3RYGA

128 hours neutron structure of perdeuterated rubredoxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
51
structure length
51
Chain Sequence
AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Rapid visualization of hydrogen positions in protein neutron crystallographic structures.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Electron transport
total genus 9
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3rygA00
1T9PA 2VL6A 2GMGA 1LKMA 1IROA 4ME3A 1YK4A 5AI3A 2KN9A 2M4YA 1SMUA 1CAAA 2DSXA 1H7VA 1RDVA 1LKPA 1R0HA 4POGA 1B71A 1JYBA 2V3BB 2LCQA 1DVBA 5IY0A 1BQ8A 3KYVA 2MS3A 3KYYA 8RXNA 1R0GA 1BE7A 1BQ9A 3PZAA 5RXNA 1DX8A 1RWDA 3RZTA 2K2DA 1BRFA 4RXNA 2PYAA 3KYUA 3RZ6A 1IRNA 1RYTA 1LTLA 3A44A 2HR5A 1FHHA 1YK5A 1C09A 1CADA 1S30A 4POFA 3KYXA 4YWLA 1R0IA 4K9FA 1QCVA 1LKOA 2KKDA 1VCXA 2RDVA 5AI2A 3PWFA 1B2OA 1IU5A 1R0FA 4AR3A 1FHMA 3KYWA 1T9OA 1SMWA 1IU6A 1RB9A 4AR6A 4TPUA 1NNQA 1B13A 3SS2A 6RXNA 4AR4A 1R0JA 1B2JA 1BFYA 1YV1A 2PVXA 3RYGA 1S24A 1YUXA 1QYBA 2QL0A 1E8JA 3MPSA 1YUZA 7RXNA 1RDGA 1S2ZA 1T9QA 3QVDA 1ZRPA 1SMMA 4AR5A 2PVEA 4YWMA
chains in the Genus database with same CATH superfamily
2VL6A 1LKMA 4AYBP 5C4JL 4TVMA 4BBSL 4QIWP 5MLC3 1CAAA 1H7VA 5JVH1 1LKPA 4JAFA 4LHLA 4POGA 2V3BB 1I3QL 2LCQA 5GAGc 1BQ8A 1Y1VL 4LHNA 3KYVA 3P8BA 3KYYA 2APOB 2NYDA 2VUML 1BQ9A 4A3CL 4Y52L 1RWDA 2A69D 5M3FL 2RFKB 3HOWL 1R9TL 2PYAA 3H99A 2A6HD 3RZ6A 1IRNA 3RZOL 1C09A 1NXEA 1I6HL 4UY81 4YWLA 1VZHA 3H97A 4K9FA 1QCVA 5C44L 5FJ8L 2JI3A 2R7ZL 3S16L 4C3JL 4A3JL 4A3GL 4BY7L 1T9OA 3I4NL 2CKAA 1IU6A 4X6AL 4C3HL 4C2M1 3S1ML 4A3DL 3LNLA 4BBRL 1Z92B 3LWQB 3SS2A 4AR4A 4WFN1 2JA7L 3HKZP 3RYGA 3WWLA 3RZDL 3FDJA 1E8JA 3MPSA 4AI3A 2Z3RB 3S15L 1OWCA 4AI1A 4A3FL 3QVDA 2BE5D 4A3ML 1PFVA 2XJQA 4AR5A 3WWNB 4YWMA 3H0GL 1Y1WL 1T9PA 2GMGA 1IROA 1SFOL 5AI3A 1YK4A 5EINC 4A3BL 4Y7NL 4AHZA 2M4YA 1RDVA 5DM61 3GTKL 1QQTA 1R0HA 5M3ML 2NVYL 3LWOB 4AHYA 5IY0A 1F4LA 1WJVA 1TWHL 2R92L 2NVTL 3GTPL 5GAHc 3S17L 1PFUA 3B0AB 5MF6A 1BRFA 5DM71 3HOZL 2H12A 3KYUA 3LPEB 3P2AA 3HOVL 4C3IL 1VZIA 2M4VA 3KYXA 4BXXL 3MSUA 3GTLL 2Y0SP 1TWGL 1TWFL 3PL5A 3PWFA 5IP7L 2B5ID 2M6OA 3I4ML 3CQZL 1WCML 2JA6L 5IYDL 1SMWA 1RB9A 4JAGA 3K35A 6RXNA 3GTML 1B2JA 3HAXC 2XJRA 1BFYA 2JI1A 2PVXA 1S24A 1YUXA 3GTOL 2V0FA 5GAEc 7RXNA 1K83L 2ERJA 2PMZP 3HOYL 4A93L 2E2JL 4AHXA 2O5JD 5MFPA 3HJYB 1SMMA 2PVEA 4GS7D 4AI0A 2JI2A 3J7Z1 3MQKB 2PSMC 2V0EA 2AYJA 5M5WL 2CR8A 1JYBA 1TWAL 2M6PA 4BY1L 1DVBA 4AI2A 3VPBE 8RXNA 2C6BA 5MFZA 3S14L 3PZAA 5EIOC 3PO3L 1RYQA 5RXNA 1DX8A 5H1Sc 4A3KL 3B08B 3RZTA 4RXNA 2E2HL 2J9UB 1ODHA 1RYTA 3JR7A 3GTGL 2HR5A 1S30A 4POFA 1P7PA 5AN9H 1LKOA 1NXGA 1VCXA 5AI2A 3HOUL 3LWVB 2AUSB 4AR3A 1FHMA 4V196 2B63L 2R93L 3HOXL 4AR6A 4A3EL 1I50L 4TPUA 2JA5L 1NNQA 3H9BA 3QQCE 2ZIXA 3S1RL 4JADA 3GTQL 1YUZA 3PIO1 2C6AA 2JA8L 5M5YL 4XGHA 3LWPB 1VZGA 1PFYA 1RDGA 1S2ZA 3PO2L 3LWRB 1ZRPA 3ZG6A 5IYBL 3S2DL 5FLML 4ME3A 5K2ME 2KN9A 5MGNA 2XJVA 3PKIA 1SMUA 2DSXA 4U671 4A3LL 3PIP1 1OWBA 4E6YA 1B71A 2NVQL 3M4OL 2AQCA 2MS3A 2HVYC 3IU3I 5C4XL 1R0GA 4ZN1B 1BE7A 3GTJL 3S1QL 1TWCL 5IYCL 2E2IL 1IW7D 1PZXA 2K2DA 3S1NL 3HJWB 4G6BA 2A6ED 1LTLA 3A44A 1FHHA 1YK5A 1CADA 2XJSA 2WAQP 4XXBB 1R0IA 5IP9L 2KKDA 4ZN3B 2RDVA 5C3EL 4B8CD 5M5XL 3NFPI 1B2OA 1IU5A 1R0FA 1PFWA 3K7AL 3KYWA 3PKJA 4AHWA 2PPTA 3J7Y1 2L0ZA 2A68D 3S2HL 2Z3QB 1B13A 3M3YL 1R0JA 2EY4E 3H9CA 1YV1A 2YU9L 4JAEA 3FKIL 1QYBA 2WB1P 2QL0A 2CKCA 5JVG1 2ERSA 2NVXL 4A3IL 1T9QA 3H3VM 2XJPA 2XJTA 2XJUA 5GADc
chains in the Genus database with same CATH topology
4AI0A 1T9PA 2VL6A 2GMGA 1LKMA 1IROA 2JI2A 3J7Z1 4ME3A 1YK4A 5AI3A 5EINC 5K2ME 2PSMC 2KN9A 5MGNA 4TVMA 2XJVA 4AHZA 2V0EA 3PKIA 2M4YA 1SMUA 5MLC3 1CAAA 2AYJA 2DSXA 4U671 1H7VA 1RDVA 5DM61 3PIP1 1OWBA 5JVH1 4YWMA 2CR8A 1LKPA 1R0HA 4JAFA 4LHLA 1B71A 4E6YA 1JYBA 2V3BB 4POGA 2M6PA 4AHYA 2LCQA 5GAGc 1DVBA 5IY0A 1BQ8A 4LHNA 1WJVA 3KYVA 3P8BA 3VPBE 2MS3A 3KYYA 4AI2A 8RXNA 3IU3I 2NYDA 2C6BA 1R0GA 4ZN1B 1BE7A 1BQ9A 5MFZA 3PZAA 5EIOC 1RYQA 5RXNA 1DX8A 1RWDA 2A69D 5H1Sc 1IW7D 3B08B 3RZTA 5GAHc 2K2DA 3B0AB 5MF6A 1BRFA 4RXNA 5DM71 2H12A 2PYAA 3KYUA 3LPEB 3P2AA 4G6BA 2J9UB 1ODHA 2A6HD 2A6ED 3RZ6A 1IRNA 1RYTA 1LTLA 3A44A 1VZIA 2HR5A 1FHHA 1YK5A 1C09A 1CADA 1S30A 2XJSA 1NXEA 2M4VA 4POFA 4UY81 3KYXA 4YWLA 3MSUA 4XXBB 1R0IA 1VZHA 4K9FA 5AN9H 1QCVA 1LKOA 2KKDA 2JI3A 1NXGA 1VCXA 2RDVA 4ZN3B 5AI2A 3PWFA 4B8CD 3NFPI 2B5ID 1B2OA 1IU5A 2M6OA 1R0FA 4AR3A 1FHMA 3KYWA 3PKJA 4V196 4AHWA 1T9OA 2PPTA 1SMWA 2CKAA 3J7Y1 2L0ZA 2A68D 1IU6A 1RB9A 4AR6A 4TPUA 1NNQA 3LNLA 4JAGA 1Z92B 2Z3QB 1B13A 3K35A 3SS2A 6RXNA 4AR4A 1R0JA 4WFN1 3QQCE 1B2JA 2XJRA 1BFYA 2JI1A 1YV1A 2PVXA 3RYGA 3WWLA 1S24A 1YUXA 4JAEA 2ZIXA 4JADA 2V0FA 1QYBA 2QL0A 1E8JA 3MPSA 2CKCA 1YUZA 5GAEc 7RXNA 3PIO1 2ERJA 5JVG1 2C6AA 2ERSA 4XGHA 1VZGA 4AI3A 2Z3RB 1RDGA 1S2ZA 1T9QA 1OWCA 4AI1A 3QVDA 2BE5D 1ZRPA 2XJPA 4AHXA 2XJTA 2O5JD 5MFPA 2XJUA 2XJQA 1SMMA 4AR5A 3WWNB 2PVEA 5GADc 4GS7D 3ZG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T9P A;  2VL6 A;  2GMG A;  1LKM A;  1IRO A;  4ME3 A;  1YK4 A;  5AI3 A;  2KN9 A;  2M4Y A;  1SMU A;  1CAA A;  2DSX A;  1H7V A;  1RDV A;  1LKP A;  1R0H A;  4POG A;  1B71 A;  1JYB A;  2V3B B;  2LCQ A;  1DVB A;  5IY0 A;  1BQ8 A;  3KYV A;  2MS3 A;  3KYY A;  8RXN A;  1R0G A;  1BE7 A;  1BQ9 A;  3PZA A;  5RXN A;  1DX8 A;  1RWD A;  3RZT A;  2K2D A;  1BRF A;  4RXN A;  2PYA A;  3KYU A;  3RZ6 A;  1IRN A;  1RYT A;  1LTL A;  3A44 A;  2HR5 A;  1FHH A;  1YK5 A;  1C09 A;  1CAD A;  1S30 A;  4POF A;  3KYX A;  4YWL A;  1R0I A;  4K9F A;  1QCV A;  1LKO A;  2KKD A;  1VCX A;  2RDV A;  5AI2 A;  3PWF A;  1B2O A;  1IU5 A;  1R0F A;  4AR3 A;  1FHM A;  3KYW A;  1T9O A;  1SMW A;  1IU6 A;  1RB9 A;  4AR6 A;  4TPU A;  1NNQ A;  1B13 A;  3SS2 A;  6RXN A;  4AR4 A;  1R0J A;  1B2J A;  1BFY A;  1YV1 A;  2PVX A;  3RYG A;  1S24 A;  1YUX A;  1QYB A;  2QL0 A;  1E8J A;  3MPS A;  1YUZ A;  7RXN A;  1RDG A;  1S2Z A;  1T9Q A;  3QVD A;  1ZRP A;  1SMM A;  4AR5 A;  2PVE A;  4YWM A; 
#chains in the Genus database with same CATH topology
 2VL6 A;  1LKM A;  4AYB P;  5C4J L;  4TVM A;  4BBS L;  4QIW P;  5MLC 3;  1CAA A;  1H7V A;  5JVH 1;  1LKP A;  4JAF A;  4LHL A;  4POG A;  2V3B B;  1I3Q L;  2LCQ A;  5GAG c;  1BQ8 A;  1Y1V L;  4LHN A;  3KYV A;  3P8B A;  3KYY A;  2APO B;  2NYD A;  2VUM L;  1BQ9 A;  4A3C L;  4Y52 L;  1RWD A;  2A69 D;  5M3F L;  2RFK B;  3HOW L;  1R9T L;  2PYA A;  3H99 A;  2A6H D;  3RZ6 A;  1IRN A;  3RZO L;  1C09 A;  1NXE A;  1I6H L;  4UY8 1;  4YWL A;  1VZH A;  3H97 A;  4K9F A;  1QCV A;  5C44 L;  5FJ8 L;  2JI3 A;  2R7Z L;  3S16 L;  4C3J L;  4A3J L;  4A3G L;  4BY7 L;  1T9O A;  3I4N L;  2CKA A;  1IU6 A;  4X6A L;  4C3H L;  4C2M 1;  3S1M L;  4A3D L;  3LNL A;  4BBR L;  1Z92 B;  3LWQ B;  3SS2 A;  4AR4 A;  4WFN 1;  2JA7 L;  3HKZ P;  3RYG A;  3WWL A;  3RZD L;  3FDJ A;  1E8J A;  3MPS A;  4AI3 A;  2Z3R B;  3S15 L;  1OWC A;  4AI1 A;  4A3F L;  3QVD A;  2BE5 D;  4A3M L;  1PFV A;  2XJQ A;  4AR5 A;  3WWN B;  4YWM A;  3H0G L;  1Y1W L;  1T9P A;  2GMG A;  1IRO A;  1SFO L;  5AI3 A;  1YK4 A;  5EIN C;  4A3B L;  4Y7N L;  4AHZ A;  2M4Y A;  1RDV A;  5DM6 1;  3GTK L;  1QQT A;  1R0H A;  5M3M L;  2NVY L;  3LWO B;  4AHY A;  5IY0 A;  1F4L A;  1WJV A;  1TWH L;  2R92 L;  2NVT L;  3GTP L;  5GAH c;  3S17 L;  1PFU A;  3B0A B;  5MF6 A;  1BRF A;  5DM7 1;  3HOZ L;  2H12 A;  3KYU A;  3LPE B;  3P2A A;  3HOV L;  4C3I L;  1VZI A;  2M4V A;  3KYX A;  4BXX L;  3MSU A;  3GTL L;  2Y0S P;  1TWG L;  1TWF L;  3PL5 A;  3PWF A;  5IP7 L;  2B5I D;  2M6O A;  3I4M L;  3CQZ L;  1WCM L;  2JA6 L;  5IYD L;  1SMW A;  1RB9 A;  4JAG A;  3K35 A;  6RXN A;  3GTM L;  1B2J A;  3HAX C;  2XJR A;  1BFY A;  2JI1 A;  2PVX A;  1S24 A;  1YUX A;  3GTO L;  2V0F A;  5GAE c;  7RXN A;  1K83 L;  2ERJ A;  2PMZ P;  3HOY L;  4A93 L;  2E2J L;  4AHX A;  2O5J D;  5MFP A;  3HJY B;  1SMM A;  2PVE A;  4GS7 D;  4AI0 A;  2JI2 A;  3J7Z 1;  3MQK B;  2PSM C;  2V0E A;  2AYJ A;  5M5W L;  2CR8 A;  1JYB A;  1TWA L;  2M6P A;  4BY1 L;  1DVB A;  4AI2 A;  3VPB E;  8RXN A;  2C6B A;  5MFZ A;  3S14 L;  3PZA A;  5EIO C;  3PO3 L;  1RYQ A;  5RXN A;  1DX8 A;  5H1S c;  4A3K L;  3B08 B;  3RZT A;  4RXN A;  2E2H L;  2J9U B;  1ODH A;  1RYT A;  3JR7 A;  3GTG L;  2HR5 A;  1S30 A;  4POF A;  1P7P A;  5AN9 H;  1LKO A;  1NXG A;  1VCX A;  5AI2 A;  3HOU L;  3LWV B;  2AUS B;  4AR3 A;  1FHM A;  4V19 6;  2B63 L;  2R93 L;  3HOX L;  4AR6 A;  4A3E L;  1I50 L;  4TPU A;  2JA5 L;  1NNQ A;  3H9B A;  3QQC E;  2ZIX A;  3S1R L;  4JAD A;  3GTQ L;  1YUZ A;  3PIO 1;  2C6A A;  2JA8 L;  5M5Y L;  4XGH A;  3LWP B;  1VZG A;  1PFY A;  1RDG A;  1S2Z A;  3PO2 L;  3LWR B;  1ZRP A;  3ZG6 A;  5IYB L;  3S2D L;  5FLM L;  4ME3 A;  5K2M E;  2KN9 A;  5MGN A;  2XJV A;  3PKI A;  1SMU A;  2DSX A;  4U67 1;  4A3L L;  3PIP 1;  1OWB A;  4E6Y A;  1B71 A;  2NVQ L;  3M4O L;  2AQC A;  2MS3 A;  2HVY C;  3IU3 I;  5C4X L;  1R0G A;  4ZN1 B;  1BE7 A;  3GTJ L;  3S1Q L;  1TWC L;  5IYC L;  2E2I L;  1IW7 D;  1PZX A;  2K2D A;  3S1N L;  3HJW B;  4G6B A;  2A6E D;  1LTL A;  3A44 A;  1FHH A;  1YK5 A;  1CAD A;  2XJS A;  2WAQ P;  4XXB B;  1R0I A;  5IP9 L;  2KKD A;  4ZN3 B;  2RDV A;  5C3E L;  4B8C D;  5M5X L;  3NFP I;  1B2O A;  1IU5 A;  1R0F A;  1PFW A;  3K7A L;  3KYW A;  3PKJ A;  4AHW A;  2PPT A;  3J7Y 1;  2L0Z A;  2A68 D;  3S2H L;  2Z3Q B;  1B13 A;  3M3Y L;  1R0J A;  2EY4 E;  3H9C A;  1YV1 A;  2YU9 L;  4JAE A;  3FKI L;  1QYB A;  2WB1 P;  2QL0 A;  2CKC A;  5JVG 1;  2ERS A;  2NVX L;  4A3I L;  1T9Q A;  3H3V M;  2XJP A;  2XJT A;  2XJU A;  5GAD c; 
#chains in the Genus database with same CATH homology
 4AI0 A;  1T9P A;  2VL6 A;  2GMG A;  1LKM A;  1IRO A;  2JI2 A;  3J7Z 1;  4ME3 A;  1YK4 A;  5AI3 A;  5EIN C;  5K2M E;  2PSM C;  2KN9 A;  5MGN A;  4TVM A;  2XJV A;  4AHZ A;  2V0E A;  3PKI A;  2M4Y A;  1SMU A;  5MLC 3;  1CAA A;  2AYJ A;  2DSX A;  4U67 1;  1H7V A;  1RDV A;  5DM6 1;  3PIP 1;  1OWB A;  5JVH 1;  4YWM A;  2CR8 A;  1LKP A;  1R0H A;  4JAF A;  4LHL A;  1B71 A;  4E6Y A;  1JYB A;  2V3B B;  4POG A;  2M6P A;  4AHY A;  2LCQ A;  5GAG c;  1DVB A;  5IY0 A;  1BQ8 A;  4LHN A;  1WJV A;  3KYV A;  3P8B A;  3VPB E;  2MS3 A;  3KYY A;  4AI2 A;  8RXN A;  3IU3 I;  2NYD A;  2C6B A;  1R0G A;  4ZN1 B;  1BE7 A;  1BQ9 A;  5MFZ A;  3PZA A;  5EIO C;  1RYQ A;  5RXN A;  1DX8 A;  1RWD A;  2A69 D;  5H1S c;  1IW7 D;  3B08 B;  3RZT A;  5GAH c;  2K2D A;  3B0A B;  5MF6 A;  1BRF A;  4RXN A;  5DM7 1;  2H12 A;  2PYA A;  3KYU A;  3LPE B;  3P2A A;  4G6B A;  2J9U B;  1ODH A;  2A6H D;  2A6E D;  3RZ6 A;  1IRN A;  1RYT A;  1LTL A;  3A44 A;  1VZI A;  2HR5 A;  1FHH A;  1YK5 A;  1C09 A;  1CAD A;  1S30 A;  2XJS A;  1NXE A;  2M4V A;  4POF A;  4UY8 1;  3KYX A;  4YWL A;  3MSU A;  4XXB B;  1R0I A;  1VZH A;  4K9F A;  5AN9 H;  1QCV A;  1LKO A;  2KKD A;  2JI3 A;  1NXG A;  1VCX A;  2RDV A;  4ZN3 B;  5AI2 A;  3PWF A;  4B8C D;  3NFP I;  2B5I D;  1B2O A;  1IU5 A;  2M6O A;  1R0F A;  4AR3 A;  1FHM A;  3KYW A;  3PKJ A;  4V19 6;  4AHW A;  1T9O A;  2PPT A;  1SMW A;  2CKA A;  3J7Y 1;  2L0Z A;  2A68 D;  1IU6 A;  1RB9 A;  4AR6 A;  4TPU A;  1NNQ A;  3LNL A;  4JAG A;  1Z92 B;  2Z3Q B;  1B13 A;  3K35 A;  3SS2 A;  6RXN A;  4AR4 A;  1R0J A;  4WFN 1;  3QQC E;  1B2J A;  2XJR A;  1BFY A;  2JI1 A;  1YV1 A;  2PVX A;  3RYG A;  3WWL A;  1S24 A;  1YUX A;  4JAE A;  2ZIX A;  4JAD A;  2V0F A;  1QYB A;  2QL0 A;  1E8J A;  3MPS A;  2CKC A;  1YUZ A;  5GAE c;  7RXN A;  3PIO 1;  2ERJ A;  5JVG 1;  2C6A A;  2ERS A;  4XGH A;  1VZG A;  4AI3 A;  2Z3R B;  1RDG A;  1S2Z A;  1T9Q A;  1OWC A;  4AI1 A;  3QVD A;  2BE5 D;  1ZRP A;  2XJP A;  4AHX A;  2XJT A;  2O5J D;  5MFP A;  2XJU A;  2XJQ A;  1SMM A;  4AR5 A;  3WWN B;  2PVE A;  5GAD c;  4GS7 D;  3ZG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...