;  3OO9 A;  1B6H A;  3Q29 A;  1YXI A;  1D9Q A;  4P1E A;  3H6T A;  3IO4 A;  1YTV A;  5HPQ A;  2UVG A;  3CVG A;  3TMG A;  5H8H B;  4G8H A;  3PUW E;  2FYI A;  3Q27 A;  2O7U A;  1FTK A;  4YKK A;  4PE3 A;  4Z7E A;  1JNF A;  1SW1 A;  1B1X A;  1MPB A;  3HHF A;  3K2D A;  4NF6 B;  3RPL A;  4HS7 A;  1OVT A;  4PF8 A;  4I9D A;  1M5D A;  4LVQ A;  4GWS A;  5CMM A;  4F39 A;  3FV1 A;  3C34 A;  5ELV A;  3I3V A;  4NQ8 A;  4NE4 A;  3QXM A;  3K02 A;  4U4S A;  4MIJ A;  4HTG A;  3BIG A;  1MXX A;  5IAI A;  4TQU Q;  1USY H;  1IXI A;  2GHA A;  4H45 A;  4ESX A;  2B3B A;  2ZYK A;  3DP6 A;  1JVX A;  1B51 A;  1P1Q A;  4NWC A;  2OK2 A;  3DLN A;  5DT6 A;  5CMB A;  4BDO A;  4NTL A;  3FGS A;  1FBE A;  3CG3 A;  4IB2 A;  3IOV A;  2ZNT A;  1MRP A;  2XX7 A;  4IO3 A;  4XKQ A;  2D21 A;  1N3X A;  3KN3 A;  3MAM A;  4GLI A;  1UIV A;  1YCJ A;  1K9Z A;  3V89 B;  3RT8 A;  4PFY A;  2REJ A;  5AA2 D;  1XI6 A;  1B7U A;  5F7V A;  4K3F A;  1XC1 A;  3BFT A;  3MBP A;  4NHB A;  4MMP A;  4U4X A;  4JVD A;  4BLA A;  2DWH A;  1G0I A;  3O66 A;  4OVT A;  2V25 A;  3IOU A;  1IXH A;  4PBH A;  1IMF A;  3LSX A;  4R72 A;  3FVK A;  1NV5 A;  2CEX A;  1FSA A;  3TEL A;  3FBP A;  4P56 A;  3C36 A;  4FBP A;  4JVC A;  2HXW A;  2KLF A;  4LZ7 A;  1FPF A;  1ZTY A;  1Y9U A;  1P1N A;  2Y7W A;  1ZLQ A;  2UVJ A;  3S9L C;  2G29 A;  4U1Z A;  4OVP A;  3O28 A;  1MY2 A;  3O6G A;  4I1D A;  5I3S A;  3OEM A;  3CFL A;  3EHU A;  2VD3 A;  4AS5 A;  5K2X A;  3N5L A;  4HCY A;  2HAV A;  4R75 A;  4IO2 A;  1M5E A;  2XXT A;  4U1O A;  4FJP A;  4N6D A;  2AL4 A;  5IGA A;  5CM6 A;  5H8S A;  1YPN A;  3U92 A;  4H5G A;  4G68 C;  1Z7N E;  1VSO A;  3KOT A;  1CE2 A;  1P1O A;  2H99 A;  1FCK A;  3FVN A;  2XXK A;  1MY3 A;  1B0L A;  3OD7 A;  4IY5 A;  1MDP 1;  3IAZ A;  1QUK A;  3K1M A;  1IXC A;  1KZ8 A;  2A5T B;  5H8H A;  1B2H A;  2Z22 A;  4HXV A;  2P2A A;  4ONY A;  4N07 A;  2FVZ A;  4YU0 A;  3TYH A;  2H5Y A;  4ND9 A;  1S7Y A;  5I56 B;  3LUY A;  2THI A;  1BIY A;  4N13 A;  3DP8 A;  5F24 A;  4R73 A;  4F19 A;  1B5J A;  2DVZ A;  3CRB A;  5A5X B;  2QVU A;  4P1L A;  1DMB A;  1FBC A;  2XXP A;  2DSF A;  3SEY A;  1FQF A;  4YZZ A;  1N7X A;  4BDN A;  4OHN A;  2CZH A;  1DPE A;  4PET A;  2E0S A;  3TFL A;  2Z8F A;  5IM2 A;  5ITO A;  1K9Y A;  2VT5 A;  1FQE A;  1INP A;  1ZU0 A;  1XVX A;  3LUZ A;  4EQB A;  3IFA A;  1NNT A;  4G77 A;  1N76 A;  1XOC A;  4FAT A;  2HQ0 A;  5K2Y A;  1SW2 A;  4WEP A;  1NUX A;  4OEU A;  1LB8 A;  1FTJ A;  1SYI A;  1NNK A;  1B32 A;  1NKX A;  3LR1 A;  1TFA A;  1FQA A;  2AYS A;  2WYP A;  3R6U A;  2A5T A;  4H67 A;  2OZZ A;  3PMX A;  4XIG Q;  2O6A A;  5EQ7 A;  3JZJ A;  4YKP A;  3KG2 A;  5LOM A;  5I7I A;  4F3P A;  2VPO A;  3W15 C;  4ZED A;  4QSD A;  3CHG A;  4M4G A;  1FJ6 A;  1A55 A;  1IMC A;  2XD3 A;  5DYH A;  1H76 A;  4ZE9 A;  5TU0 A;  5KCJ B;  4NMY A;  2XXR A;  3TTM A;  5JK4 A;  4RXL A;  3B6Q A;  2F7B A;  2HPG A;  1M5C A;  4N91 A;  3CI8 A;  1R1N A;  1N0T A;  1SQY A;  2PT2 A;  4F2O A;  1QKA A;  4P3L A;  1FTM A;  5BUU A;  2AL5 A;  2G93 A;  2P3V A;  3FJ7 A;  1FQB A;  3RPW A;  4U22 A;  1AH5 A;  1DPP A;  3MZ9 A;  5ESY A;  5LDZ A;  3OSR A;  2BJJ X;  3ILT B;  3RY3 A;  5IZ3 B;  5L8D A;  3UGW A;  1I6B A;  3FXB A;  3A09 A;  1HSJ A;  5HBC A;  4FEB A;  1LBX A;  4XTC Q;  2XXX A;  4NF4 A;  1MM6 A;  4GBW A;  4XEQ A;  1B7H A;  4NX1 A;  5EQA A;  2RKM A;  4O7I A;  2ZYO A;  1B05 A;  4DI4 B;  1Y1M A;  4PFT A;  2GFE A;  4LON B;  4P0G A;  4MEV A;  1AL3 A;  2PT1 A;  1A8E A;  2WBD A;  3Q28 A;  4WED A;  1B3E A;  1O64 A;  3A3C A;  4JWX A;  1QUJ A;  5ET8 A;  3ECR A;  3O29 A;  3MP6 A;  2PYY A;  1YYZ A;  3PPN A;  3KSX A;  4YB5 A;  1IUD A;  3PV0 E;  5ICT A;  4LZ5 A;  5ET6 A;  5ISU A;  3FIR A;  2DVC A;  1EZ9 A;  3L6H A;  4H5F A;  1LBY A;  1Q1K A;  3EKI A;  2P3N A;  1BTJ A;  1UQW A;  2V4C A;  1RKM A;  3N94 A;  4R9G A;  5FTH A;  3E9X A;  3H3G A;  4JWO A;  3FUZ A;  3U8Q A;  4DE8 A;  3CFX A;  2QJE A;  3OEK A;  3TTR A;  4N8Y A;  2D5W A;  3U72 A;  4GWZ A;  3E79 A;  4NF8 A;  5I57 A;  4JSD A;  4GX3 A;  1S50 A;  4ZEI A;  4I40 A;  1A8F A;  3PPP A;  2Y7P A;  2A5S A;  1LBZ A;  2I3W A;  4UAB A;  2H9B A;  2Z8D A;  2PFZ A;  2HXR A;  3CFZ A;  3ZS6 A;  1R9Q A;  3CSB A;  5DVF A;  3MST A;  4N6K A;  5L9O A;  5BWJ A;  1LST A;  3THI A;  1FBD A;  3VVE A;  4RY1 A;  3IR1 A;  1B9J A;  2OPE A;  1PBQ A;  2HFB A;  3PPO A;  2VPN A;  5KCJ A;  1LAF E;  3B50 A;  3RT6 B;  3VV5 A;  3JYR A;  1FBP A;  1AMF A;  1MQJ A;  1RYX A;  1A99 A;  3FVO A;  2R6G E;  4NF0 A;  4GVO A;  5CC2 A;  4RJZ A;  1FBH A;  1A7L A;  2JJK A;  4LA9 A;  4WKM A;  1SVX B;  4ZEF A;  3DEL B;  2Y84 A;  4RNS A;  3KEI A;  1US4 A;  1B7Z A;  1HSE A;  3H6V A;  3LC8 A;  4JWY A;  1DCU A;  4OFJ A;  3HPI A;  1DTG A;  3MYU A;  3UA8 A;  3PTY A;  1LGB C;  2F35 A;  4NF8 B;  3ZKK A;  1ZIU A;  2I58 A;  1MDQ A;  4GWO A;  5CBS A;  3H06 B;  3SDF A;  4TLM B;  2HHM A;  4QSC A;  3I6V A;  1SBP A;  1XT8 A;  2F5X A;  1LCF A;  5I84 A;  4R6Y A;  2H25 A;  2I6E A;  3LBS A;  4OAN A;  5H8Q A;  5HM4 B;  1D9V A;  3ONM A;  1XVY A;  4E0W A;  1POY 1;  3MVY A;  4KQP A;  3RLF E;  1MH3 A;  3IJX B;  2I48 A;  3PUY E;  4EQ9 A;  1JW5 A;  3MZ1 A;  3UN6 A;  1O7T A;  1FTA A;  3S9E A;  4P8B A;  1ZBM A;  4DI3 D;  3MZB A;  1LAH E;  3MP8 A;  4PDH A;  1MPC A;  3B8B A;  3IOR A;  3K6V A;  3F11 A;  2ABH A;  3QSL A;  2BJI A;  3EHS A;  3OEN A;  1FPI A;  4O94 A;  4QFN A;  4GF8 A;  4TOZ A;  4N81 A;  2IA4 A;  4LQ5 A;  2IEE A;  1CNQ A;  1MXY A;  2NOO A;  1I6Q A;  2RC8 A;  3RGY A;  1FTL A;  5I59 B;  3QAX A;  4POX A;  4NF4 B;  1UTB A;  1QUL A;  2UYE A;  2F97 A;  4IO7 A;  3RQT A;  1R6Z A;  3MWB A;  2F7C A;  2RC7 A;  1SI1 A;  4G4P A;  1PC3 A;  3PD9 A;  1PEB A;  4ZZA A;  4EUO A;  4RK2 A;  3RYD A;  3ZKL A;  4NGU A;  1QGX A;  4QHQ A;  3TTL A;  3SER A;  1B5I A;  1PDA A;  1UTB B;  5I2N B;  4YKJ A;  3FAT A;  3PUZ E;  2YPN A;  2O84 X;  3R26 A;  1NH7 A;  1ZMG A;  4FED A;  1ZJL A;  2QS3 A;  1NUZ A;  1NV0 A;  2GH9 A;  1CB6 A;  3RTF B;  2XWK A;  3B7D A;  1BP5 A;  3G3K A;  1N04 A;  2ZZX A;  4KYE A;  1VFE A;  4RK9 A;  2F34 A;  4QFL A;  4EQ7 A;  2Q8M A;  2QVR A;  1J1N A;  4MBP A;  5CMC A;  2ZZV A;  2HZL A;  3TAJ A;  3UOR A;  1Y4T A;  4PCD A;  4PP0 A;  2QPQ A;  3M3L A;  3C4M A;  1SW5 A;  4OXV A;  2FNC A;  1MXV A;  1RDX A;  2XXY A;  4OES A;  2PCR A;  1PB7 A;  2NXO A;  1NMU A;  5AA1 A;  3D4C A;  2V93 A;  1FPK A;  4MFI A;  3VLV A;  5EQ8 A;  1MQG A;  4OVJ A;  1OMP A;  3KJT A;  2PFY A;  4X8R A;  3KC0 A;  1IXG A;  3S4U A;  4GWY A;  1D3K A;  4GWU A;  1FQC A;  1NUW A;  4GWW A;  3FVG A;  1LCT A;  3V8X B;  3TTN A;  1OLC A;  1LAG E;  2F6P A;  1MXW A;  4H46 A;  4OEN A;  1LBB A;  4NN3 A;  5I2K A;  4ZEK A;  2DQV A;  4NWD A;  4PDD A;  3HFU A;  1B5H A;  1NV2 A;  3BIH A;  4QFO A;  2UYF A;  1PB9 A;  3FXQ A;  1XHY A;  2NUV A;  5ET5 A;  4GL8 A;  2F3D A;  5JTY B;  1NV3 A;  2OPD A;  1FJ9 A;  2F78 A;  3KC1 A;  3FAS A;  1ZKB A;  5AA2 A;  1VDW A;  3GBA A;  2I4C A;  1M5B A;  3IK6 B;  2F8D A;  2UXA A;  5ICQ A;  2Q88 A;  1AWB A;  4R6H A;  3Q25 A;  2I3V A;  1B0H A;  3H6W A;  4F3G A;  3H4Z A;  1I6A A;  1G0H A;  4ISU A;  4RA1 A;  4DCY A;  2O69 A;  4DCX A;  5FBP A;  1DOT A;  5FTI A;  1ATG A;  4XKP A;  3ROJ A;  2HCA A;  2GQ1 A;  3UIF A;  5FHM A;  4NG7 A;  3TKD A;  1IME A;  4QRZ A;  4YKI A;  5L9S A;  4XF5 A;  4EXL A;  4IR8 A;  2Q9T A;  3EF7 A;  4YMB A;  5TP9 A;  3Q26 A;  2DYX A;  3QIM A;  4KR5 A;  1FRP A;  1YZ0 A;  3E78 A;  4LN5 A;  1LFI A;  3R7X A;  5I58 B;  4PFU A;  2XWO A;  2XXI A;  1Y1Z A;  2V3Q A;  4HE0 A;  3SZP A;  1MXZ A;  1B3G A;  2WX9 A;  1KA0 A;  3PGF A;  4NED A;  3K00 A;  4MF3 A;  3PMV A;  5I5P A;  1T0K A;  3MVW A;  1HSL A;  1LAX A;  1POT A;  2E1S A;  1QW0 A;  4ZEC A;  3KGC A;  2O1L A;  4O3C A;  4PAK A;  3KZG A;  1B4H A;  4FAJ A;  4U2R A;  2P1S A;  2I4B A;  4QF9 A;  4KXP A;  2NWJ A;  3OEL A;  2QMW A;  3SES A;  1VFD A;  4OVR A;  1NV1 A;  1F9B A;  3NOH A;  3QUF A;  3PUV E;  1IMA A;  4PBQ A;  1FW0 A;  3S9M C;  3EQ1 A;  4G68 B;  4KCC A;  2XHD A;  5IZ1 A;  1H43 A;  1XS5 A;  2F3B A;  2DXR A;  4MLQ A;  4F18 A;  3B6W A;  4GIZ A;  4X1B A;  4DLD A;  2CZK A;  4H6D A;  2XA5 A;  4MNP A;  1B52 A;  2HAU A;  2XX8 A;  2ZNS A;  5FHO A;  3D4G A;  2ZMB A;  4JXI A;  3KSJ A;  3VXB A;  1URG A;  4OER A;  2D3I A;  5H8F B;  1EZP A;  2DWI A;  3TQL A;  4O3A A;  4NF5 B;  1JEV A;  3C35 A;  4OFO A;  2QL3 A;  1LLS A;  3UP9 A;  1JQF A;  1NV4 A;  3TEP A;  1NV7 A;  3PPQ A;  1MXU A;  3GXA A;  4N6P A;  3K6W A;  4BDM A;  2CMO A;  4PFI A;  3GYY A;  3LSL A;  3G7W A;  3FV2 A;  1B3L A;  4O3B A;  3N26 A;  3T9U A;  4G8N A;  3IOT A;  4FEC A;  2Y5K A;  4N15 A;  4Z0I A;  1AOV A;  4JB7 A;  3SEW A;  2OLB A;  1PB8 A;  1SYH A;  3E13 X;  5EHM A;  2GRV A;  2P0S A;  3W9W A;  1B1H A;  2ZZW A;  4PF6 A;  1II5 A;  2FBP A;  1Y20 A;  2HZK A;  4F2Q A;  3FZV A;  1GV8 A;  4OMB A;  1IZ1 A;  3CIJ A;  4F1V A;  3FD3 A;  1GVC A;  5H8Q B;  3OMB A;  4OA4 A;  4Q5T A;  1Q9D A;  5KDT A;  1B58 A;  5EHS A;  4H0W A;  5JTY A;  3MJN A;  4LQ2 A;  4GQO A;  2QS2 A;  3IX1 A;  1DTZ A;  4JDF A;  1MY1 A;  2OWT A;  3SET A;  2O68 A;  5F1Q A;  1S9T A;  1NV6 A;  5KDT B;  3G3J A;  5CRY A;  3HN0 A;  3I5O A;  4PGP A;  3KN7 A;  3RN8 A;  4U23 A;  3G3G A;  4F3B A;  2XWV A;  3HST A;  3C31 A;  4DXU A;  3KFM A;  1A40 A;  3C32 A;  5LTC A;  2DE4 A;  2Y7K A;  3TCG A;  4EF2 A;  4LP2 B;  4NAP A;  3EN3 A;  4H1X A;  4F3S A;  4KYS A;  3VE1 B;  3PD8 A;  4AQ4 A;  5T3J A;  3O97 A;  5JEI A;  4YMA A;  2OX3 A;  1H44 A;  3OXN A;  4DIG A;  4R9F A;  4H8J A;  2WKY A;  2O1M A;  4FIM A;  4XFE A;  2QS1 A;  4PFB A;  2RF1 A;  1JP4 A;  2V84 A;  1US5 A;  4HE1 A;  4IO4 A;  2XXQ A;  4F22 A;  1DSN A;  1Z7M E;  2H98 A;  5I2N A;  3AXF A;  1IQ7 A;  1MM7 A;  4IO6 A;  4KPT A;  3T66 A;  2UVI A;  4XKR A;  3SEU A;  4MNI A;  3QMF A;  2PX1 A;  4R6K A;  2VHA A;  1N84 A;  3ODB A;  5TPA B;  2NVU B;  3W9V A;  3TZA A;  4I62 A;  4AB5 A;  1EYK A;  3CG1 A;  4PC9 A;  3DM0 A;  4I8C A;  3CSG A;  4YB6 A;  2Z8E A;  5A5L A;  1MQH A;  5ITP A;  1LBV A;  3U94 A;  4Q8R A;  1TFD A;  1NUY A;  1Y3Q A;  3MW0 A;  1SW4 A;  1EZO A;  5AA4 B;  4RPO A;  2WYK A;  4AS4 A;  2Q2C A;  3OO6 A;  1P99 A;  1R9L A;  2XXV A;  1EYJ A;  2Q89 A;  3T9H B;  4AB6 A;  2VP1 A;  4KD5 A;  3T93 B;  1BK4 A;  4OVQ A;  4LUB A;  4DDD A;  5KZT A;  1FBG A;  3IB1 A;  3IB2 A;  4U21 A;  2RC9 A;  2Q74 A;  2L5V A;  2REG A;  3TPA A;  3UK4 A;  1OVB A;  2ALU A;  2QFL A;  3U65 A;  1H45 A;  3HHG A;  4IGT A;  3A3U A;  3MPL A;  2ONS A;  1SPI A;  3K4U A;  3N6T A;  1B4Z A;  2FIE A;  3GLB A;  4RPN A;  4FE8 A;  4GL0 A;  4Q0C A;  3TQW A;  1UIU A;  1YAE A;  4N17 A;  1GTK A;  4BDR A;  2QVV A;  1LBC A;  3QYT A;  3MUQ A;  4UA8 A;  4KCD A;  4PAI A;  3V83 A;  5L9M A;  4DXB A;  2OWZ A;  4PAF A;  4X9T A;  4QFK A;  4OVS A;  2I49 A;  2RCA A;  2VGQ A;  3MP1 A;  5B70 A;  5H8N A;  2DWJ A;  4HE2 A;  5I58 A;  3FXR A;  4Q30 B;  4EXK A;  4M1V A;  2FHY A;  3OOA A;  1N3W A;  1MG1 A;  1GR2 A;  2V3T A;  1WDN A;  3KBZ A;  5EQ9 A;  1D4N A;  3G3I A;  1LFG A;  2F7A A;  2ONK E;  4F1U A;  5CI5 A;  4OZ9 A;  2DP8 A;  3KN8 A;  1NI9 A;  2R8T A;  3RNN A;  3K6X A;  2PBW A;  1LEV A;  4GFR A;  2Q2A A;  4F29 A;  2VD2 A;  4G68 A;  1Y3N A;  5A5X A;  3ISP A;  1NNP A;  4KYD A;  5EYH A;  3O2A A;  3SEX A;  2Z23 A;  1IMB A;  1P1W A;  4ECF A;  3WAE A;  3T9X B;  2QRY A;  1FPG A;  5CBR A;  3IFC A;  2GHB A;  2OWS A;  2H4I A;  2Q8J A;  3C33 A;  4C1T A;  4TLL B;  2V3U A;  2FIX A;  2PVU A;  4YIC A;  2ANJ A;  1JVY A;  2HEU A;  3K01 A;  3OO8 A;  1FPB A; 
#chains in the Genus database with same CATH homology
 1FBC A;  3W9V A;  4O7M A;  1LBW A;  1DK4 A;  1NV1 A;  1AWB A;  2OWZ A;  4YZZ A;  4F1V A;  2P3V A;  3FBP A;  3T0J A;  3NOH A;  2HHM A;  4P56 A;  1NUZ A;  4N8Y A;  4PAF A;  2CZH A;  4PBQ A;  1IMA A;  1EYK A;  4FBP A;  4JVC A;  4OA4 A;  1NV0 A;  4PE3 A;  4X9T A;  4PTK A;  2F5X A;  1Q9D A;  3D1R A;  1RDZ A;  4OVS A;  4PET A;  4PC9 A;  1FPF A;  4GWZ A;  2XWK A;  3E79 A;  1FPD A;  2ZZX A;  5ESY A;  5IZ1 A;  4GX3 A;  1FBF A;  2F3B A;  1G0H A;  4HE2 A;  4OAN A;  5IM2 A;  4F18 A;  3RPL A;  5LDZ A;  2B4M A;  1K9Y A;  2CZK A;  4UAB A;  4I40 A;  2Q8M A;  4PF8 A;  2QVR A;  2XA5 A;  4MNP A;  4X04 A;  5A5L A;  2VT5 A;  4GWS A;  4M1V A;  1LBV A;  4OVP A;  4MHF A;  5I7I A;  5IZ3 B;  1INP A;  2FHY A;  1NUY A;  2ZZV A;  5FBP A;  2HZL A;  1FPE A;  5I3S A;  3FXB A;  3LUZ A;  1LBZ A;  2CEY A;  4HCW A;  4AS5 A;  1NV6 A;  1LBX A;  3IFA A;  3KBZ A;  4MJO A;  2DDK A;  5EQ9 A;  2QPQ A;  2WEF A;  4HCY A;  4N4U A;  4NQ8 A;  4P9K A;  2DE3 A;  2WYK A;  4GWX A;  4AS4 A;  4MIJ A;  2PFZ A;  1KA1 A;  2HXR A;  4GBW A;  3ROJ A;  1RDX A;  2Y5L A;  4PGP A;  4MCO A;  4XEQ A;  4NX1 A;  1FTA A;  3MST A;  2GQ1 A;  1EYJ A;  4N6D A;  4N6K A;  2XWV A;  4P8B A;  3BIG A;  5IZ3 A;  2PCR A;  1FBD A;  5EQA A;  1NUX A;  4GX6 A;  2KR0 A;  4DI3 D;  5CM6 A;  4O7I A;  5IGA A;  3A29 A;  4I3E A;  4NG7 A;  4F1U A;  5LTC A;  2B4L A;  2DE4 A;  1IME A;  1FPK A;  4I3Y A;  1EYI A;  5EQ8 A;  4H45 A;  4DI4 B;  4XF5 A;  2VPN A;  4PDH A;  1BK4 A;  4NAP A;  4QXD A;  3B8B A;  4IR8 A;  4OVQ A;  2Q9T A;  1NV4 A;  1NI9 A;  3B50 A;  4MEV A;  2WYP A;  1FBG A;  2PFY A;  1FPL A;  4GX4 A;  4X8R A;  1FBP A;  2R8T A;  3KC0 A;  3LV0 A;  4GWY A;  2BJI A;  1NV7 A;  2WBD A;  4GWU A;  1LEV A;  1NUW A;  4GWW A;  4PGN A;  1FPI A;  5EQ7 A;  2XXK A;  5T3J A;  2MKZ A;  4JVI A;  3ISP A;  1FRP A;  1YZ0 A;  2Q74 A;  2DE2 A;  2L5V A;  2VPO A;  2OX3 A;  4O94 A;  4PFI A;  1FBE A;  5ET8 A;  4GBV A;  4N81 A;  4MAG A;  4P47 A;  3GYY A;  4N8G A;  4NF0 A;  5J1D A;  4MX6 A;  5EYH A;  4H46 A;  3CHG A;  1CNQ A;  2QFL A;  1FBH A;  4LN5 A;  3U65 A;  1FJ6 A;  4NN3 A;  1KZ8 A;  2CZI A;  1DBZ A;  1IMC A;  4XFE A;  2XWO A;  4PFB A;  4G61 A;  2WBB A;  4PDD A;  3HFU A;  1YYZ A;  1IMB A;  1JP4 A;  1NV2 A;  4HXV A;  3BIH A;  1SPI A;  2Y5K A;  4N15 A;  2JJK A;  4PCD A;  2V3Q A;  4HE0 A;  2FVZ A;  3SZP A;  2FIE A;  1KA0 A;  1K9Z A;  2WX9 A;  5DW8 A;  4MNC A;  5ET5 A;  2XWI A;  1IMD A;  4HE1 A;  1FPG A;  4QBA A;  3IFC A;  1XI6 A;  5JK4 A;  5ET6 A;  5EYG A;  5J16 A;  3RPL B;  2F3D A;  5I5P A;  4NHB A;  1NV3 A;  4MMP A;  4JVD A;  4N17 A;  5F24 A;  1DCU A;  2KQZ A;  4F19 A;  1YXI A;  1D9Q A;  1FJ9 A;  2HPG A;  4P1E A;  1G0I A;  4N91 A;  3KC1 A;  4PAK A;  3RYD A;  3W9W A;  2DVZ A;  1LBY A;  2ZZW A;  3EKI A;  3MYU A;  2QVV A;  4PF6 A;  3T1B A;  3PTY A;  2FIX A;  1FPJ A;  2P3N A;  1QGX A;  1RDY A;  4NGU A;  4OVT A;  1VDW A;  4PFR A;  5IZZ A;  4YIC A;  4PAI A;  2FBP A;  4PBH A;  3E78 A;  2V4C A;  4KXP A;  2HZK A;  1IMF A;  2QVU A;  4P3L A;  4MNI A;  5ET7 A;  3QMF A;  4P1L A;  4O8M A;  1FPB A;  1NV5 A;  2CEX A;  4OVR A;  1FSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...