3RYMA

Structure of oxidized m98k mutant of amicyanin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFKRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Replacement of the axial copper ligand methionine with lysine in amicyanin converts it to a zinc-binding protein that no longer binds copper.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 24
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3rymA00
3AG2B 1KGYE 2XX1A 3T9WA 5ANHA 3NJMA 2J5WA 3X1BA 4EF3A 3FQ1A 3FQ2A 3CDZA 3FSWA 3ERXA 1MDAA 3X1FA 3WI9A 1V10A 2HRHA 1KV7A 3NJJA 5TK4A 5I26A 4E9TA 4KOCA 2B08A 2PP9A 1BQ5A 1A4CA 1JZHA 1IKOP 1A3ZA 4QLWA 1CYXA 2PLTA 2H47C 2Q9OA 1QNIA 4KNTA 2UX6A 4ZK8A 2J56A 2P80D 3N55A 3CZUB 1JXFA 1OCCB 2PPFA 4YSQA 4TXVB 2YXVA 4YSSA 3FPYA 2W8CA 1NIAA 4KO5A 2CALA 1PLAA 2HXAA 3NSDA 2DV6A 5LDUA 4JKNA 2AZAA 2A3TA 2DYSB 5D4JA 4DP6X 1KBWA 1L9QA 4A67A 1WA0X 1F56A 3IE9A 1ZV2A 1WAEA 3OQRA 2AZUA 1PY0A 3ZX1A 4L0PB 5B1JC 1GY1A 2LLNA 3KW7A 3TASA 1XB8A 1GS7A 3QQXA 4HCIA 2E86A 1AS7A 3OMAB 4WKXA 2IDFA 3UACA 4A2GA 1BYOA 4AX3A 2XX0A 1ET5A 1NWOA 3CVDA 1X9RA 1E5YA 4G70B 1OE3A 2VSKB 1AANA 3QJQB 1EHKB 1ET7A 3WIAA 1A4BA 5B7FA 1JZEA 1ZDSA 1N70A 2XVBA 4ENZA 1L9SA 4GP5B 4YSTA 3TU6A 1AQ8A 4AI7A 3NYKA 3FYIB 4G7SB 5B1AB 2IWFA 2YAMA 4KNUA 3OMNB 4A2EA 3T6VA 3IN0A 5F7AA 1AIZA 2YAHA 3ABMB 1AOZA 2EIMB 1SFHA 2BZ7A 2OJ1A 1A8ZA 1MG2C 3PLYA 2HX7A 4BK5C 1AZCA 1A4AA 5AZUA 1DZ0A 1J5CA 1R1CA 2IDTA 2IWKA 5I6NA 1B3IA 3G5WA 1OE2A 2IAAC 3EH4B 3X2QB 2UXGA 2VMJA 3PCYA 3ASNB 1AZNA 1IUZA 1EZLA 5I6KA 4YSCA 4YSRA 1ADWA 2XUWA 1ZIBA 1BQRA 3QJTB 1JOIA 5E9NA 3S3BB 3FPXA 3QPKA 2YQBA 2GIMA 4KNSA 1ET8A 2EILB 2R7EA 3TA4D 3WKPA 1JERA 2UXVA 3GDCA 4FA7B 2CCWA 2YAPA 2PCYA 3NP3A 4Q89A 2BP0B 2W88A 2H3XC 2ZONA 3IEAA 3MBWB 2BWDA 2UXTA 2YAQA 1GYCA 3S8FB 3FQYA 8PAZA 2PPDA 3PPSA 1NTDA 4UANA 3JT2A 4BDVB 5I6MA 3WG7B 2FNWA 1W6LA 3EF4A 2PP8A 3QJRB 1XB6A 2IDUA 4X4KA 4W1TA 1TKWA 1PZBA 1NPJA 2IWEA 2FT6A 3V9EA 3AY2A 1XMEB 5AFAA 2FJSA 3QJSB 1JZJA 1NWPA 4CSZA 2YAOA 1JVLA 3MX0B 3T6WA 2AVFA 1GR7A 4YSDA 3DKHA 2XU9A 3NSYA 4YVNA 1AACA 1VLXA 2VN3A 9PCYA 4DP1X 2MRYA 1NINA 2UXFA 1E5ZA 4BWWA 3DTUB 1L9OA 1NZRA 3AW5A 3X1GA 2BW5A 1SHWA 2FWLB 6PCYA 2VW6A 2HX9A 3D12B 2PP7A 4JHUA 1JXDA 2ZXWB 1RCYA 1HAWA 6PAZA 4HALA 4HHGA 2HZHA 1E30A 3L45A 3QJUB 1GS8A 3U25A 4N8UA 1GW0A 2XXGA 3PAVA 4RH4A 4YVUA 1V55B 1HFUA 1OE1A 3CVCA 1CYWA 4HHWA 3UGEA 2ZWNA 1WS7A 2H5UA 1OV8A 1AZUA 2XV2A 1PF3A 2J55A 1RZQA 2B3IA 3WNIA 2J57A 4AZUA 4HCGA 3ABGA 4DP4X 1HAUA 2VM4A 2JKWA 3FSZA 4DP7X 4KO6A 4JHVA 4PCYA 1NIFA 3TBCA 3ZIYA 1PLCA 1UATA 4W9ZA 2JFCA 2DY2A 3SBQA 5I6OA 2BP8B 4NB7A 4BWUA 1I53A 3FU9A 1SJMA 1JZFA 4A2FA 1CC3A 3NJLA 2HRGA 3X1NA 2PCFA 7PCYA 4DPBX 1M56B 1ZDQA 4AKOA 1OCOB 1NIDA 5I5IA 2BZCA 2BWIA 2I7OA 1TEGA 2Q5BA 1KCBA 2QDWA 3OM3B 2EIKB 4QKTA 1AR1B 3NJFA 5PCYA 2WSDA 4DP5X 2HLEB 1JZGA 2IDSA 5B3SB 3FS9A 1CUOA 4DP9X 3NJGA 2GI0A 2PPAA 3AG4B 1DYZA 1E65A 1GY2A 1FFTB 2GC4C 2XWZA 3CDZB 3WKQA 2FT8A 3NJKA 3FU8A 1BEXA 1BXAA 2FT7A 2VW7A 3NJNA 1ILSA 2FQFA 3H4HA 2EIJB 4KOBA 1PLBA 1ETJA 3PAUA 3EHBB 1WA2X 3FYEB 2TSBA 4E9QA 1OCZB 2ZOOA 4P5RA 1AG0A 2VM3A 4DPAX 1SFDA 1PNDA 1AG6A 2QT6A 5B7EA 1BQKA 2DYRB 1PZAA 2P80A 3UABA 2FQDA 2XYBA 4HZ1A 2Y69B 2OV0A 5I5JA 4YL4A 3T6XA 4AKQA 3UAAA 2IH9A 4NAJA 2JXMA 1KCWA 1CURA 1M9WA 3ASOB 4E9YA 1NDTA 1AZBA 1QLEB 4BXVA 3C75A 5D4IA 1OCRB 2UX7A 2BW4A 1BXUA 1E67A 1BYPA 4NERA 1PMYA 2GC7C 1KDJA 3UAEA 1BXVA 3RYMA 3PXLA 1NPNA 1AS6A 3OMIB 3GYRA 5D4HA 4A2HA 3BVDB 4UF7C 3V9CA 4BWTA 2DWSA 2TSAA 1JZIA 1RZPA 4F2FA 5B7MA 4G7RB 2RACA 3KW8A 3FSVA 4CSPA 4E9XA 5B1BB 3TBBA 1URIA 3HB3B 5I28A 1MZZA 1GS6X 1T5KA 3S3DB 5A7EA 2WO3B 1ILUA 1MG3C 2NRDA 2YAEA 2DWTA 3DIVA 3NT0A 4KO9A 1IBZA 2FQEA 1KYAA 2CJ3A 4E9SA 2YARA 1WS8A 3EH3B 1PZCA 2X88A 1MZYA 2YAFA 3CG8A 4A68A 5I5MA 1J9SA 1L9PA 1V54B 5I6LA 1JVOA 4DP8X 1ZIAA 4M4RB 4YSUA 4WTQA 3AZUA 7PAZA 2QPEB 1OF0A 1XB3A 2WO2B 3SBPA 4BXSV 1KDIA 1L9RA 1M57B 1IC0A 2MTAA 1J9QA 1ZPUA 3CVBA 4G7QB 2XXFA 4F2EA 3S3CB 3BQVA 3NP4A 1ASPA 2GBAA 1N68A 3NJIA 4YSOA 2CBPA 3ABKB 3NJHA 4YSPA 1JXGA 2QDVA 4MFHA 4FAAB 2VSMB 1FA4A 3NSFA 3IBOA 1X9UA 3H4FA 2XLLA 3T6ZA 2IDQA 1J9RA 5AKRA 5IY5B 1YLBB 4GXFA 4HCFA 4A66A 1WA1X 4GY4A 5F7BA 5FC9A 2XV0A 3EH5B 2XV3A 4AKPA 1AS8A 2N0MA 5EHFA 2BP0A 3ABLB 5I6PA 3JTBA 3H56A 3AG3B 3NSCA 2I85A 4YSAA 1NICA 1PCSA 2CUAA 1ID2A 3FU7B 4M3HA 4GP4B 3ZBMA 2EINB 3PAZA 1SDDA 1W6WA 2GSMB 2PPCA 3SQRA 1NIEA 2QPDB 5B1KA 3FSAA 1AZRA 2FQGA 1W8EA 2I7SA 2OCCB 1SHXA 4E9WA 2IH8A 4PAZA 3OD3A 2GHZA 1FWXA 4GYBA 3N2JA 4DP2X 4A2DA 4G71B 3UADA 2GB2A 5B1JA 1NIBA 5TK2A 1AAJA 4F7KA 1SF5A 2BHFA 2X87A 3GXUB 2AFNA 2Y1AA 1A65A 1GSKA 2FTAA 4GP8B 4P5SA 3ZDWA 1ASQA 1TU2A 3AG1B 2CAKA 4G72B 4BDVA 1PNCA 4HIPA 2R7EB 2AANA 4DP0X 1BAWA 1IBYA 2BO0A 4K9JA 4KO7A 4E9VA 3QJVB 1J9TA 1TEFA 1RKRA 1KBVA 4UAHA 4E9RA 4YSEA 3S8GB 3FU7A 3WNJA 1SF3A 1OOWA 2BP8A 1PAZA 1L9TA 1J5DA 4N4YB 3X1EA 2HX8A 3IN2A 3FT0A 4HAKA 3SBRA 2YXWA 3HEIB 2PPEA 5PAZA 3T71A 1SNRA 2VW4A 1QHQA 1SDDB 4DPCX 4Q8BA 1ASOA
chains in the Genus database with same CATH superfamily
3P2TA 3VFPB 2XX1A 1J1PH 4N0YH 2FEEL 4PWFA 1FFNB 1F0LA 3LRSB 4K3GA 3RGVC 1U95A 2SEBA 1DJGA 2QSCL 2ADFH 3I9GH 1BD2B 4XVSL 2CLZA 4MMYB 4Y5XC 3CFCH 4D9LH 2Q10A 5LGYA 5CR8A 4JPIB 4H4NA 3QUML 3WIFB 1RUML 1G0YR 25C8L 4I5BA 4G8GE 4JO3L 1FBIH 3TO4A 5I1IL 2R4RL 3V0AC 1S9XB 1TLKA 4FNLL 1T2XA 4YO0A 2R15A 3DYPA 3NA9L 2HFEB 2NXZB 4J3BA 1EHLH 1ZK5A 2NY7L 1TSHA 3GLAA 1YNTA 1JXFA 5TDOB 4HUUA 4IGBA 4JR9H 4XXCC 2EC9U 5CEYB 1TQUA 2BCKA 1F2XK 1OWRM 3UTQA 2QZQA 3DO3A 5EH1A 2QR0A 4UI2A 4LQ1A 4FNLH 2BWQA 3DPBA 2DLHA 5AB2A 4LEOA 3U0WH 3GJFA 4AH2B 2LLLA 3BGFB 5FUZL 3EOYG 3GBML 1CIUA 4IEFB 1SBBA 4WHCA 3D05A 1WAEA 5LGKA 3I9GL 1RJZB 2YC1B 1BZ7A 4UTCA 3CZGA 2F58L 2EDLA 3U9WA 3V6ZB 3F12B 4LCCC 4NNXB 1GS7A 1A5FH 3IGAB 5GPRA 3V5KB 2RGSA 3T1FA 3S37H 1KTKE 3UEQA 4KV5E 2QGCA 1RXLA 2NXYD 1PZ5A 2PYEB 1FFQA 1FO0H 1U95B 1QG3A 2NZ1A 1OSEA 4W68A 2BDNH 5GGRB 1CFNA 1GAFH 1YPZB 2VSKB 2WM0A 1S46A 2A9ML 1AANA 3E7JA 2Z7ZA 1MJJA 3CMOL 4S1DD 4Z7OB 5IK3A 3ZE0B 1QMUA 1X4ZA 3RB7A 1FCGA 5L9DH 2N56A 3OZ9H 3HI6L 3H9HA 1UZ6E 5E2VH 1F5WA 1EO8H 2WCGA 1NAML 4JFDD 3TBYB 1N8ZB 4E41B 4TSBH 4HUWB 3IGUA 2ALAA 2QADC 4GBXB 3BOVA 3NACL 3PL6A 1EGJL 5T1DH 3W9DA 4GIPD 3T0EE 3X13B 4MNHB 3WSQH 4B3EA 2IH1A 3WEXA 2MCMA 4KXZI 5ICZA 5ICYB 3GJFB 1A9VA 1L0XA 2VZTA 3GRWA 4MNQA 3GHPA 4R26H 1QP1A 2DJMA 4MQXC 4Y19E 5AZUA 1JRHL 3TPUB 4Y2DC 5AG9A 5BRZB 1J5CA 1KULA 5CFHA 2OYLA 1JHKH 5H2BA 5I1EL 3BD4A 4Y1AD 4F1ZA 4XP5L 4TUJA 4YBLC 2Y3NA 2O6EA 2G3MA 3MGTA 5KSAB 4MTMA 2VKWA 4IW4C 4KTEL 5C0JA 1EZLA 3HG1A 2E27L 2RQ8A 3P1VA 3ES6B 1ADWA 4X5RA 2D9CA 1HNYA 2YFOA 2DIAA 3IKKA 3MXWL 4HCRH 1WQVT 2F7RA 3VDCA 5IB3A 1XF1A 4PBXA 2XWBA 2NY5C 4X42A 2CCWA 4L37B 4LPCA 1RPKA 2PCYA 3FFOA 4BZ2A 3KD4A 2BP0B 2ZAIA 5C08E 3MCLH 3TO2B 4F57H 5C8JA 4FP8L 2WYZA 2YAQA 1GYCA 4N9GB 2P5EA 2FBOJ 4HC1L 4UTBL 1WH0A 5C09E 3CVHB 4O5LL 2AEWA 1MVUB 2E47A 4P4RA 1VFUA 3HR6A 3WG7B 3ZE1E 2LLGA 4X4KA 2A99A 4RWHA 5JHBA 2IG2L 1LM8V 2ESVA 4Y5YB 5IZ7A 2YUWA 3AY2A 1WAAF 5LVEA 3TBSA 3TV3L 3QJSB 4CC4C 1Q9LB 2J4WH 1XXDC 3TLRA 4ZW7A 4U1JA 1FCCA 4Y5YC 3MX0B 4BUGA 4EQ2A 3VTAA 4NO5B 1FYHB 1I7TA 4HULB 4YPGA 1UM4L 3N9GH 4PJ8B 4R2GC 1QSFA 3WTVA 1MUJB 4M6ML 3B1UA 4P46B 3HJEA 4YUEH 4NKIH 1IGFL 2UWEF 3AACA 3V4PA 2UXFA 5E6ID 4Z7UA 5H35B 1X5FA 3NPSC 3TC9A 4BWWA 2WOBA 1YEDA 2CUIA 1Z3RA 4OIFA 5I0DA 2PNDA 3N50A 5TE6L 2BSEA 1MXGA 3ZRFC 3DBXA 4HHGA 3LB6D 3I2CH 5DO8A 4GSUA 4OGYH 3SKNB 1AD0B 2R27A 3P4OB 4IRJA 2CDFB 2OMVA 4Z7VF 3UTTA 3WUWB 4R7XA 4GQZA 5I1AB 35C8H 3ZMRA 4LK4A 1HFUA 1SLUA 5BV7C 1BVOA 4IHOB 3O11A 1UWEH 2ZWNA 1FG9C 1GGCH 4G8EA 4GXUM 2YPLE 3CPUA 2J8HA 2P24B 2YEVB 4MHHG 5DS2A 3ZZ1A 1OEZW 1Z9MA 4JQXA 5CN3A 1AGDB 2IJ0C 1HAUA 2VMFA 3FOLB 4YDIH 4MQ7A 3KM2A 5ISZA 4GRMA 4PJ5D 1FGNH 1UASA 1P1ZB 1MCSA 5AW8B 3HZMA 5A3ID 4NAMA 5FKAB 5CCKL 3WENA 1G87A 3DTXB 2CQVA 5C09B 2AV1A 4NQDA 4YLQT 3ZIYA 4ZTPL 2NQCA 2EYRB 2A38A 2WBJC 3L6FB 2EO1A 1M9SA 3GHEH 4FXKB 1E9QB 1XF4B 2H4EA 3H9SA 1FNSH 4NB7A 1BVKB 1X4XA 3H0TA 4QRTB 3WNNA 1CLVA 1WIPA 3TBVB 1EDQA 3DYMA 4FXKC 4XBGA 2EECA 1I3VA 2FBJL 4MD5A 4N20A 3TO4C 2XXMB 4TTGA 2YLHA 1YNLH 1C1EL 3EOAB 3OGCA 5MEOA 1KYUA 3ULUH 4LRIC 1OGAD 2BWIA 4KITB 1QASA 3E3QE 4L9LB 4UCFA 1N19A 4LP8A 1PSKH 4Z0BL 2VDOH 5SX4H 5I71B 5D2LF 1MOEA 2OMWA 3KYNB 4APQC 4U7KA 3DRTA 1GY2A 4OM1L 2VXQL 3BYTA 3B5HA 2WZ5A 3WKQA 1KEGH 3NJKA 2X2IA 2VW7A 3GNMH 2FHCA 3H4HA 3MLZL 5EUOA 3EHBB 3SDCD 1ZTXE 3FTXA 1EQWA 5E2UH 3O6FA 1UENA 1BEYH 3ECWA 1UKSA 3QDJB 3C2AL 2J5LB 1OAKH 1EAPA 4Z3TA 2OMYA 1R5IB 1R6VA 1XH0A 2IPTH 1FZOA 2DIEA 4J2XA 4AYMC 2OMZA 1ZLWH 4XNDA 5HHVH 4O2FB 3SDXE 5K9QG 3C8HA 4LCYB 4M00A 2X6BA 5ES4B 2VRAA 3MYZA 1VCBC 3BDXA 3QEGL 3MLUH 1A6PA 2WBJB 1V27A 2V5YA 1BBDH 1CN4A 1MREL 1ZANL 5E56A 3HI1B 4B96A 4MD4B 4XP4L 4NBYB 5FYLE 4FQHB 4P3DA 4P2YA 1NCGA 3QFDA 4FQCL 4PUBH 4K94L 4XHJD 4Y4FA 1WZKA 4BFNA 1FNFA 4G9DA 4OZIA 1ZLVH 4O02L 4XP6H 5C0NC 2IBGA 3KVDD 5IEHB 3WEMA 4MWFB 3RRQA 1NFKA 4B9PA 1IQWL 4NUGL 2PF6A 2ZCKL 3P4MA 3GJFK 1CICB 3FN0L 1AHMA 1K8DA 3VXSA 5EIQA 4UILL 3FQTA 1S78C 1FLTX 1WLHA 4OSUH 3FFDB 3VTTA 4ZW5A 1V7NH 1MZYA 1RJLB 4RFNB 5FW8A 1CXFA 4NUQA 5HGBB 2GHWB 3RBSA 2Y24A 1OSPL 3HAEA 4LLYA 4EEEA 3QC5X 3CSPA 1X3DA 4NHCH 1DDHA 3LPGA 1NFIB 3UTTE 2R0WH 2XN2A 4HEMA 5HYSA 2A9NL 5EIIG 3FRPB 4R4FL 1JK9A 3IT8D 3PDOB 5DC0A 4NCDA 5FDWB 4AYEC 3DIFB 1JIBA 3S7GA 4Q2ZA 4NPYB 3MRPA 5KWYC 5ERWB 3WE1A 4PR5A 1ASPA 4NQDE 5JORB 4MFHA 2NYZA 4X4ZA 4Y19A 1QI5A 3BN9D 5AL8A 4HIIB 1GYWA 4EAEA 3BE1H 1RUAL 1LVEA 4GXFA 4A66A 4NLAA 3GTVA 4YGVB 2VDRH 3BFOA 4W70A 3A5VA 1SJHB 2ENJA 5I1CL 3ABLB 3OKYA 3LIZA 5BO0D 4PJBF 5CM1A 4XI5D 2FLMA 5IMMA 3TN0C 1QX1A 3QIWB 2YBRB 1F1DA 3CK0L 3GSRB 1A7BA 3NZ8A 3PAZA 4GQ9L 4KDVA 3N1QC 3CZSA 4IKJA 1ORQB 4GG6B 2EO9A 2YA1A 2F68X 1NFDE 3UMNA 1A7QH 4KZDL 1NPUA 3CLFL 2JIXB 1LE9A 1LK2B 2JWYA 4I0PD 2J21A 4IBZA 3Q2WA 5C0GB 3U9PL 3QXAB 1IAIH 2R8SL 3JV4A 4M6NH 5TFSH 5IGXH 1UURA 2ZAHA 2WXJA 3FB5B 3QC6X 3GI8H 3QNXB 3KPQB 2GTQA 3CZJA 3BCFA 4QOKD 2AQTA 4ISVB 5B22A 4M1CD 3TS8A 1Z5LB 2A6JA 3EJUA 2ICEA 1OP9A 4TS6A 5EO0A 1HXMA 1JV5B 5E2WH 3MODH 1NGQH 4OCWH 2DQGL 1J12A 2Y36L 3MOQA 2DIJA 4NM4H 1B4JH 4LDCA 1FN4B 1LEIB 1S9VA 4UZUA 3Q3GA 3CJJA 3WAJA 3C2SA 3QQ9C 4WSJA 1NSNL 2X09A 2PABA 1WBZA 3FZUC 5KSVA 2J2ZA 4N4YB 4X7SH 2CWRA 5KTEH 2XA3A 5JW3H 5T5NF 3QWOB 1C8PA 3QORC 3FQXA 2VABB 4F37K 1IILE 2XACC 4CU7A 5BV7H 4G7VH 4G2AA 3QG6A 5KJRH 1D2PA 1J0KA 1Q9KA 1MFDL 1Q94B 1F3DH 2B7DT 3DSNA 4KKAC 1FNSL 3DX9A 1JMZA 3HHRB 1M2VA 2LFEA 5MP6H 5J9PA 1BVLB 1PEZA 2Q8BL 3ARDD 3LEXA 1YJDC 3WNOA 1FC1A 3V52H 4J6IA 2V17L 4IJ3B 4XBEL 4BCYA 1KBKA 5AZEH 1XSIA 5DK0A 4I4WA 2ITEA 3BPNB 4RQQA 5CJ5A 2JLLA 4JB9L 4FFZH 4ABQA 3HMWH 4CMMB 1JZHA 4NDMB 1CD0A 2BSDA 2PLTA 1A5FL 1MCFA 3NCJL 2YFNA 3HAEG 4X6DB 5B21A 1P5UA 4GH7B 3VXMB 3JWOH 4ZK8A 5MEND 1YQVH 3GSQA 4K9EL 4LCUA 4LDEB 2LAAA 2VJ8A 5K9KB 1K2DB 3TF4A 3KLDA 4PBWD 1AZVA 1KYDA 1OM9A 5DQJB 1KJVA 4MA1B 5ILTH 2JH2A 1RUKH 4O58L 4Z8FH 5FO8A 1K5NA 1A9BB 2OP4L 4CVWA 1S7SB 5AW1B 3L3IA 3GSNB 4XPFL 1L9QA 4DGUA 2JK5A 1WBXB 4Y5VC 5I8KL 1EDYA 1NEPA 4FNQA 4ZFZB 5DD1H 4DETA 3L2LA 3FQXB 3ULVE 5I6XB 2F8XC 2D31A 1JGVL 1GY1A 2CIIB 3T65B 5DT1L 4D0BA 4YUEL 2AJUL 8FABB 5INDB 3QQXA 3L4UA 3LRSA 1UM4H 2VZSA 3N9GL 4ES9A 4BKTC 2CGYA 2F74B 3IJEA 1DQML 5IJKA 4A2GA 1MVYA 4AEEA 4F93B 4LESA 4MLSA 4N2HA 3L9EA 4ORGA 2X89D 4HKXA 2AJ3A 1PPIA 4E0RB 4TNGA 4WWOA 1OE3A 5H4YA 2GAZB 5B8CA 2IFFH 3T3PB 2W94A 4GKNB 4NGHH 5DXWA 1P5VB 1VKXA 4B3VA 5I19H 4YDJB 1CLZH 5E2UL 2FGWL 3W5MA 2GY7B 4LSVH 1N70A 2C9QA 4WWKD 3MA7A 3NBNA 3PHAA 1CFSA 2ZWSA 3NTCH 4ODHL 3EF7A 1X5JA 4YDVB 1QSFD 4QRRD 1H3TA 4LCWD 4I9XA 3BX7C 3WO4C 2F0CA 5E08L 1MRCL 1ACZA 4CW1A 3DLQR 3RTLA 5KVMC 4A2EA 5EZJB 4LLVA 2V5SA 4PB9L 1MWAA 2CG9X 4LEOB 2DLTA 4ODVH 3LNDA 3PV6A 5F7AA 5KAQG 4A04A 3EFDL 2ATKB 4HSCX 3PP3K 4RGOL 4FZ8H 5E5MA 1WITA 4BK5C 2HB0A 3MLXL 1Q8MA 4PW4A 1ZT4B 5LNGA 3E6HA 1XH2A 4ZW8A 4JDTH 4ANUA 3CQFA 4LEEA 1PIGA 1C5DB 3LQAC 3QO1A 3P9WB 4OIIL 3NG5A 3HRZB 4KXDA 4QXTA 2D03L 4ZTOH 2OTWA 5CBEA 2ZD0A 3FTVA 3V4VB 3SDCC 1FVCA 1WIOA 5BV7B 4EI5A 4TNWF 3K2IA 4H88L 3FONA 4KVNL 3MNZA 1ET8A 1CL7L 3QUMH 4JJHA 4FA6A 1UXMA 4Q0XH 1DVFC 4LOFA 2UXVA 4CN4A 2R4SL 4S1QL 4DKTA 4W4OC 2ARWA 2DQTL 5L4JA 3VI4A 1J88A 1MJUH 4GKNA 3IEAA 5I66B 5E2VL 3S8FB 4GG8A 4RGMB 1B3JA 1FZMA 3EH1A 5D7JC 1G0XA 5KVDH 1E8ZA 2ZSVB 3NCBB 3PU7A 4IBYA 3QUYD 1U21A 1SJEA 4KK6C 1PS3A 4PJCA 4W1TA 4WUUD 1EBAA 1RUQH 1SXNA 1XMEB 5ID0A 1DQKA 1WGVA 3OX8B 4LPWA 2IALB 4AUUA 2FIKB 2WWKO 4F33B 4XOBA 1EANA 4MKMA 2O6CA 4OT1L 2W9EL 5FHAL 5IHHA 2MRYA 2XG4B 2QVTA 2VJXA 4U31A 4PPTA 2X2UA 5LDSA 4OCRL 5T1JA 1UH2A 1CF8L 1ACYL 2C4XA 3BKCH 4QTIL 2BSRA 5E6IC 3M1CA 3BZ4A 4F7EA 4JFSA 1UXSA 6PCYA 2HX9A 2PP7A 2WINB 4YNYB 3CSBA 4J5VA 2CRMA 2HZHA 4HP5A 4HWZA 3L45A 4NPKA 3MJ7B 4N8VB 1GS8A 1WE5A 7FABH 2WLYA 4G8FB 3T8MA 3RKDD 5C2UB 3L3GA 3X11B 1G1OA 3ZKXC 5DWPA 3PAVA 1SEQH 3HN5A 1V55B 3WLBB 3X3FH 4NSKA 4TPRH 3GEWB 4Z3HA 5C07E 4OJCA 2ZOLA 1OAJA 3BAYA 5EPMB 2ZPKH 4J4PA 3M17A 5L88H 2IQ9H 1RZQA 1E50A 4ONHA 1O7DE 2H2PC 1R5VB 3PJSB 3DK0A 1IGCH 4KVCH 3DIDA 1A21A 2YIHA 4G80B 4UNUA 4XNXL 3G7TA 4WJ5B 4IGBB 4WVRA 4BV1A 3PABA 4PG9A 4N0FB 3TBCA 1JVKA 1Q0EA 1QLRA 2DB8A 2ZXDA 4GEJA 2YD5A 1LO5B 1R5WB 1HHKA 3ATAA 2GSIB 3U1SL 4NZ8A 3QQNA 3SIKA 3MRKA 4GAGL 2V5TA 4UQIM 3RWJB 4NRXA 3KWXA 4I3SL 3QHZL 4M7LH 4N3UA 3C6LD 4RRPG 3N0PB 1BZ7B 1V3MA 1WRFA 3T8XA 3O2DA 4DHLA 1R34A 2VDKB 4YBQC 3VD5A 1WWAX 1UACL 4F2ME 2F53A 3R8BB 4F9LA 1KIRA 4E68A 4IRJC 1KFAL 4TLSA 1UA6L 2VH5L 1UKTA 4IU3A 1QI3A 2EDNA 5TPWH 3UO8B 1ZTMA 2O30A 1AZZC 3T0AA 2Z1PA 3QUXC 4S0HA 2FDBP 2GI0A 3QIUD 4HYTB 4P4KD 3WCYA 3EHBC 1E65A 5JUEL 1RPUA 2X28A 3PWPE 1T04A 3U4EA 1VESA 1BXAA 2A1WH 4ZAKC 4APXB 1UKQA 1JGUH 2EIJB 3EO1A 1QTSA 3OAUH 4U4IA 4NSKB 4E9QA 4X5XB 6FABL 1QFWH 4PRHD 2UZXB 4BSWB 4J3TA 3QHFH 4NQCD 4XP6L 1KBGL 3ALXA 3R18A 1FORL 3D34A 3P69A 1QFHA 3HS9A 1WISA 4R7DB 1SHMA 4FFYL 4AKQA 4TL4A 2Z31B 5ADPH 4MXWL 5LJYH 2B0SL 4H2AA 4N3TA 1CURA 5JW4N 3ARXA 3KR3H 4GBXA 1H3XA 5FCSH 3Q6GL 4OZIE 3MJ9A 4IJTA 3V0GA 3ZE2B 2GW5A 3H6JA 4OFYD 4TQEL 1EAOA 3L48A 4PTUA 2F54A 1AHWB 2UX7A 1QYGH 1UD4A 4GAJL 4POZC 3BI9X 3REWA 2YPLD 1IM9D 2HKHH 1PMYA 2FJGA 1KDJA 2J1WA 3QDJE 4Y2OB 5MENB 2B4CC 5CLYA 1ZHNA 1WICA 3LRLA 1BZEA 3TNMA 4XPFH 3MXWH 4HCRL 2VDOB 4HEME 4X6FB 1N4XH 2PR4L 1ZT1B 2Z31D 1S2EA 4J3UA 4LNRB 1R3IL 4MAYD 5C0JB 3U7YL 1TCMA 3P3TA 4RGOH 4TKWA 1BM3L 4XNYH 1AO7D 4M5YL 1GHFL 1HOCB 4ODUA 3VGEA 3QWRD 3S3DB 4QXGL 5BMFL 1JN6B 2WO3B 1GGBL 3L5WA 4JR9L 3VXSE 2ZNWA 1GMIA 5CKAA 1R19A 1YECH 4GFTB 3ULUC 3DOSB 4N0UA 4E9SA 2BLFA 1WO2A 2VO8A 3G9AB 1FE8L 3KS0H 4I3RH 2Y7QA 5IB4A 3QDMD 2WNGA 3MJ6A 3GEFA 3NEXA 4NUJB 3TO2A 3NCJH 2VDPL 1A1MB 4P5TD 4JFFE 4ZW3A 3DX1A 1ZRUA 3IWVA 2Q8AH 2OX5B 4LSQH 5AWNH 4MJJA 2HG0A 5JIKA 3NESA 4ELMF 4WTQA 2A1WL 3BFQG 4Z7WB 3TZVD 2EABA 2V17H 1XD0A 2G60L 2A4EA 1TR7A 3FQWB 4Y2NA 3FF7A 4XXWC 5DZAA 3FT1A 4DCQB 2ZXCA 4QD2E 1HT6A 4H8QA 4S1SH 2JVUA 4C83A 5DD3H 1A1OA 2Z8SA 2ZSWA 5LBSH 5IHWA 4EE2A 5I2IA 1X9UA 1GC1L 1QKZH 4FI8A 4IRSC 4WW2A 2HVBA 4LHQB 5LBGA 4ODBD 1NKOA 3VU1A 2FB4L 1JWMA 3PJNA 3ZZLA 4F8PA 3B7RL 4OZHB 3N1MC 4LEXH 3SDXB 3OKEB 5MENA 3N43F 5IB2B 1KYOJ 4Q9RH 3H56A 1GZHA 3F7RA 1KTBA 4IGBD 3N04A 1U6AH 5JXEA 1U3JA 3CHQA 3EDFA 4HWBL 1W6WA 4E5XA 3BAKA 4RGNE 3NZHL 1WHOA 4RMUA 4Y4KA 2CNZA 2I7SA 5FLVA 1ROCA 2V2WB 1VERA 3V6OE 3VG0H 3CC5B 1Z9OA 5KEZA 3H1ZA 4JO4H 2P5EE 1QW9A 1NEZB 1P0SE 2YEZB 3K6FA 3QEHB 4QJ4B 4UMGA 3SGJC 3D85B 4HEPG 1AAJA 4OGZA 4U3SB 4L5FE 4R3SA 1GSKA 4M7KH 4CA4A 1I9JL 4GAYB 3OAYH 4KJPD 2BOLA 2YRZA 2F15A 2JQAA 1MDTA 5T8IA 4L1DA 4Z3GA 3E8UL 2MWCA 2RCSL 2VDQL 3N6YA 4WQOA 1MHHA 4E9RA 4F7MA 4HUCA 2V2TB 3LNHA 3ZE1B 1INEH 4RRPA 5J6HB 5C7ZA 3U30C 5HJ3A 2W5PA 1J1XH 1QVOA 3UZQB 1OB1B 4DZBB 5D1ZD 1QA9A 2HX8A 3SBRA 5E4AA 3OJDA 3LZNA 4KJYA 5JQHC 3DX6A 2G9HA 4KI5F 1DDTA 2IBBA 4LVOB 4I18B 4NQDD 4LCWB 4YDMA 5K1JA 2OMBA 5M7QA 1A14H 1LP9A 2WXGA 4PJ5A 2R56L 3FQNB 4N28A 5D7JD 1V10A 2XWTA 2YGNA 5F7NC 4JMNA 4A37A 4P5TA 3OG6B 5I26A 4EDWL 2V7HB 3UG3A 4TLUA 2R1WA 2ITCA 4OW6A 2VITB 4ZQKB 5EUKB 5IVXE 3VFGH 4YR6A 4R3SB 4HMCA 1E9OA 3HZKA 3IJYB 5JLZA 3RBGA 2WPGA 3KAAA 3RVVC 2GFBA 2VB5A 5T5NG 2KLTA 1E3FA 1U3HD 4PGJA 3NQKA 4LARL 2CSPA 2YXVA 1KGWA 2WOYA 1MF2L 2NNAA 5I1DA 3ECVA 4OCLC 4ZMLA 3LH8A 3NSDA 5HHPA 3BRDA 1NCHA 5I15L 4YHYB 2VXTL 3Q2VA 3FQRA 3PHSA 4OLUL 2J2ZB 3MROA 4I8DA 5E9DA 3VGDA 3PDGA 1QVOB 3BVXA 2XBDA 1IM9A 1VPOL 3SKMB 4H8UA 3DVNA 5CEZH 3L3DB 1I8MB 1P7KB 4LBEB 1ZV2A 2WO4A 1TVDA 1S7UB 4FFTA 1FNGA 3PIQB 3AUWB 4QAMB 5B1JC 2OYMA 3IXTB 3TIDA 5DUML 4CAGA 3JVGA 2BERA 3RJQB 1Q0XH 5B39G 1AS7A 2A74B 2GY5A 1KB5A 2EDEA 3A47A 4W6XB 3TPKA 3ZRSA 3ML8A 1A4JA 1F11B 5BV7L 5EOTA 5D7IB 1I3UA 1KJMA 4G70B 5E8PA 4WO4B 2EH8H 1NKGA 3QJQB 1JF1A 1NSNH 1A14L 4N5EC 4XOCA 1YJDL 1UZ8A 3WY1A 1LE5A 3RGVB 3ESOA 1L0PA 1R3LA 2QKSA 4U05A 2VN6A 2XIIA 4WO4C 4XOEA 2BSSA 1AD9B 3OHXC 4YSTA 4M3KB 4QGYA 3I3EA 2H3KA 1KPUB 1BOGA 3DGGB 1AGCA 1AQ8A 3CZKA 1NOLA 3L5XH 5AYUL 3K6SB 5DUBB 5E2WL 1UD8A 2HT2C 2EYSB 3EFFA 5KYWB 5I0ZA 2JELL 1T83C 5KSUA 5AG8A 2R69A 4WEBL 1TPXC 1XR8A 1D7DA 2ZCKH 3UL4A 3QIUC 4P4KC 3OMNB 3SPIA 3CDFA 3AABA 4Z0BH 1HCVA 5EG6C 4LXFA 2CK2A 1HHGA 1OGAE 5LN4A 3L16A 4NHUB 1F4YL 4MJ6B 5DUMH 4UM8B 3AS2A 1DQTA 3B9VA 5DMYA 4OH2A 4L3CA 1MCQA 3MRGA 2OJ1A 4DEPB 3PLYA 4MA1C 3QIBA 1SLVA 1MLBB 3U2IA 3SCMC 3EGDB 2HCZX 2C7FA 3K6IA 4PY7A 4RMVA 2DLEA 5K33A 4E5XG 1GCFA 1XCXA 1OAZH 2HT3D 2EUWA 5BUGA 3KPRD 2JKIS 4AIEA 1JYVA 3C12A 1TXKA 3DDFA 3BO8B 3WXWH 4RRPM 4GW4B 3BSGA 5IV2A 2QR0B 2GEEA 3UBXI 2X6VA 1KJ3L 2HFGH 4U6HB 1UM6L 2I5YL 4XHJC 3X12A 1NGXA 5FUOL 1JJUA 1HZHH 2XTLA 5D7SL 5L8LB 5D7HA 5D72L 3UDWA 4PGEB 5DJDA 1I8LA 3BQUC 3B7SA 4D3CH 3OB8A 2DL2A 2YAPA 1NBZB 1A6ZA 2A5UA 3QJZA 2IPUG 1S9YA 1KBGH 3WD5L 2K8QA 4MNGE 5F0JB 1HJBC 3PPSA 1AD9A 3FRUA 4FD0A 1KTLA 5HHMB 2B3RA 3JT2A 3QNXA 4WAFA 3IMBA 1W6LA 4HWUA 3KCPB 2IDUA 1FUNA 5FV1L 1PZBA 1NPJA 3MV11 4HG4J 2JKXA 4ZUTA 3EG9B 2VDRB 1GOHA 1T5WA 3UPRB 5B38A 2YD0A 3ZYJA 2CGRL 2VDRL 4E9LA 4EOWH 3RX7A 2RTTA 1BFOA 4MX7A 5GHWH 1QTPA 3BP7B 2CHDA 2D7PA 5I1HL 3CWGA 4IIZA 2D4FA 3QIBD 2LV4A 3CD4A 5MHSE 2WVTA 4CMHB 5D93B 3NSYA 5JHMA 1S7VB 1ZT4A 2X6MA 2W38A 1K4CA 5DMGC 3D0VA 3LXUX 1IGTB 1PG7W 2KMWA 3VD7A 1ODAA 3MFFB 4JZJA 4C58B 1KLFB 2O5XH 4HXAH 4APQB 2Y5TA 5CUSL 5LLIC 1WT5C 3D12B 3CBKB 4I13B 5CZVL 2ZXAA 4EI5B 1VCAA 2VDML 4G6FB 1ZV5A 2XIDA 3P2BA 4CADA 3NDZE 1BVLA 1QRNA 4Y8DC 1YEHH 2CJSA 1WWCA 4MJ5B 4UIMA 5DVPA 4GSDL 2ARJQ 4GOSA 5AOLA 5IW1A 4RH4A 3KNBB 5F93C 3GI8L 4QXGH 4ANKA 1WZMA 2P8MB 4F5CA 4I0PC 3BESR 1CICD 4KK9C 3LKNA 3OG4B 4Q56A 3S37X 5CSZA 4L48A 2YD9A 1T6VN 3GO1L 1OQOA 2X9XA 1FFNA 2IPKB 1FF5A 2V6HA 2XFGB 3KCPA 3QIWD 4OJYA 1DHKA 4UNIA 3KPPB 4JREC 1E4XL 1U8CB 4L37A 5IUSA 3QEQA 3RPBA 4JFDB 4GSXA 4KXBA 2MIZA 1YN6A 2IBZY 4RZCA 4OLYH 5KVEE 3IBEA 4GXVH 3WDIA 4LLMB 4XXWA 4CU8A 3VI3F 4UDUB 1U4EA 4PJAF 3GSNA 1U91B 1R46A 1S5IH 2CUHA 3A67L 1OT4A 1HILB 2K45A 7PCYA 2Q87A 5IJVB 1VFMA 4EUPB 3GPSA 3FCGA 2WINA 3FAXA 5I73B 2ISDA 1BPVA 1F6AB 5CEZD 2EAEA 1G1CA 2UZIH 1IU1A 3ULVF 1CZ8H 2PYED 2WSDA 3KPNB 4MMZC 4PS3A 2F74A 4ZFOB 4R7NA 1D7BA 1XF5B 3OL2A 1CUOA 4ONGH 3V7AG 1AR1C 3ZKNC 4E2OA 4MMZB 5E1QA 3TJEL 3QUXD 1WV7T 1RZIA 1FE8H 2NY1D 4H5SB 3NJNA 2WNKA 3CN1A 2KDYA 1H6TA 3EHBD 1MFEH 5CLWA 2E9JA 4OLWH 4PJ6A 2JE8A 5I1GL 3FYEB 1KB5H 2AITA 3IFLL 1FYTB 4WNJA 4YDJA 4PRIA 3WDJA 4P5RA 3HG5A 4IOSA 3GBEA 5TDPA 1JTPA 1OSZA 1QPXA 3ARFA 1W0WA 3TCLB 5B3JE 3TBYA 4E41A 5K1VA 4DVBB 5GS0D 1RK7A 4I1PA 4ORZC 5EU6D 2OV0A 5DJZB 5EWIL 1VDGA 4N0FA 4A2LA 5JOPE 2YD2A 1C9SA 3AQZA 5D2NE 5CS7A 1QFPA 4PFEA 5I8CB 5KN5A 5FIEA 4M7JL 2X2YA 1XGUB 5GGRA 3DMMA 4N1HB 1N5YH 4UT9H 5DRWA 4F8TA 3DV6B 4PUBL 5DF0A 2OMUA 2LVCA 3L5IA 3GIVA 4ZUUB 3O3DB 3UAEA 4TUJB 4V33A 4PLKC 4TSCH 5AD0A 2EC9T 3MOAL 4FQPA 2I07B 2PW2A 1E5BA 3ARGD 4G1MA 3PG2A 2TSAA 1OP3K 3SE8L 1ZT7B 1QLFA 5LG1A 2SODB 1M3JA 2AC0A 4Z7QF 4RIRB 4J3OG 2CMRH 4WSKA 3KPMA 2FO4B 2XBZA 2XJKA 5DJXA 5EN2A 4YDKH 3X13A 5IB3B 4V11A 1S9WB 2BNQD 2WVUA 4A7QA 2DWTA 3QUZA 2EC8A 3W2DL 4PRNA 5DFVD 1KYAA 4MZIA 2PR9A 4QHKJ 4N9GA 1UJ3C 4JVPA 1PZCA 4U1SA 3LXBA 4QWWD 3VI4B 1KCVH 4M6OL 5KS9E 3REVA 4JGJA 4UTBA 4XVJH 4Z23A 3KJ6L 2QHRH 3F2LA 3LHPH 4DP8X 3D39E 1SOXA 4AEIL 1YEKH 4UTAL 3K4DA 5TDOA 1OTUD 4BFIB 3OJMB 2X4OB 1A7PL 3CVBA 5AYUH 1Q9LA 4X83A 2DQCH 4KZCA 3DRTB 3HS8A 4QXWA 3UC2A 4LIQE 2EEXA 1HHIB 2P44B 2B39A 3RDTA 4TQIA 1ZEAL 4NO5A 2WGNB 4R90H 5F96L 5GRZA 2FIKA 1W8OA 4QOKE 4Y88A 3MYJA 1FJ1B 2ZUSA 4LCIL 1ZD6A 3C5SB 3CH8A 4JGNA 1XGYL 3OF6A 1HIML 4I89A 2CMRL 5IFAH 5DRWB 4F7TB 3WTTA 3V4PL 3ZE2F 1FLRH 1JNLH 3RWDB 2XV3A 3Q5YA 4RISH 12E8H 5AD0B 4ZX6A 2VLRB 3NSCA 1DSWA 2I85A 3QJXA 1LWHA 4KFZC 2DTML 3ZXAC 5HHXH 3HTLX 3CU1A 1JWSB 2OMZB 3F12A 3OLDA 4NNXA 1MFUA 4WKZA 5EU4A 3KPOA 3W57A 4BD4A 3MRNA 3QDME 4ZOEA 3SKNA 2QPDB 3TZVA 1QABA 2WXLA 4Y4HA 1DBJH 4N8VA 5EEUA 4OV6F 3BMWA 4K94C 2JI1A 3ZUCA 1VENA 1BFVH 3X11A 1T0MB 3BUTA 3NMEA 2HWZH 2VT0A 1OAUL 4PWEA 4DZ8B 5CGYD 5F0PB 5J8OA 4AT6A 4KRPC 5ALCH 1CBVH 4JN2B 2AXGB 2BHFA 4P23B 5ALCL 4K55A 1DLFL 2DJ4A 4M93C 1D9KA 5BQ7B 3QUKA 4G3YH 4P07A 5AB1A 3C5ZD 1MFEL 3QSKB 1WSST 3V0IA 3BCDA 4QY8B 2MHAA 4HBQA 4AQEB 4PI2A 2VLJB 3JTTB 4MAYA 1U3HC 2VWEE 5DGQA 3APNA 2HJFA 3EJYD 5CEXA 2IH1B 2WTRB 3T0EA 4WW2B 4L0ZA 1I7ZB 1W9XA 4PRBA 3BPCB 1KSRA 5GGUB 1JNJA 2VNCA 1IC4L 3CNKA 5BZZA 2OSWA 3RWJA 4LRIA 2Y6TE 2VL5A 1J5DA 3T0XA 2CIKA 1XEDA 5C0BD 1B9KA 3S4SA 3G5ZB 1HK6A 2XN9D 1QSED 3IU4L 4OFYA 4RAVA 5FDWA 4WDIB 4D94A 1DVXA 5EF3A 4XPBL 1XL6A 3T71A 4BQ8A 2QVMA 2MOQA 3S3SA 2NY0D 4IBSA 1KEMH 2EVIA 3AS0A 3C5ZA 4XN5A 4WEUD 1UCTA 4FOMA 3WS3B 2ZCLL 2EDHA 1WAAA 4X6BA 4U6TA 1XSJA 2XN9B 1NAKL 4NI3A 4Y5XB 3TBTB 1HXKA 3VI3A 2CBTA 3WEOA 3K6NA 1NLDL 3VACA 1E27B 5T3ZD 3WKNA 1WAPA 1H6FA 4LT7A 3TFBA 4ZQTA 4KVCL 2IADA 3F04A 2H3NA 1IEAA 4XO8A 3BKJL 3SO5A 1KJ3H 2HFGL 3BKYH 1WUNT 2XDHA 3GINA 5L2KD 1YY9D 1YMMB 1ZLDA 1IRAY 3K72B 5DSCB 2J56A 1HC1A 5ACZB 3ALWA 3B2PA 3IDGB 3WELA 1HH9A 3H3KA 3V0WL 5M94B 3RVVD 5DHDA 5I1KH 5KSAD 3WU1A 2J73A 1IT9L 3MRBA 3Q9QA 3QFJE 4ZFGH 1E4KC 3BC9A 5LO7A 3UPCA 1U8PB 5CEXB 3I6LD 4J7RA 4N0CD 4RFOH 2F54B 3U46B 1W72A 2A4ZA 4BH7A 4JM2B 4JN1H 4HS6B 3UCRA 3F64A 1GOGA 1QWUA 2WQSA 4O00A 1MHCA 4Y4HC 1J0HA 3UTSE 5DMKB 3JYCA 5DDHA 3TNMB 3KPQA 3U2SA 1BGXH 5I23A 1ZKAA 3IE9A 5CP3H 3DX6B 3ZOAA 4Y4FB 3ZZQA 4ZMXA 1ZT1A 3WTUA 4OFPA 2EDYA 4PJXE 5EB9A 2ZUQB 5HJBA 1N5YL 3NTCL 3UTZB 2WKGA 2I60L 4Q9QH 2Z91B 3B9DA 3SGKA 3ARBB 4ODTH 5A2BA 4OF3A 4LP4A 3TT3H 4HGWA 1EV2E 2VLMD 2XWTB 4AX3A 1OO2A 3FB6B 5FF6A 2CGRH 3P3YA 4NWUH 1RK1A 5AOIA 1FZJB 1X5LA 3SDAB 1L5GA 4HJUA 4S1DC 4ODWB 2WZPA 2B14A 1FORH 3SDCA 32C2B 5G4MA 5AB9A 4NNYA 5F7MC 2R0LL 2H8PB 3LXAA 5D1QE 4LZKA 1Q9KB 1A4BA 1ZLSH 2J7LA 1NGWA 3UO1H 5JOFA 3LKSA 4UINL 5C0RH 4GP5B 2QQKL 3O6KL 4WO4D 3ESPA 3QFGA 3FHEA 1J86A 4X9IA 5DLML 5JXEC 2AABL 1JV2B 3O3BB 4OJAA 1ZS8B 1JNHB 4RMRA 3PQYA 5FKPB 4G9FB 4TOYL 4NENA 4L4VE 2VISB 3DTXA 1X7SA 3H7LA 4HK0A 2WXRA 3U0TB 4AYFB 2J6EL 3BT2H 5DK0B 5IQMA 1IM3D 5IKCB 4MAZA 4DGWC 5E9DB 1BF8A 2DQHH 4ZUWB 4Q74A 3ILEA 3IKCB 4WSGA 2X4QA 2BZ7A 3VXRB 2PTTB 4MD5B 1QZ1A 2YXMA 3LIZL 1RP9A 3J8F7 3L7FA 3OPZH 2R2EA 3ECQA 5KVEL 5FO9A 1LP9F 1UM5L 2WXQA 4S2SB 3WJJA 3GBMH 5LGJA 3FFCA 3IJ8A 3WJLC 1UCBL 4QMEA 4GAGH 5FGSA 4WV1C 4WUUA 4P2RD 4PRPD 1CD9B 3CSTA 4TYUA 1EFXB 4YBLB 3ARGB 5ICXB 5BZDA 3QAQA 1A4KA 2QSQA 4PJIE 1NEUA 3AREB 3O4LA 5SWZD 5IJCC 2JNZA 2WSKA 3FPXA 3T2PA 1NUNB 1IC5H 4AGQA 2BVOB 1HNGA 1MI5B 1JHLH 3KJ4C 1JDDA 1DBKL 1XSOA 4ZS6D 5BUAA 1REIA 2NY6C 3A4EA 4FA7B 1IVLA 3BUDA 2CDGB 2NQDA 5CR1A 4JKLA 5DZJA 4AQAA 2PPDA 4UYPA 4FCAA 3RNQB 2FR4B 2H0FA 1NGWB 1HU8A 1T89C 5CBAB 2CLVA 2D3NA 1RIHL 2ZT9C 4YHNB 3EF4A 5KUKA 2FD6L 1T80A 4YDNA 5EOQH 5D7JB 4WY7H 2C9RA 1XR9A 1L6PA 1EZUA 2BSED 1YN7A 4G9FA 1A7PH 5E7BA 2EXWC 4OB5H 5AFAA 2VXUL 1XZWA 4NQUA 1W0VA 4AV0A 3S5LA 3L3JA 3WHXA 4YXLH 2EE0A 5DI8A 5HJGA 1XGTA 2GJJA 4ZW6A 5IOKA 2FWUA 3VXOA 5HJ3B 2XU9A 1AXSA 1P2CB 5EIIB 1WZAA 2VN3A 3EGDA 3P73B 4RWYL 4B53A 2GCYB 3MRLB 2PTTA 4OJFH 1CFSB 2ZUUA 3OJDB 1LO3H 2KKQA 2PTVA 4AYBA 1PZ3A 2W9LA 3DC0A 1OAQL 1NZRA 3B5TA 4YK4C 5TDNA 4Y9EA 4OV5B 3PWLB 3SE9L 4G6AD 5E1GA 3D9AL 1AP2A 4M48L 4OIBA 3S3PA 3STBA 1RUQL 1PY4A 4U1GB 4XXCA 4N2MA 4ZPVA 5FYKD 1CICA 1T2QH 4PGEA 2D2CC 3TYGL 3PREA 3GMNA 4HETA 5HJDA 4PEEA 5GS2D 2P5ED 1G7PB 3FOMB 3LKQA 4PRAB 4N6QA 1G6RH 2K3HA 4K9EH 4C56A 1P5UB 3VG0L 2CDGA 2WW8A 5DK2A 3ULVD 1WC7A 3WIHL 4XVOA 4ABWA 4F7PA 2J57A 5CIPA 5DJ6B 4XMZA 4GQQA 3LCYA 4IBTA 1KCKA 4P49A 4XP9H 5DHEA 1KN4L 2AERT 3MV7D 2XWEA 4LPYA 3MNZB 3LEVH 1FVEB 2CH8A 4H1LG 5AAMA 3QEGH 4FQIL 4PJCE 1NIFA 3RVXC 4ELMB 3D2TA 2DY2A 5DJYA 1NGZA 3WXVL 1BVNP 5E51A 2X05A 2DEXX 2WLLA 1JE6A 5SWZA 2JJTA 1J0ZA 2QLVB 2EUZA 5C0BA 5HYSG 2Q7YA 4JZJB 2C5DC 1L9MA 4ZUSA 5I1CH 2F19H 3HB3C 4LKCB 1MRDH 4G6FD 3JYBA 2UWEB 1NIDA 5J13C 1S8DB 2I7OA 2BPBA 4DGIH 1IE4A 1FL3A 1NQBA 4MJIA 5A7BA 1KJVB 4AY0A 1ZV9A 4KPHL 5DZVA 3VXUB 4ELME 5LBSA 4AH2A 4KX7A 4M5SA 4UIMB 1KIQB 1OSPH 1BZ9A 2NY4D 2Y1VA 5FWRA 3L9RB 1P9MC 1A7OH 4ZNCD 3IAGC 1A22B 1NEZG 4GIOA 1A7OL 3TH4T 4X8JA 1JPTH 4OKVB 2P8MA 3JV4B 4I0CC 3UX9B 5IR1A 5JMOC 1BD2E 1ETJA 3RJOA 3FOMA 4L18A 2P49B 4XVJL 2XZCH 3DX0A 2QPSA 3FB5A 1LDPL 1Q90A 4WTXA 2QT6A 4YE4L 2NY0C 2DYRB 1WC7B 4CGUB 1PZAA 1ZHKB 2XY2A 5EOCH 1L7IH 3BP5B 4HPYL 4BQ9A 3O9WA 1N0LB 2Y69B 3T4AA 3LAFA 1D9KC 5HHMD 5AW3B 4BH8A 4YQXH 4EIZC 4KWUA 2PWDA 2UZYA 3BQUA 1CT8B 1FFPA 5K9JH 4UMSA 3QZWA 5D4IA 4AYID 1R3HB 4J23A 3L3KB 3MNVB 3PWVB 2DQTH 1E5UI 5FGBC 1CXEA 5AOJA 4XP4H 3PWUA 3A23A 5GGTH 3O4OC 1VZIA 3VYNA 2YKLH 3G5VB 4AK1A 4HZLB 2N0KA 4H8VA 3OF6D 4IQHA 2EUVA 1PFOA 3QG6B 4PB0H 3WS6A 3QS2A 3LH2H 5IVOA 3KPLA 2BS71 1NCWH 3V4VA 4POZD 4GS7C 3PXJA 3UAJC 4NLHA 4GW4A 4KRNA 5FB8B 1GS6X 4Y2DD 1BEYL 2K7QA 1QEWA 1TQCB 3MI6A 3NJXA 4NRXB 3RNKB 4MS8D 3HE7C 3TPUA 1KY6A 4ZMTA 2Y6SD 2X44D 2W65A 4O9HL 4Y16A 2FQEA 4TNVK 2IPTL 4PWGA 4YAQB 1MH5B 1BQHB 3ZKMD 4XT1C 1WS8A 4MDRA 1SDAB 1QUNB 5IOPB 2Y22A 5KSAA 3GHBL 4XNZC 1OSZB 2OKMA 4ZO7A 3SQOH 2XPGB 5F7EL 5C9JB 5HHOE 5HVHC 1MPAH 4M9PA 3N41F 3R1GH 4AQZA 4F8NA 3GK8H 3VXUD 1JPTL 1T66D 3MKGA 2VDPH 4H8PA 2VO5A 2XA8H 3HHMA 3X14A 2BDNL 4UILH 1IBBA 1UADC 1NAMA 3H2WA 1IBFA 3S6CA 4ZNEA 1DUYB 4JFYA 3BP7A 1EGJA 4FI6A 1QR1A 3T6ZA 3IRPX 2MQ0A 4PJBB 2AK4D 2ADIA 1J9RA 4JRYB 4JE4B 3MNVA 4AMWA 3O3DA 5HGHB 5ID1A 3B8YA 5F7BA 5FC9A 3VXTB 3PWUB 3W11C 3WE6B 3HIZA 4MD0A 5ABAA 4ZFZA 3LX9A 4Z5RA 4FNRA 4O2CA 1J1XL 3QZPA 2Z31A 1OSYA 1U93A 4DOHE 2Y0SA 3SHSA 1AOHA 5E8OB 3L5HA 1N6QH 1CJYA 1QWNA 4JN1L 4MJIE 3HI5L 5E4EC 3T6QC 4RAUA 4G8FA 4PTUB 4YN3A 1HKLL 2H0JA 2OCCB 4H0IA 2IGLA 4ORGB 5IREA 1FWXA 1VGEL 1NDGB 3RNKA 4QTHB 2FO1A 4LU5L 3CVIH 1NGPH 4QO1A 1U92B 2XQBL 3JTSA 4IEFA 3ZTDC 3ZYIA 2B1OA 3F6JA 1TQCC 3RAJH 4BZ2L 1HJCA 4ONHB 2WANA 2VDNH 4OBRA 5CGYC 2PTUA 4G6JL 5I17A 4HISA 2FTAA 4MCYA 1UXSB 3O3AB 4KTEH 5IJDC 5EA0H 5LAXB 1U3HB 3TJPA 1YPZF 3SGEH 4PRHE 3RKPA 5EC2B 1DUZA 2GITA 2G2RA 2AMUA 3CVIL 1W91A 4QPEA 2BC4A 3VFSB 2CDFA 2OMVB 4K9JA 5BO1L 1MAKA 3UGXA 4BZ1L 1JTTA 4PJIB 1U8MB 1MJ8H 5F3HB 3S4SG 1WWBX 4O51A 2FYYB 1FL5B 3K8KA 3ULSB 1ORSA 4LLQA 2GG1A 5DTFA 4L8SA 1L9TA 2O5XL 4UDUA 3J2PA 5GGQH 4AYGA 4LAJH 4RGNC 5KVGE 4HX1A 2QQQA 2NUTB 2KHAA 3JUYA 5HDLA 4B9GA 1R4XA 4M7ZB 1VGKB 2A9BA 3CN4A 4OJFL 1AIFB 2CO7A 4JQXC 4QRUB 4WKZB 1C5DA 3N42B 5EU4B 5F7HA 1F4HA 2AV1B 3AM8A 4NQDB 1SUHA 4OKDA 4DPCX 3H53A 1WG3A 5AAMC 3IDJA 1J5OL 5ESAA 3WV0A 4GB9A 1XF4A 3H9SB 2DEYX 4ZSOB 4M4PA 1MCWM 2JCWA 2LU4A 1JWMB 1MDAA 3OKEA 3HE6A 3NCFB 4X6DF 2X7LA 1AR1D 1ES0A 1F8TL 1WWWX 3ZKND 3JWNH 5JNYA 2A6KB 1DBML 4HLZG 5SWQB 5KANI 2ZKWA 1PW3A 2EE6A 1C5BL 2QGEA 4CN1A 1JPFB 3SKJH 2WLMA 1W0WB 1JWUB 2D03H 3V95A 1HSBB 5DD0L 1G7HA 1Y1DA 3NAAH 2ZCHH 3N55A 3KYNA 4KK9D 4XWGH 1KMGA 2HWZL 3AWGA 1OCCB 3DVGA 2PPFA 1ED3B 1A3LL 1S7WB 3PAYA 4OY9A 3QULB 3MJ9L 4JM2C 2Y2YA 1NCUA 2ZTBA 5F3HA 4JJ5A 2RD0A 1HDMA 4KI5E 1EEYB 5CJXC 1L0QA 4OD1L 3N91A 4U3SA 2BY0A 4UQ2A 1J11A 3II1A 4LRNH 3S4SB 3RY6C 3KLQA 4G7YL 5CN2A 4EDWH 3D3VB 1CFMA 5KVEH 1D2OA 5TE4H 3OWRA 5F1KC 4KZDH 2GJ6A 4M43H 3FUHA 4XN9A 4OCRH 1U3NA 3ZLQC 5EU3A 3WN5C 1R3KA 3AWEA 3TBSB 2ZYRA 4NN6C 4CDGC 5IQ9B 1I1YA 1RJYA 2VDLH 2XTSA 1HIMH 4M8QA 2HLFD 2VQTA 3MX0A 2NMSA 1KYOK 1E2ZA 3V4LA 1ZTXH 4M8RA 4LSSL 2NSMA 3FJTA 4J6RL 5DJ8A 3ZHKA 2ADFL 3MLVH 3F58L 1TTAA 1BOYA 2DH3A 3G6DL 3OHXB 4MD4A 2H3NB 2ZOLB 2J1YA 4WWKC 2GBUA 1OPGH 2VGLM 4D9RE 1G9MC 5DVLA 4PV9A 5KVFL 4QWWC 4J8QA 3BWSA 4Z7VB 4ENZA 1L9SA 1EPFA 5IHZA 1J8HA 1UEMA 4FQ1H 3UFIA 1F58L 3VXQB 2VXQH 1T3FB 3PWJA 5JQ6L 2Y4SA 3MGOB 1R24B 1QBLH 2WQVA 4XZUB 1DBKH 5L6YL 2VXVL 4MS8C 1MEXH 3WKML 3BGAA 2Q6WB 1S7WA 3LKPB 5BS0D 3Q44A 4RBPH 1Q0XL 3FO2B 3QCUH 4P5TB 5F7EH 4BGLA 3IDXH 3V79C 4DEPC 1I9IH 3BHBA 3QDMB 2QVFB 4OFVA 4IDJL 1XGRA 3GXPA 4YK4B 1E3ZA 4UZSA 3S2AA 5IB2A 1A8ZA 1E9OB 3FRPA 2F19L 4KTYA 1DZ0A 4ZMNA 3S8WA 4X5WB 2ENYA 1KXQA 1MFBH 1OE2A 4HA1A 2VLRA 5I1EH 1QO3A 2R2BA 3U83A 4YIQB 3QDGA 2VMJA 3PCYA 4HWBA 3MLTB 1IKFL 4PJ9B 1B6DA 3RDJA 1NCWL 1ZA3A 2X4UB 2XUWA 2ZICA 1QBML 3DSFH 3R7QA 5FOBB 3GUTB 3EFDH 4ZX4A 3B9KD 5EFIB 2LFGA 5DU7A 5DRNA 2Z35A 1JOIA 1NOAA 2WWNA 3HC4L 3MV9E 2YQBA 2YWZA 3RHWF 2GIMA 3MRCB 3OGOE 3QCVL 1BZOA 2YPLB 2E9IA 2WZ6A 3FO1B 3WGVB 3OTTA 3VB9A 1Z32X 3JWNC 4PY8I 4N68A 3MA9L 4JN2A 1GGCL 3QIWA 1DVFB 2XYCA 4BSWA 4Y1SA 1AY1H 5AZ2L 2AQSA 1EERB 2V2XB 5J6GB 1CLZL 2CBMA 2DL9A 1Q0YH 1T1XB 2A74A 2C7UA 2FNWA 1AQDA 3D69A 4J3OF 3VFTB 2VSCA 5J5EA 2G4GA 4HK0B 5J0BA 4HWEL 1F00I 3SGEI 1R24A 1SXAA 5EOTB 4HV8A 3OXSB 5I0YA 3V4PH 5F9WC 4L3EB 2NY4B 3UTPE 3T6WA 4CU6A 4FS0A 1OB1A 1Z9NA 2X89A 4M61B 5JHDB 1R3LB 3O6FB 4YSDA 1WZ1L 4MB5A 4XCFH 3W56A 3MACL 4JFDE 3L7FB 1KEGL 3VNZA 4JM0A 2YOAA 1NINA 3M1BA 5C0EA 5B4MC 1G1YA 1CE6B 4KKCC 4ONOA 4X5QA 3ZKQD 1CK0L 1ETZA 3JVGC 4G8IA 2DBLL 4LFHG 1N6UA 2GK2A 3PP4H 3HNTH 2FWLB 4WFGE 4ALAL 2ZXWB 3AREA 4PJAA 1UH3A 2CBQA 2GVYA 2RCSH 2VDQH 3QJUB 2P28B 1DJXA 4FJ6A 4Y5XA 3TBTA 3KBPA 2HJLA 4J4PD 2F8VA 5J12C 2JJSC 2HT3C 3U0PA 4FQJL 2VZUA 4AC4A 3RP1A 1T4KA 4L3FA 1IGCL 1SHSA 1XCTB 4CVZB 1BG1A 1KELH 3HZKB 5EUOF 4P3DB 5IMOA 3U79A 3UBGA 4OZFH 5L7XL 3GXTA 1ZVSB 4K8RL 4KRPD 1W80A 3MLSL 4I0PB 3ULVC 5J6GA 4XC3L 5GRJH 2C7UB 3D69B 3GXDA 2EIEA 4DKFL 4XVSH 5BRPA 3GF8A 4PS4H 1HH6B 3QWNA 3S5LB 2Z34A 5AUMB 5MI0B 4JGMA 4JCWA 1SXBA 3AU1A 5HDBE 3DBSA 4XRCB 1T03H 1R9FA 1FZKA 2QVIA 1B0GA 2ITCB 2C9UA 2V8MA 4LBEA 1G9HA 2NCMA 1KTLB 4IBVA 2EIZB 1N7MH 2VC2L 3DROB 4M8VA 3BPLC 4HUVB 4A2MA 4P99A 4FQXB 3BP6A 2F18A 2C34A 2A9DA 1OCOB 2LE9A 2YPKB 3H3BC 4M48H 5DFVC 4L8CB 2F08A 1P4IL 2EIKB 2FEEI 2A9NH 1WZLA 1KB5B 1IAII 3GK8L 2JKRM 3CXDL 1KB5L 2IDSA 3IFLH 4L4TB 5B3SB 4OR1A 4HIJA 1NCJA 1W8NA 1YEGH 3CFUA 4WO4A 1BFSA 5EORH 4PV8A 1BXXA 3DARA 2YQ2A 3SPVB 5IB5A 1QZNA 1Q9WA 3QXWA 2BSSB 1P7KA 2DM7A 4PG2C 5FK9A 1K9TA 1KLFA 5C0ND 3B2UC 4AM0Q 1N2RB 5CIPB 2H2SC 4ZAKB 2XWJA 3T3ME 1OWWA 1YEEL 4I3RL 2IG2H 1H8LA 4CADB 2QVKA 4KBPA 1JNHA 4PYGA 4C56D 5DEFB 1TYRA 2CDEB 4YFDB 1EBPA 1OB0A 1LE9B 3NFPA 2WQAA 4DFIA 2IBZX 1NGYA 2EDKA 2WUCH 1KUMA 3N5AA 2VDLL 2VLKD 5F88A 2V5MA 5AVZB 1JF1B 4H44C 3UH8A 2EYTB 4DN4H 2WVVB 2X40A 3GBDA 4I85A 1U8HB 1WYJA 4H7VA 3U6XA 5J1TC 3L17A 1KT2A 3CZFB 3GBLA 3GZQA 3QIWC 1QA9B 2ZWKA 2UV3A 2VZ3A 4KDTC 4ZUSB 3UTSD 2EIZA 1CF1A 2JCCB 1TMQA 4XGZA 3OMIB 5T1KD 4PP2B 3K7UA 4GAFB 3O81A 2YD3A 3PP3H 3MO1A 2ADYA 3DX8A 4PJ7B 1Y0LB 4U1HB 3VD2A 4U6HA 3APMA 1IKFH 3UC0H 3ARGA 5ICXA 3FSVA 3ZVVA 3QGVA 4XNMB 4FL4C 1CL7I 3L1OH 1J1OH 4ZMZA 1KPRA 5A7EA 2APVA 1OY3B 3VSVA 1K4DB 5E8NB 3EZJB 1FYTD 2PWGA 4DK3A 1D5MA 3CHPA 5IR1B 3FSOA 3CUPB 5CZXD 3DV4B 2JJTC 2F1BA 1IGML 2EZ0C 3BKYL 2X88A 3I6KB 3QZNA 4G9FD 4WI9A 4R5TA 1E5CA 2GT9A 1BVNT 1OGPA 2HVKB 3DO4A 3NH7H 3PXHA 3QUXB 3RFRA 5EF1A 3O8XA 3VB8A 3G6AB 1F6AA 1LO4L 4C47A 4AMXA 5HY9A 4CJ1A 4ZX3A 5J56B 1PSKL 4FRWA 3UTTD 5EU6A 1H0DB 2A73B 1OZUA 1HQRB 1A64A 4W6WB 1IC0A 1LYQA 1N12A 5T5FA 4MMZA 4M29A 3VWJB 1NMCB 4WEEA 5IW3A 3UO1L 3WIFA 1I7RA 4BKLA 1N68A 3NFPB 1A9EB 3ABKB 1HCFX 1FA4A 4JNXA 4RFEB 2O5ZH 3O45A 5DZPA 1AC6A 1KB9J 5T33H 5C6PB 2NX5D 1COBA 3O4LD 5BZWA 3IMWA 2WK2A 1N26A 5IJKC 3MC0A 2Y1ZA 1C08B 3F58H 1WA1X 3INOA 5EU5A 1JRHI 5GRXG 3NK3A 3MRLA 3EXLA 1S7UA 4JFOB 3IAPA 4LAQL 5AW9B 2C3VB 4GW5B 2EACA 2DICA 4WI3A 4Z7NE 4H40A 2GJZA 2WKOA 5KBDA 3QORA 2IANE 5HD8C 1IFHH 4L0YA 2TRHA 5SWSE 4WWNA 4TNEA 3SDDC 2VXSL 3V4VH 5I30H 1NIEA 3DMMB 3TN0B 4G6AC 2E7LC 3BAEH 3MV8D 4Y16B 2C9PA 5K9JL 1I9EA 4DKFH 2N1TE 3STZA 1T1WB 4G3YL 1LDSA 1EMTH 5GGTA 1OK0A 2RALA 5HYJE 1DEEA 1VFOA 2DN7A 4M93B 2XPGA 4XH2B 3ATFA 3DO7B 5CSZB 4OZFA 2CR6A 1ZT7A 5IGXL 1F97A 3ZT5A 4ZDHB 5L2KB 1CGSH 2Y1AA 4X6CE 5FA3B 4BE6A 2I24N 4X4XA 4P9MH 5CFAA 3FCBA 4JAMB 2DW5A 3D9AH 4L23A 4S10A 3AGVA 3IJEB 1I1AA 4GI9A 3ULVH 4Q14A 3DETD 4M62H 5D9SB 5C7XL 3ARUA 4OJDH 1J9TA 1T89A 3SN6N 3HVNA 2AJ3B 1CQKA 2R4RH 4NHUA 2PN5A 4RWYH 3KLHC 5CCJA 3CXHJ 5T1LB 3FU7A 1DQJB 3NIDE 4K3DH 4B5ZA 1A6TB 1HX0A 1Y6KR 1S7TA 2WLLB 3I75A 3ARZA 2BSCA 2AJXL 3QE5A 4ZO9A 4AVIA 3GXNA 4R4NC 2EVGA 1C12B 5EEZA 1GZQA 1C1EH 4MNQD 4ALAC 2C9XA 4BFIA 1NAKH 2FAUA 5PAZA 1RIUL 1SNRA 3VMPA 1RZKH 1YYML 4Q8BA 3VRLF 4MNHA 4R7NB 2B8OT 5IF0A 4L9DA 4YEEA 4F58L 1KC5L 1IBGH 4AEHL 4XPBH 1SMAA 1Q72H 3PUUA 4MNQB 3US9A 2IWGA 5AVUB 3L9RA 4IMKA 4QRFA 4N22A 3WI9A 4JDZB 1ZS2A 2YXFA 3C08H 4FC3E 4Z76B 3ARPA 4U6YB 4E9TA 1J87A 1RZJH 2FRGP 2FWOA 5DC9B 1MELA 2OP4H 2R9HC 2A83A 5B1CA 4ZFQA 1UB5B 1E2WA 2ITDB 1LLAA 3EJRA 1IAIM 3D30A 1FG2A 1KCVL 2X70B 1QNIA 2J1XA 4KNTA 4M6OH 4F8QA 3MRMB 3IETA 2K0RA 3C5JB 2ZYSA 3EO9H 3FHAA 3FXIC 3MZTA 5HHNA 1HSAB 4DN3H 5F3BA 2IV9A 4NO0B 1YVLA 3L7EA 1CDCA 5I8CA 1XF5A 4JO4L 4FYSA 4YHYC 4P2OD 4JQVA 5AVSB 3MUHL 4G6JH 1TZHB 1FNEA 1OW0C 3DV6A 4FQQA 3PWNA 2C1PA 1TNMA 4AT6B 1R3HA 4PJIF 5FS5A 3SQBA 2AXGA 3VFOA 5LDUA 4JKNA 3TBWB 2RQEA 4HWBH 4OVUA 2JIXD 1SQ2N 2IMMA 1C7TA 3IAQA 1I9RH 5ENWA 4JRXA 2I07A 2PW2B 2KYIA 4DP6X 4HPHA 4EZLA 2NTFB 1WA0X 4LFHD 1PD6A 3G5VA 3MFFA 5JIPA 4K4KA 3TN0D 3M07A 4XE0A 4OU3A 3HE7A 3KW7A 2HJFB 5EU7C 3K3QA 4FJYA 3ZDXB 1DANT 1I9IL 1RUAH 1I7TB 5KJ7E 5HHXL 3AT8A 3HI6H 3V7MA 3SDAC 5KN5B 4C4UA 3BH8B 4P3CH 3K0WA 1TTRA 1D6VH 3SOBL 4QHLB 4E41D 4YDZA 2P42B 4WWID 5CLXA 3F3HA 3GGWB 1BWMA 1U0QA 1XCWA 4X7SL 2EDTA 5D5ME 5KTEL 4RAVB 5EOCL 5E6ZA 3JXAA 1X5AA 4Q58C 2CUMA 1YEDB 5I76A 1YNTF 2FWOB 3K81A 1NCOA 3UP6A 2OYKA 5E94B 4LF3A 3IK2A 1I8LC 1PX8A 1JSYA 1UD6A 3FTGB 3M6DA 4UTAA 3SPGA 2NR6C 3VGHA 3MJ8A 1SN2A 1ZE3H 1HHIA 3BP4B 4P9HC 5GZNA 4PMFA 2AS5M 4FFYA 1FO0A 4MXVE 2E46A 2YAMA 4AEIH 3WFCL 1IEHA 2DJSA 5K39A 2BRRL 2ZKHL 1DUYA 3O9WC 4GRLA 4WI4A 4RZCB 3L4XA 2BNQB 1OP5K 1U58B 4G5ZH 4YPJA 5F89B 3VFOB 3NFNB 2VJ0A 4JDVA 3VXTA 2HX7A 2VDNB 4TQHA 3ULAB 3GIZL 3S36H 5IIEB 1UH4A 2Q1EA 4J28A 4X9FA 3QFJD 5KSAC 3QZWG 4EI5C 1CLYL 4OFQA 3RX9A 1DQDL 3IDGA 4G80A 2IANB 3JV5A 5H94A 5CEZL 2O5YL 4DTGH 2K6YA 3HPJA 4TLTA 4N0CC 4X8GA 2Q76B 4R26L 3GJFH 2EYRA 2L4OA 3H55A 3L6FA 4FXKA 5DRXB 4QKXB 4DVRL 2Y23A 1T6WA 3Q5OA 2OMTB 5ICZB 4AL8H 1NC2A 1AGBB 1VADA 4B27A 1CGXA 2XKNA 2R7EA 3GMOA 3RB5A 2O72A 2YGPA 5A2KH 3CFCL 4D9LL 5C6WH 3GO1H 2JELH 1ZHLA 1NLDH 2W80C 4M03A 1H3PH 2VLKB 1ZMYA 2FWSA 4KY1L 4P23A 2YD1A 4R84A 3SKJL 1J9CT 3LZFH 3B7YA 3LZOA 2QQKH 3FMGL 4JS7A 3JUZA 1NTDA 4LF3B 4XMTA 2Z91A 1U3HA 2BH0A 2R23A 1B4LA 2D0FA 2G3NA 3QJRB 3CC5A 3DX3A 4WGKA 3UBFA 4FMFA 4FG4A 5TQ2L 2X9WA 1RK1B 5HGGS 3T0EB 1T66C 4PJIA 2XWBB 3NCWA 5K93A 1LDPH 4YE4H 1XGUA 3K1DA 4FLQA 3R1GL 3Q6FB 2EEFA 4GRLB 3QDJA 2CIKB 4CUCA 1CDYA 3L4WA 3PRZA 4L8BB 4A6YH 2XC8A 1GPOL 1KIUB 2YZ1A 4DO5A 1PKQE 1I75A 1CFBA 4JFZH 1E5ZA 1VIWA 2PO6D 5FYLH 3K46A 1L9OA 5T3XL 4F15B 5EF2A 3GSNH 4U7SA 1BGXL 5H94B 1NCIA 1BJ8A 2NOYA 5JDJA 2H32A 2Q3XA 4U1JB 3DX2A 2EZ0D 4JZNA 3DNKA 3ZU8A 2WTRA 1PJ9A 3MRFB 1JZ8A 3ELQA 4X9YA 3S36X 5HPMB 5DHVH 3D85D 3ZDZE 2H26B 1ONQB 3HI1A 1ES0B 4W81A 3HUJF 1JFQL 1SRDA 1WAAE 4G83A 1CYWA 4OLZL 4HIXL 1W72H 5F6IC 1YMMA 5IEKB 4IBUA 1KACB 2J55A 1K8IA 1T1XA 3VFTA 4AQ8A 3H42L 3PGDA 1TZAA 2V5RA 4PJ5B 4DO4A 1Z66A 2G75B 2VM4A 4PRID 4FHJA 1TVHB 1BAGA 2P8PB 1HZHL 5D7SH 1DSFH 1ED3A 4ZAKD 3GB7B 2Y25A 3GLEA 4NWTL 4L3EA 3VI3B 2NW2B 3TGXA 2G3XA 4N86A 4KKLC 1M6OB 4JJ5B 3I2CL 1W72L 2APFA 4AGMA 1QYGL 2YO3A 4YR6B 4F58H 5AVWB 3UYOD 4EN2A 4ADIA 4F7TA 1GRWA 1UJ3A 2IADB 4N2DA 1ZGLA 2OX5A 4LPTA 4ZOAA 1ZLUK 2G2NA 4JO8A 3MUGA 4JHAL 1INDL 2JKLA 2A77L 3KYMB 5KYUB 2E6JA 2P7TB 5KS9F 5C09A 3BE1L 4F8LA 1CICC 3IB4A 3SY0A 2MFNA 4JHWL 4PJAB 1WZ1H 3FK3A 4MXVF 4QKTA 4XCFL 5GIRA 2C1OB 3MCG1 4HXAL 1DR9A 1A66A 2O5NA 3FQRB 2W0LA 3IPEA 5E6IB 4HFWA 1E8XA 1W72B 2Z7UA 4FMKA 1NAMH 3NRFA 3MRFA 4HVBA 1JZDC 3TV3H 3AMLA 1U8IA 1W15A 1WD8A 2ZXBA 2EIBA 2B20A 3CN2A 3IFOA 1TIUA 1DE4B 3UYPB 3WMQA 4V1DD 1MCOL 4AUYA 4CVZA 2FVNA 3S88L 4MDIB 3LKSB 3ZO0A 4TVPL 1I85C 4WU5B 2WZAA 1UT1A 2Q8AL 2A7BA 2BNQE 2FYVA 4DGVH 2QQNL 4QI3A 4HC1H 1P7HL 2OSLB 4G6MH 4XBPB 3W37A 3F6LA 3NSJA 1BQKA 2WWKT 5KS9B 4XB3A 4HXBH 1FIGL 1E7UA 1J8HB 2J6WA 3CLWA 3ULUD 3H7BB 2AXFB 2FX9L 4ZFFB 2FQDA 3UJIL 3GMQB 2VN5A 3MFGB 2OMWB 1BIHA 4L5FL 2JSFA 4MAYB 3T6XA 1F90L 3UAAA 1RIHH 1DJYA 3VXRE 1CFVL 4Y4KC 2Y06H 4NOFA 3WUZA 5HBBA 1EJFA 3UIZA 1RAMA 3RPIA 1RURH 3FO0L 3KLLA 1UZ8B 1M6OA 4I1RA 4JRXE 4PJGB 4MCMA 3DUSB 3IDMB 2R0KL 2BW4A 1BP3B 4L1BA 4U7MA 4ODSH 1U8NB 1IIIA 3V0FA 3RYMA 4JFPA 1H5BC 4LVNC 2YD7A 4JDTL 4GKZA 3QWRA 1VPOH 4QHMB 1XVSA 3F7PC 3EUDA 4DFHA 3HE7D 3VW3H 5FUZH 3V9CA 1EFXA 5D6CB 3O41A 5B39B 5KYUA 3AY4A 3MLSH 4Z9KB 1GVIA 6TAAA 5JPNA 1JNLL 1PLGL 4HWNA 3S35H 3D3VE 3WTSA 1IB5A 1MZZA 3U7WH 3ZUNC 2XTJC 1PKQA 4YBHA 3L81A 4PIBA 5J6HA 4YQXL 3BT2L 4FFWC 5BRZD 1CLYH 3BSHA 5L4IA 1MG3C 1YYLL 2QV2A 2YAEA 3NT0A 2DQUL 2VQUA 2X4QB 1H8SA 2BSTB 3OKLA 3QS3A 3MRQB 2XZAH 3ZHFA 5J7CC 3C2AH 3EH3B 3GMLB 4LKCA 3UYRH 5I1JL 3VD4A 5B38G 2BFGA 5I5MA 4AQ8C 3IVKB 3EO0B 1SY6H 1MFCH 2CLVB 4LSQL 5AWNL 2YK1L 4RFNC 3VWKB 1ZIAA 5EF0A 3VXPB 2L7JA 4NCC2 4NBXB 1DQQA 1OF0A 1HH9B 4QTIH 3V4UH 1GJWA 3QPQD 4BXSV 2BMKA 5DMJB 3L5XL 2MTAA 5BCAA 2NSQA 1K8DB 3VXSB 1P4LB 2WXPA 3S3CB 1NGYB 2X1XR 2AK4E 4FABH 4CMMA 3WGUB 2EVHA 1E4JA 4U49A 1JNNL 1L7TL 2J72A 4IHBA 1V8HA 1M05B 5IVZB 3CFTA 4KQ4L 5ESQB 4AGOA 4XMKH 1EXGA 2IDCA 3MA9H 4GY4A 1UTDA 2XV0A 1ZHKA 5JLZB 3O0LA 4AKPA 4GKSB 1JK9B 1WHPA 3PDOA 1EVUA 3F85A 3OMZA 3EYQC 4JGUA 4PJ9D 4FXGA 1BJ1H 2RAMA 5HHOD 4KI1A 2Y5EA 4R96A 2CPCA 2PYFB 1GXEA 3SPJA 4QLRA 4MX7B 3U1SH 4GP4B 5JORA 4JVWA 1T03L 1KPVA 1XTMA 4ZPVB 3IDYC 3KH3A 3C5ZC 3RU8H 3BEWB 2B2XL 1CD8A 1SGKA 1G7PA 3VXOB 2KZ1B 3ARRA 4DP2X 3NIGE 4XNXH 5A2CA 3CU7A 1DQLL 1DQIA 3H8NA 5HYJA 3L3DA 4M56A 4J4PC 5E03A 3UZVB 5JW5B 1PKOA 4NNYB 3ZDYB 1HKFA 5TK2A 3PIQA 5IMOB 5MEQB 3GSRA 4HW6A 2V9TA 5D7IF 3HR5B 3HKFA 4G72B 1LHZA 5GS1A 4PRDB 4WW2F 1PG7H 1I4FA 1BAWA 1MHEA 4P23C 3ROLA 4AV5A 3FUEA 1KCLA 5AZEL 5HVFB 5AVYB 3U0TA 4E9VA 5HI4C 2GAZA 4PJFA 4RGND 2HG5B 3D1MC 4Q4EA 1OPOA 2DM4A 3NGBC 3KLAB 4POYA 4QTFA 5IVZA 1I3GL 1OOWA 3ZDYF 1CK0H 1OGTA 4IU2A 4YLCA 2VXVH 2FECI 1MRCH 2C3VA 3HFML 1X9LA 1MIML 3V0VB 4KKZA 4JHAH 2V9UA 4LL1A 4RVBA 5DHVB 2O93L 1R0AL 1U8CA 4WK2B 3V6FA 2DTSA 1MWAB 2YPVL 4JFYB 5IMLB 2KPNA 3C6SB 2EXYC 3F8UB 3Q7JA 1YN6B 4JY6B 5LBSL 5AEAA 4D8OA 3E6FA 1OHZA 4Z7NB 3D3VD 1M1XB 5ISZD 1MJ8L 2P9RA 1T1YB 2J71A 4NZTL 3J7HA 5E8EB 2BHUA 2IF7A 4WTWA 3WE6A 3X1FA 4E41E 3LIUA 3NIFB 3DPDA 3SO3C 1I7UB 3ZIMA 5AL0A 4K15A 5EEVA 4H8WC 3RVTD 4C4KT 5BQDA 4XC3H 5G55A 3OC8A 4W4OA 1YY9C 3BP5A 5DC2A 4XNQB 5FWQA 5JPMC 1JZ5A 2XWJB 3ZE0E 4TUOA 3L95A 4OCNC 1M71B 1BBJA 4HUKB 4PRDA 3O2WH 4YSQA 3VH8B 3I02B 4TXVB 1IC5L 1YMHA 1YHPA 4OZHF 2Y7MA 3HS0A 5C92A 4M5YH 3BGFC 1RULH 1PLGH 2H7WA 1FVDB 1TOXA 5EU6E 1JXJA 4F91B 3EUUA 4NO2B 1LWRA 3U9UB 3LKRB 3A6BL 2K4WA 2JJWA 3P73A 5D4QA 1L0YA 2DYSB 4HBCL 5ILTL 5DVKA 2PMZA 1OGTB 4IU2B 2DQIL 4YHML 2BXZA 5E8DH 3GSNL 3VM5A 5HHOB 4NN6B 4Y0GA 1NBCA 3ZQ9A 1Z2KA 2LU7A 3D39B 3O6MH 1F6LL 4KX8A 5ACLA 4TMPA 3OX8A 4PJ7A 2VXSH 2UY6B 4H0HB 3V4VL 1CLOL 4QRRB 3TASA 1AP2B 3QW9A 2AI0L 3VAEA 2G5BA 2YWYA 1U8LB 3BQUB 5DQDH 4LVHB 1GH7A 1DO6A 1KEML 1ORSB 4LLQB 3G08A 3QJFA 4WKXA 2M83A 3BVUA 5DO2D 5E2JA 3UACA 2XX0A 4LAQH 1SJVA 4XO5A 3F84A 3D09A 5CD3B 1GSMA 2D4DA 4IOFD 2COQA 5DJAA 3KS0J 3EBGA 3VRJB 4FQ1L 2JJVA 3QCTH 1E43A 4FNUA 4XC1H 5DLMH 1AYRA 4EN3C 4N2IA 2HLFC 4APQA 3VRIB 4O2EA 4JDEA 5F1SA 3HLAA 3WJMA 3UIYA 5HHNB 4XPTH 2B1HH 2OL3B 4NGHL 3QQDB 3X14B 1GYVA 1GAFL 2KZBA 3W0WD 1HQRA 3II2A 2WSPA 1RZGB 4G7SB 4KQ3L 5B1AB 1QRNB 2R4SH 4S1QH 2BOBA 2WLIB 1Y18A 4ONGL 1TZHA 5C70A 5I8OH 2Z4QA 1ZVYA 2ZXEB 2F2HA 3B83A 4L3ED 3IRZA 3RQ3A 1JD7A 3F5WB 1SY6L 2OZ4L 3NEOA 2NTSP 2FHBA 5CKGA 5GGRY 1BG9A 3DXAA 3KDMB 2K8MA 4ZUVB 4ACTA 4P5TC 1LO2L 2RJMA 5I15H 3LKNB 1JWUA 5DMIH 4NQED 4BFRA 1DN0A 1DQLH 2H6UA 4WNSA 1OAZL 1PEWA 2RH0A 3L1OL 3RWCA 3X2QB 4EDXA 2PCPA 1X7QA 1F6FB 3IXAB 1R5WA 1ZOXA 1YC7A 2I32A 5ICYA 4YSRA 2VLJE 1BQRA 1LMKA 2E3VA 1HDMB 3OB0K 4N24A 2E4TA 3J07A 3CPLB 4PYHA 1IFRA 3MOBL 1KIQA 3W5NA 4JPWL 4P05A 4FULA 3SYOA 1AQKH 3C09B 3VFRA 2HPTA 2DYPA 1G7IA 5DJAB 3GC3A 5GISL 1BLNB 1G9M