3RYMA

Structure of oxidized m98k mutant of amicyanin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFKRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Replacement of the axial copper ligand methionine with lysine in amicyanin converts it to a zinc-binding protein that no longer binds copper.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 24
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3rymA00
1JERA 1IBYA 1JOIA 2WO3B 4DP4X 1J5CA 3T71A 4BDVA 4HCFA 4BWUA 3PLYA 4WTQA 1OE2A 2VMJA 4FA7B 2IDUA 3S8GB 1PAZA 1HAUA 3X1GA 1A4BA 1JVOA 1GY2A 2YAMA 4YVUA 1W6LA 4F7KA 7PAZA 5I6MA 1ZDSA 1PNCA 3QJTB 3UAEA 2EINB 2YAPA 4G7RB 1NINA 3WKPA 3X1EA 3RYMA 1AZCA 2QPEB 2PPFA 4HAKA 2XXGA 1ASOA 3TU6A 1WA2X 4KO5A 1MG2C 3FU9A 1GR7A 2UXGA 2J55A 5D4IA 1B3IA 1SHXA 3L45A 2X87A 2BP8B 4KOBA 5EHFA 3KW8A 4DP7X 3S3CB 2CUAA 2BW4A 3V9EA 1RZPA 2DYSB 1KDJA 2IH8A 5B1AB 4A67A 3T6ZA 2JKWA 5B1JA 3H56A 4DPCX 1TU2A 5D4HA 2BP8A 2IWFA 2XXFA 1X9RA 4E9WA 1FWXA 5AFAA 3JTBA 4AKOA 4E9SA 2GSMB 1WS8A 2FJSA 4G7SB 2FT8A 2P80D 4CSPA 1GW0A 3OMNB 3EH4B 3SBRA 4DP8X 1J5DA 3IN0A 1J9QA 3AG2B 1NIFA 2VM3A 3X1BA 4DP1X 1KCBA 5I5MA 1L9OA 5F7BA 1UATA 3WI9A 1N68A 2XX1A 2UX6A 3NJFA 1PF3A 3DIVA 1W8EA 1A65A 1JZIA 1AS6A 1WAEA 7PCYA 2XV3A 2Y69B 2ZOOA 5B1JC 2BWDA 2EIJB 3NJHA 3MBWB 1KV7A 2H3XC 2QPDB 1FA4A 4A68A 2CJ3A 5AZUA 3UACA 2TSBA 2VSKB 1AR1B 3PAZA 3ABLB 1ADWA 6PCYA 3CDZB 2AZAA 3FPYA 4HIPA 4YVNA 1WA1X 2BO0A 1KBVA 1PY0A 2J57A 3X2QB 1NWPA 4JHUA 2DV6A 2YAOA 3FU7B 5E9NA 4JKNA 3NJKA 1JZFA 1SF3A 3HEIB 2I7OA 3OD3A 4L0PB 3CDZA 4N8UA 4A66A 3NSDA 4KO6A 2W88A 3T6WA 4F2EA 1M56B 4ZK8A 4GP4B 1RCYA 3FU7A 2OV0A 4KNSA 3SBQA 1IBZA 1AS7A 1OOWA 1CUOA 2DWSA 2CALA 3TASA 3G5WA 9PCYA 1JXGA 1EZLA 1BQRA 1L9PA 2PPCA 3ZIYA 1HAWA 2HX9A 1L9RA 2UXTA 5B7MA 2YAHA 4P5SA 2TSAA 3AZUA 2ZONA 4YSRA 2PCFA 2YXWA 2IDTA 1E5ZA 3MX0B 1ZIBA 1M57B 2OCCB 2ZXWB 5IY5B 2HX7A 3NT0A 1E67A 1PLCA 1XB6A 4E9VA 4WKXA 2R7EB 3ABMB 3NJMA 1OCOB 3PXLA 4A2HA 4ENZA 5I5IA 3PPSA 2AANA 1BEXA 2HX8A 2BZ7A 4AX3A 1AZBA 1RZQA 1SDDB 1ZV2A 2N0MA 6PAZA 2MTAA 3FT0A 3ZDWA 4E9RA 2YQBA 1MZZA 2R7EA 1ET7A 5AKRA 1IC0A 2UX7A 2GC4C 4GP5B 3FPXA 1OCRB 3EH3B 4QLWA 2FQDA 4G7QB 1SDDA 4E9YA 1PMYA 3OQRA 2GIMA 2BWIA 4P5RA 3IE9A 1ASQA 2B08A 4GYBA 2FT7A 1QLEB 2I85A 3FSAA 1WA0X 2GHZA 1E30A 4HHGA 2DYRB 3AW5A 3U25A 2LLNA 1IKOP 1X9UA 1AZNA 1KYAA 2I7SA 3TBBA 3TA4D 3CVDA 1OCZB 2XX0A 1NDTA 2AZUA 2QT6A 1ILUA 5I6KA 1NIAA 3FSWA 1BXUA 5I6LA 2J5WA 4YSTA 2MRYA 1EHKB 2UXFA 1PZCA 3NP3A 1TEGA 4K9JA 5B1KA 2VN3A 2FNWA 2CAKA 2YAEA 1AAJA 3SQRA 1OE3A 2WO2B 4W1TA 1ID2A 2UXVA 4UAHA 1MG3C 3BQVA 3UADA 5I6NA 1TEFA 4AZUA 2IWKA 3X1NA 1GYCA 2YAQA 3UAAA 2X88A 2PLTA 1NTDA 2XV0A 1L9TA 3FSVA 4Q89A 2H47C 1AG6A 2HLEB 3CG8A 2H5UA 3NJGA 2ZWNA 4A2FA 1PCSA 4YSDA 2EIKB 1OV8A 2FQEA 2XYBA 1NZRA 2HZHA 5TK4A 2HXAA 4AKQA 1M9WA 2GI0A 2FQFA 2IDFA 1F56A 1SNRA 1AIZA 2CCWA 5B1BB 4F2FA 3N2JA 1NIEA 1AOZA 3KW7A 3QJUB 4Q8BA 3FQ1A 2JXMA 3NSYA 3S3BB 4YSPA 1JXFA 4X4KA 1AANA 2XLLA 2XWZA 1V54B 3HB3B 4DPAX 1SJMA 3OMAB 1CYWA 1GS8A 5FC9A 2YAFA 4JHVA 2GB2A 5B7EA 5A7EA 2PP7A 4NAJA 4YL4A 1QHQA 1BYOA 3WNIA 1OF0A 2IAAC 1JZHA 1SF5A 1KBWA 3FS9A 8PAZA 4NERA 4YSUA 4EF3A 1GS6X 2BP0B 1ASPA 3QPKA 1ET5A 2DWTA 1MZYA 1XB8A 2IH9A 1KCWA 5PAZA 1AG0A 3NJIA 2PPEA 2PP8A 1BYPA 4MFHA 2OJ1A 3QJQB 4YSEA 1IUZA 1ETJA 2BP0A 2WSDA 1FFTB 4FAAB 2FTAA 2GBAA 3EF4A 1T5KA 3EHBB 2BZCA 4KNTA 5I6OA 2EIMB 1QNIA 3WG7B 3T6VA 4AKPA 3ASNB 1OE1A 3T9WA 2XU9A 4BWTA 3N55A 1TKWA 1WS7A 3PAUA 2IWEA 1PZAA 1AZRA 1DYZA 1SFDA 1ZIAA 4G70B 1A4AA 3OM3B 2EILB 1PNDA 2YXVA 2XV2A 1SFHA 4G71B 2XUWA 1V55B 1AACA 3T6XA 3DKHA 1BQ5A 1NPJA 4GP8B 1A4CA 3ZX1A 4NB7A 2Y1AA 3AG4B 3ABGA 3X1FA 5B3SB 2DY2A 4KOCA 1MDAA 3FYIB 4A2GA 4HZ1A 4BK5C 2FT6A 3QQXA 1PLBA 3AG1B 1GSKA 2XVBA 3NP4A 4PCYA 3V9CA 4KNUA 5I26A 3ERXA 1JZEA 3OMIB 4HCGA 2BW5A 1R1CA 4GXFA 4M4RB 1YLBB 3IN2A 4BWWA 1J9TA 1A8ZA 2YARA 3GYRA 4QKTA 5I28A 3EH5B 3UABA 3PAVA 2P80A 1CC3A 4UANA 3QJVB 2GC7C 4HCIA 1NIBA 2PP9A 4DPBX 4DP2X 1BQKA 3S3DB 5I6PA 4RH4A 5ANHA 1XB3A 4AI7A 1W6WA 2VW7A 2RACA 1NIDA 3FYEB 3DTUB 3AY2A 2FQGA 4BXSV 4W9ZA 3NSCA 4DP9X 4DP0X 3H4FA 3JT2A 4YSCA 4M3HA 1NPNA 1J9SA 4TXVB 4G72B 3WIAA 3CVBA 1JZGA 1ZDQA 1XMEB 1AQ8A 5I5JA 3UGEA 1BXAA 2HRHA 4YSOA 3CZUB 1ET8A 1A3ZA 3PCYA 4PAZA 1CURA 3NJNA 1HFUA 3S8FB 2Q9OA 1I53A 4HALA 3IEAA 1ILSA 1KGYE 5PCYA 4BXVA 3GXUB 1CYXA 4YSAA 1L9QA 1VLXA 2CBPA 1ZPUA 2E86A 3NJJA 3SBPA 2PCYA 3WNJA 2VM4A 1RKRA 1GS7A 1N70A 2JFCA 1BAWA 3AG3B 5TK2A 3QJSB 3CVCA 2QDWA 1NICA 3WKQA 2A3TA 4CSZA 3FQYA 5B7FA 1V10A 2IDQA 2W8CA 4E9TA 4N4YB 2HRGA 4YSQA 3ABKB 4KO9A 3ASOB 1AS8A 1E65A 1JVLA 4DP5X 3C75A 3FQ2A 2NRDA 2PPDA 1URIA 4UF7C 1GY1A 4KO7A 4E9QA 4A2EA 2J56A 3H4HA 3ZBMA 3QJRB 1SHWA 5LDUA 2VW6A 3NJLA 1PLAA 2QDVA 4GY4A 2VSMB 1DZ0A 1NWOA 1KDIA 3IBOA 2Q5BA 1AZUA 3GDCA 2IDSA 2FWLB 3FU8A 2B3IA 1J9RA 1L9SA 3D12B 5D4JA 3NYKA 3NSFA 4A2DA 1JXDA 5F7AA 3BVDB 4BDVB 2PPAA 2VW4A 1JZJA 1BXVA 1OCCB 2AFNA 2AVFA 4DP6X 4E9XA 4YSSA 1E5YA 1PZBA 3TBCA 3FSZA 4HHWA 2BHFA
chains in the Genus database with same CATH superfamily
1E8ZA 1JV5B 1J5CA 1I9RH 1JWMA 4Y9CA 1VFBB 3RPBA 2QHRL 4WTQA 3S5ZA 1YPZA 4YHML 3WHE1 1TQUA 3VXQB 3QIWB 2XRAH 2DMHA 5DA4A 3WTXA 4XC3H 3KXFB 1JPEA 1YYLL 3AMLA 4IDLA 4OGXH 4IM8A 4N22A 1P0SE 5GGRY 5B22A 1CE6B 2QVFB 2R0LL 4QXWA 2E3VA 1MG2C 4RBPH 3FU9A 2YA1A 4QTHA 2B59A 2Y06L 4ELME 3GMOB 4L9LB 1TU2B 2AS5M 4OUUB 1T83A 2NX5D 3WFCH 4ZOAA 2D31B 1EHAA 1F6FB 3TZVA 2D8KA 5HDOA 1TNMA 2BW4A 5HJ3A 4W6YB 4R0LC 1A8JH 4P46D 2XN9B 4LSVH 3V5DB 4MMXC 1NL0L 3QNXB 5JW3H 2FUTA 3H0TB 2NY5C 1G7JB 5HDQL 3MTXA 1KCRL 4L1LA 4MASA 3W0WD 5K39A 2DWEB 1FL5B 4G42B 4XXWC 5HYJD 2QTEA 1LWHA 2PETA 4WWPA 4P59H 3ZKND 1KENH 3EUUA 4JFDD 3V0VA 4ANWA 1K8DA 1PJ9A 4LLDB 3CC1A 3DVGB 5JW5B 2FD6H 3C5SB 4PGBB 1CGWA 2ZSWA 4EI5C 1NKRA 2UX6A 5ICZB 3VXNA 5FKPB 4MD0B 5FA3B 5FF6B 4PD4K 4UQ3A 4XVSL 3IDUA 2BNRA 2JTDA 2ZOOA 2C26A 5AOJA 2H1PH 1AMYA 3CHOA 1SUJA 4XP4H 4QCIA 2E0PA 1DE4A 4ONOA 4GUQA 1UD3A 5C0AB 4YDKH 2NY3C 1I4FA 2K6ZA 5AAMC 1HH9A 2YWYA 2FWUA 3PAZA 5IV2B 4HKXB 4UV7L 2DMKA 4M8RA 3FOLB 3E8UH 4WU5B 5B39A 4M7LT 4RX4A 4OTXH 5HYSG 4HIPA 3AMKA 3MUZ1 3NA9L 4J3OF 2ITDA 4XMZA 3IPEA 2VDOH 3IXTA 5IJBC 1F1GA 3C2SA 3NDYE 3MNMA 3BAEH 5JOPE 1IGFH 5IB1B 1XAKA 1OAYH 3ZYJA 5GZOA 2L3BA 1N6QH 4Y1AA 1OSYA 1C08B 1F6AB 5MEOB 1A4JA 3GIZH 4HWEL 4WWKC 4XNMA 2F18A 3FRUA 1HL9A 4LVOC 2YPVH 4DK5A 1XF5A 3PWVB 4ODUA 3RZCD 3REWA 4PR5B 2WLZA 3H9SD 2CKNA 2YKKA 4I18B 1M1SA 3LNFA 5IMOA 2AK4B 4X4MA 5AAWA 4XMWA 2ZAHA 1NDGB 1UACL 3CCHB 1OAZL 2EH7H 5D1ZB 4MJ5A 2ID5A 3K7UA 3KMDA 3V5HB 4KDWA 1I3GL 2JJWA 3KS0H 1AMXA 3Q2NA 1SXAA 1ZIBA 2X09A 1GW6A 3L3KB 3U6XS 2EDWA 4GW4A 1D5IH 3B7UX 4U31A 2NY0B 3D2UD 2VXTL 4E36A 1IAIM 4Y2DA 1OCOB 3FB5A 5CFHA 1KBGL 3SD2A 1BEXA 2Z64C 3QJZA 5BS0E 3UPRB 3SO3B 4RA0C 3VFNA 2B59B 3CFKB 4JM2D 4J3OG 4B7LA 1ET7A 2QSCL 3CGTA 4PYHA 1S7WA 5FYJD 1MLCB 4XR8C 3V52H 1Z9OA 4MAZA 3MLXH 4Z7WB 3O6LH 1I1CA 5I71B 4W81A 3IE9A 3QHFL 4K7FB 4KROB 4ZPTB 1U8IB 5JUEL 4OCWH 5DD6A 5C0DA 1FZOA 5DK2B 1WA0X 1PDKA 5IROA 3DJSA 5BRPA 3AW5A 1ROWA 3AS2A 3S36L 4ZTOH 1HHHA 4WWOA 3EH1A 1Z6JT 2O5YH 2W1NA 5AG9A 1O6SB 1XF2B 1EZVX 3AAZB 3O8XA 3F6JA 2IVFC 5B3JF 1MJJB 3ZZSA 3ZE1B 5E8OA 3RJDA 2VITB 4YSTA 5C0JA 5ABZA 3ULVF 1XL6A 3BEWB 1TEGA 4EI5D 5JQIB 5DC2A 4L4VA 3OKLB 3MLSL 4UTBL 1TTAA 2R29H 3IB4A 4OLEA 4R84A 5KS9A 4G6ML 3U4EA 5CXPA 2J8UE 1LMKA 4Z3JA 4IGBD 5EU6D 3VO0A 1T4KB 3KAAA 4KX8A 4UAHA 1FAIL 2OMVA 4MKMA 3KPPA 3IDYB 5IHWA 3NPZB 2HJLB 2NY3D 3SHSA 1UURA 4DQAA 2WXHA 4LGSB 4MXWL 4IRJB 5F9JB 5I1IL 1DVTA 4RVBA 5EN3A 2VXSL 1I8UA 1PLGH 4PLNC 1EJOL 1QW9A 3EYOB 2B9AA 4B60A 1DVFB 1J9CT 3BCDA 5GIRB 2P42B 5J1AA 1MFVA 1T1XA 2XYBA 5KVFE 1EMTH 1F02I 4JY6B 4HZLA 3DO7A 3UGXA 1PD6A 1ZGLP 2CR3A 3ZRSA 1QSEE 4AKQA 1U58A 4F2MA 3OKNA 1XH0A 2GI0A 1SNRA 5KVFL 2I25N 4PTTA 4PV9B 4K94L 1PKQB 2WINB 1IIIA 1FORH 2UV3A 3ZKQD 4ELDA 2B1HL 3ZIMA 2H8PB 4KJYB 4L0YA 1NBCA 3TNNA 1WUZA 5EIVA 4G9FD 4OGZA 3NCFB 1JIBA 4HFUH 4ETQA 2X9YA 3OHXA 4ALAC 5FV2A 3TS8A 3O9WA 3TBWA 1NMAL 3DK0A 5KOVC 2DL2A 2YAFA 3MRDB 2C9PA 1SQMA 2GB2A 4ZTPL 1K6QL 3LX9A 3E6HA 3PDOA 4NAJA 1A7QL 2F58H 4FQXB 5EC1B 2DWXA 3FS9A 3S4SB 1Z3RA 1ES0A 1H3UA 2IV9A 1FN4B 2UYLB 3F7QA 4AL8H 1KIQA 4NQEB 5GRYA 3GGWB 1SBSL 2QSQA 4I1NB 3QG6A 3PE9A 3K72A 4MMYA 4NIKB 1TQVA 5KSUA 1RK1B 3HIZA 2GEEA 4JVUA 1OK8A 3VFTA 4L3AA 3DRTA 4PP2A 5C0GA 1U8QB 1IUZA 3PDGA 2BP0A 4NQVA 1B88A 3W9DB 1MRFH 3IGUA 4IKLA 3VU2A 3L54A 4N6RA 1CL7H 2VISB 4QXTB 1S7WB 3IMUA 4HWNA 4PJIF 5BZDB 3WG7B 2NY2D 3CVHA 2I60L 4ES8A 1GC1H 5CJ8A 4ZUUA 1OWWA 5IK3B 5LCVA 3N55A 3PAUA 4NRXB 5AVWB 1G43A 4G70B 2YD6A 3L16A 4O02B 3RDTA 1TO4A 1F97A 1CFBA 2R83A 1RZ7H 1RP8A 3CQFA 3GSNH 2CA4A 4L48A 4NN5B 2P5EE 2N59A 2R2CA 3VGDA 5ELIA 2Q8AH 3QPXL 4JDEA 4E41E 3CMGA 2DWYA 4R7VA 4IRSA 5ALBH 2CCLA 3NCEB 1HESA 5FS5A 5F6HI 2BVOB 1GOFA 4GT0A 4IBQA 1NFDE 3NSJA 4X6FB 4GG6A 3L7FA 2GSIB 5E8NB 1IAII 1WK0A 2X05A 1BG9A 2NUPA 1ZVNA 4O51A 4L2LA 3TLRA 2FHBA 4BGDA 3W38A 4MNGB 4AQ1B 4DEWA 3ARVA 1HCYA 3VQ1C 1BF8A 3WHXB 3ROLA 2O93L 2HAZA 2O6DA 2PWHA 3IN2A 2VN7A 2WYZA 3MXWH 5CJBA 1NCJA 3K2UL 1PFOA 4P57A 4OZFH 4WO4A 2ZKYA 6FABH 3QYNA 3MV7D 4K3DL 4OF8A 1BFOB 1S5IL 1WZAA 2I07A 1HE8A 4GXVL 4K7PY 2GC7C 2CRIA 1A2YB 1NFIB 3F8UB 3NTCL 1FYTB 3MFFB 1UB5A 4G8EA 1YECH 2FH6A 2EEAA 5M94B 2ALAA 2FX9L 5IJDC 2OK0H 2JCCE 4GIOA 4M7JH 2P8PA 4BKSC 2HG5B 1RZ8B 4E9LA 4YQXH 1JN6B 3Q8AA 1MWAH 2PCPA 2YC1B 2NT0A 4EVNB 2AVGA 3I75B 1VCBC 1HWHB 2WYHA 5C2UB 4M03A 3AWEA 3TVMB 2ATAA 4F2MB 2B3RA 1ZLWK 2YGOA 4M5YL 1OQXA 4TM9A 1XMEB 5JDSB 1MREH 2W59A 3C8KB 4YDJB 2WAQA 2Q86A 5EZPA 2WLKA 3T3MB 1LE9A 3TL5A 3NIDB 3S5LG 3HNTL 2F7QA 1MQKH 2AGJL 4JZJB 1KGYE 1MH5A 2BOBB 2GEQA 2DTSA 4HOZA 5C08B 5KUKA 4XOAA 4AIZB 4HGWA 4MAYC 2DM2A 2QADB 1G7PB 3GRWA 1KGWA 3AXLA 2CKBA 3EJTA 1N70A 3Q5TA 5GGSA 5TE6L 3VGAC 5A2KH 3AG3B 1SXBA 2Q7AA 5HYEA 5JPMB 4Y89A 1DDTA 3WKQA 3GTVA 4JUSA 1KIQB 5ABAA 2VLJD 1AP2A 3MI6A 3HG3A 1TXKA 2IAMC 3U4KA 4U6HA 3RY5A 4QRRD 5DEGB 3E8VA 4Z0XA 2WB7A 4HX1A 1NGQL 4HJSA 1N5AB 4FXGB 1E65A 1KGIA 1TVHA 1CG9A 4ZS6C 3C75A 4L1BA 4ZFZA 4DP5X 2W07A 2HB0A 4GKSB 2HT3C 4NWUL 4WI2A 3NA4A 1IQDB 15C8H 5AW3B 4EDWH 2WJ5A 2WPGA 4HCRA 1B0RA 1M7IB 3K81A 2HKHH 4N68A 4U1LA 1YEHL 3T3PF 4HS8L 4G1MB 3F7YA 5AB9A 4KHTH 1SLWA 2F53A 1QNZL 4HETA 3WUWB 3NYKA 1AE6L 4ONHA 4L4TA 5IFJA 1W0YT 3OKDA 2ICWI 3V10A 4EJ1C 2PPAA 3MLUL 4WHDA 3W5NA 2A4ZA 1ZE3H 4OLVH 3QQ4B 1COBA 2V9TA 3ZSTA 2WNGA 2ATPA 2ZJSL 3SE6A 4L8SC 3TFBA 3HAEB 1EA9C 2XIDA 2Y72A 4FQIL 3ZTNL 3QUGA 3PYCA 1K5NB 2WO3B 2XWTB 3SCMD 1NCDL 3KGSA 3EJQA 1RJZA 4JRLA 4BDVA 4GAYB 5CD3B 3LZOA 2VKXA 4Q9RH 3K2MC 5EU4B 4YXKL 5I0YA 2DWDA 5LNEA 1MPAL 4YLBA 2XKUA 4WI0A 4FFVC 5DJCA 3AUVA 4PV8B 3RVUC 4YBLB 4W4NA 1ZDSA 1QUNB 2DTML 5K33A 4EQ2A 5TQ0L 4WW1A 5CHNA 5G5DB 3U6RA 3WXVH 2PPFA 3EOTL 3RWJB 3TT3L 2VO8A 1BCIA 5DJXA 1LDPH 2YKLL 1WA2X 2BCKA 3IWUA 3VAEA 1T20A 1DCLA 4YMPA 1R3JB 1E27A 4CRPA 1S7VB 1JGUH 4PS7A 3EIFA 1ZT7A 4I1RA 2V3EA 1CS6A 1VZGA 1QA9B 1U93B 3BUIA 4XTRC 3L5IA 4HIIA 4J12A 1IB5A 1D5MA 3QUML 4H2CA 3QUXA 1AY1H 2GTZA 2JB6A 3NCYS 4P07A 4ZSOB 1DSWA 1LEIA 2VMFA 1N0XL 3N1GC 3O6KH 4BJLA 3ARTA 4EN3D 2L7JA 2ZPKH 5JXAL 3IDMB 1B2WH 2HN7A 5EO0B 2VDLH 3OPZH 3TBSB 3ZDZE 4N0FB 4DGVL 9CGTA 4GRWH 1U3ZA 1JK9A 4YPGB 3OMNB 4X98A 1J5DA 5F88A 1RUQH 2DMCA 3BX7C 3FK3A 3OKEB 1KJ2A 4WFGD 2OQJA 4FNLL 3CUPB 2J21A 1CGTA 5MEPA 1J1OL 4FYTA 2DH2A 2YA0A 4ODVH 1L9OA 1A1NB 3LZPA 1P6AB 4YHOL 1JRHH 3LKOB 1XGYL 4MAYD 3GIVB 3FW6A 4PS4H 2C9XA 1R5VB 5A2CA 3NJHA 4LLWA 3MV8A 4MS6A 4QYOA 4XCFH 4ZUVA 1UKTA 5SWZD 1BX2B 1YPZF 1MCIA 1JWUB 2AQRA 3KWVA 4HQQH 4PVMA 2EXTA 2AXFB 4EIGB 4N2LA 2IAMD 2Z8RA 1E8WA 1FRGH 4PJ9C 5DQJA 2HUEA 1A21A 3DWTA 4UTAA 2RQEA 3OGCA 3KYNA 3MKKA 1QFPA 2UY7B 4ZMAT 4LHUA 2WXFA 3SGKC 3TURA 4ZS6D 4EXPX 4XWOC 4ZD3H 1OF2B 1Y1DA 2HT3D 4AE1A 5I0XA 2FJGA 1A5FH 4X83A 4PJXB 2Z1KA 4JKNA 5FHBH 5DK0B 2NDFA 1XIWB 3KCWA 3NZ8B 3IVKB 3PJSA 4JRWA 4GRWF 1MCPH 3HEIB 1TTBA 2I69A 2NSMA 3O2DA 4GJTB 1MLBA 4HIEB 1U8HA 5EOCL 3SY6A 1EXHA 4KO6A 1XSJA 3VXOA 1M42A 4HV8A 5IFJB 1MIEH 3HRPA 4JQIH 4KXAA 5EORH 4Z7WF 3VVWA 1LMIA 1YNLH 1ADQH 2AJVH 4Z9KB 1UEYA 3AQZA 1UB6B 2HFEA 5AVXB 5DJ2B 4YXHH 4WENB 4F93B 2XQBH 3LNHA 3LPGA 3PHQB 3UP1A 3NZUA 4RGNB 4LASH 4FADA 1MJ8H 1U3HC 1XDTT 2Y1ZA 3MLYH 5L9DL 3O3AB 2DDQL 1B4TA 4HJIA 5IJKC 1R3LA 1F1AA 2C7FA 4K9EL 3BKMH 3MV9A 3UZQA 5IVOA 4FFVD 4C4KO 3ZE1F 3BP4A 3LQAL 1HILA 4XVUC 2W0KA 3NT0A 1G6RB 4JKPL 2F74A 4QRUB 5ACLA 1GIGH 5JXEC 3OKKB 4MDJA 4WKXA 1BOGB 4P5MB 5AYQA 3ULUE 3MODL 1KMGA 2OR9H 3TCLA 5D72L 1NCGA 2WSKA 4BFIB 4HDIB 5DUML 1RZJH 4Z3GA 5T1MA 4KMTL 3S48A 4B3EA 3ULUL 2VAAA 3MR9A 3ZL4L 1NCHA 4ONGH 3OL2A 2G2RA 4XTRD 1GZQB 4QLWA 3Q13A 4NZ8A 5TF0A 4Q6IC 1OGAD 3T1FB 5E2UL 3T4AA 1VENA 2R69L 3FHAA 3WIHH 1HI6A 1QR1B 4FZ8L 4XNQA 3RU8H 2RCSH 1AYRA 1F3JB 4GYBA 4M61A 4YO0A 3L9EA 5HHQA 4FDWA 2NX5A 4JPWH 4NKIH 1S8DB 4LVHB 4XWGH 1PZ5A 4QHUA 1AZNA 3VXRA 2PUQT 4AYFA 4O2CB 4C4UA 4RSVA 2X1WL 3HZVA 2VDMB 3D06A 3QR1A 3V4PA 1CI5A 4CADB 3N42B 4F57L 2OSWA 1CIDA 2XI9A 1DQDL 4MDRA 1ILUA 1UZ8B 2P47B 4O02H 3N06B 3IRCA 2R2EB 4JB9L 1MNNA 3EO1A 4X7SH 1FPTL 1QLRA 3BEVB 5LG1A 1ZLEA 2FX8H 2GUYA 5JHLH 3JV0A 2ATKB 3SQRA 1OE3A 1MCWW 3TA3C 1R0AL 4OLWH 5DRXB 3S5YA 4QYOB 4OZGA 5DWUL 4JFDA 3CFCH 1NCAH 2WZ0A 1RUPH 4RZKA 4K3JH 5EO1B 1E28A 3OTTA 1MG3C 3BQVA 4HJGB 5EFIA 1RPKA 3COOA 2WLMA 4PJ9D 2E7DA 3SDYH 3WIFA 4M1GL 3R0MA 5C0CE 2X2UA 1NCBL 1QAWA 2O1AA 5I66B 3WXWL 3G6JE 3OB8A 1KCKA 4AYDC 1TVBA 3GBNH 2ZWNA 4XWOD 4A2FA 1CBVH 1OD9A 3BAWA 4DW2L 1PCSA 4LLVA 5HHNA 4FE9A 4U1KA 5B39G 3NCWA 4LCUB 2NMSA 1IJNA 3KWXA 3I6LE 4IU3B 1DSYA 2BIPA 4N87A 3P0VL 4Z77A 3VWJC 1D9KC 4YUEL 1S7RA 1NUGA 3OX8B 1F56A 4ORZC 5GZND 5F3BA 4U7SA 3W56A 5F8QC 1EX0A 2JKJA 3QQ9C 2XT1B 4OCRL 2JXMA 2WO4A 4KJWC 3TBTA 3W37A 4FABL 5DURD 4DKFH 1KY6A 4A55A 2XLLA 3BPOB 4RETB 1I7UB 5DT1H 1KYUA 4YAQA 1KWKA 4MHHI 4I85A 3IFLL 3DECA 3LRGA 4Y7MA 1D5BB 4ZXBC 5E08L 2I32A 5A43C 1U3HD 1DUYB 3GJEB 4YL4A 4XBEL 3QZOA 3M8OH 3RA7H 5E4EC 2X28A 1M6OA 4BZ1H 4LDOB 2VZ1A 5GS1C 3CHXA 1RPQA 1N10A 4XCNB 4EF3A 3RZCA 3RFZA 4XVUD 3H9SA 3S4SG 2MCPL 4B95C 5JXED 4D0CA 4ZUTA 2V33A 5IFHH 2EDDA 2PWFA 2PP8A 4WFHE 4L3EE 4MFHA 3GF8A 4G5ZH 5CJOH 3X14B 3QJQB 4WTZA 1JYWA 3OV6A 1EHLH 5T1MB 5I75C 2E75C 4MJIA 1Y18A 2ADGA 2GPZA 5C2BH 3O3DA 1T0PB 3AVEA 3P4MA 1LEKA 2WJ7A 3WTTA 1UADC 4I9XA 2FECL 4HG4K 5HD8C 3CSYB 4IJ3B 1OE1A 5ESQB 1LILA 2WN3A 1CCZA 2DQCL 1J1PL 2H0FA 1TJXA 3DIFA 5C0IA 1HI6B 4JJOA 1U91B 3RILA 3SDDC 2WXPA 4R4FL 4JM2A 2BX5A 5AZEL 1PQZA 4MMZA 5FK9B 3CX2A 3UTQA 2X2HA 1W9XA 4TQEL 5IIEA 3AQXA 4G6JL 1CZ8H 2EXSA 1AACA 1JTPA 3AM8C 3P2DA 5TFSL 1BQ5A 2NXZC 3CVHH 1S9VB 2WQWA 3OR6A 4P46B 1ETA1 2YD3A 3CH1A 1OW0A 4TVSa 3FYIB 2PABA 4PJBA 3T3MF 2ZAGA 3FUDA 4LAQL 4GKNB 2Y3AA 1T0MA 3DX2A 5KYUA 3W0WB 4ZRGA 2BH0A 3I6SA 5HYJB 2OJEA 3RX9A 3ELQA 1KIPA 2AV1A 1QSFB 5MERA 4AG4H 3TA3D 3V95A 3ZL2A 4LFHG 3VE0B 2F6AA 3JV4A 1LP9E 1P7QD 1B4JL 3HAEH 4J39A 5CKAA 3QJVB 1FZMB 3AWGA 3CJJA 4FERA 4DKAA 4EI5A 5JTWA 1P4IL 3LB6C 1YMMB 4GQ9L 1OAQL 2D0GA 5DC0A 4AENA 2E56A 3MUGA 4IGBA 1WVZA 3FQXB 3HNVL 3U7YL 1JPTH 1T0NA 4JDZB 1V7ML 2KLSA 3PV6B 5F7EH 3VH8B 3TN0C 2G2NA 3MOQA 5CMAA 1PX8A 3NCYP 2WIIB 3S0PA 2ICCA 3IAGC 3BVWA 5FYLD 1QASA 1T21B 5D96C 3VWJD 1YDPB 4K8RH 3WIAA 5ITBL 4QTIH 4P99A 1BXXA 1DSFL 4JO4L 3VJ6B 2F9BT 3QQ9D 3TBTB 1KB5A 3LN4B 3QDJB 4KJWD 4TF4A 3FQWB 4CVXB 1CURA 4PVLA 1RZKL 3QQNA 4Y5YB 5F72S 1RUMH 2ZUYA 3ZHNA 4WV1B 3DJZA 4F8LA 5DRZB 2ZNXA 4ISVB 5CSBA 2CPCA 4X99A 4AM0Q 2ENPA 5FO2A 1IFRA 1ZPUA 3ZKSD 3U1SH 4CN6A 2VM4A 1CN4A 2ZUVA 4P2QD 5GGTH 1GS7A 1ZXQA 4LCIL 5AVYB 5A2FA 2J72A 4G9FA 1QUPA 4GG6F 1BAWA 2BHUA 5MEQA 3FMGL 3H9SB 1OLLA 1F86A 1U92A 4X5XB 3INUL 4TUOB 3GHBL 4YIQA 4X6CE 1XGUB 5E2TL 4S0HA 8FABA 3CX5J 2VXQH 2DI8A 3FOMA 1PX4A 3EJCA 3BSZA 4WEBH 3GRWH 2DQFA 3BCFA 4JAMB 2P5WE 2LR4A 2CKBH 5DVOA 4P23A 4RMQA 3C2AL 5EB9A 3IDGA 1PYWB 5GSRA 5E5RB 2QQQA 4E9QA 2VC2B 3D2UB 2X2JA 5HD8D 2ZCHL 3ZDXE 3B1TA 4OIIH 3K6SB 3SKOB 3MA7B 5F7WC 2ITCA 2XA3A 3DIFB 2G9KA 4AGNA 1KLUA 5DZVA 3TO4A 1V7NH 1Z3GH 2Q5BA 2FWLB 2B3IA 3SDDD 1M05B 3FN0H 4X7DC 4EQ3A 1OARL 3VGGA 3KR3H 5T5NF 3FT3A 4X4XB 3VXMD 4PLJC 1F4YH 4GMSH 2NXZD 1DJIA 1TFHA 5EOQL 4R0LB 4DNLA 4FJYA 1I1YA 4WI3A 4GQQA 1N19A 1AOHA 2YRLA 2BHFA 4XC3L 3V9FA 4DVBA 3JSSA 1CXHA 4MMXB 3BP6A 4DP4X 5D71H 3QP3A 2V6HA 1K4DA 4YE0A 4M6ML 1QG3A 4V1DB 1J0YA 4XGZA 1OP4A 1VFUA 2VOTA 4X7EC 5SX4H 2C7UB 4XP1L 4F7KA 3V6OA 1KBPA 4JCWA 3NCMA 4XP5L 1NINA 1J48A 1KV3A 3L4CA 2VL5A 3F65A 4PY8I 5IHZA 4QRPE 1ZT4B 3T0VA 4DO5A 3GDBA 1U8CA 2NR6A 3KLAA 5IUCA 2CIIA 3NFPB 4OQTA 2PYED 2P28B 4F9PC 1FFNA 3L45A 1HQ4B 1AKJA 5EU6B 1EBPA 2QQNL 1ORSA 1F4XL 2V8MA 3IJHB 4LOVA 4YHZH 1EVTC 3RWCA 1G6RH 1ETB1 3SDXA 5AKTA 2BS9A 2CUAA 3HN3A 1IKFL 4NO0B 3ILQC 2A6DB 1ZPLA 3L9BA 2ARJB 4BK8A 2NY3B 3NG5A 5FPIA 3NIGB 5FB8B 3Q43A 5BO1L 1P2CA 3UBHA 3F83A 1HEZB 4HUUA 3UZEC 3L3HA 1HL8A 4PJXF 1BIHA 3HG1D 3WHE0 3Q6FA 1QRND 2P80D 4KTEL 5BVJB 4FX5A 5LQBL 3NACL 5B8CA 1MI5A 2FCBA 3OAUL 4UNVA 3FBKA 1KC5H 3DSNA 5I1AA 5HY9A 3D39D 2J2ZB 4QWWD 2VXVL 3V4VL 2ZP0T 1UXMA 3RWDB 1KUMA 3HHRB 4LESA 3GB7A 5DMGD 3ILPA 4WWKB 4XBPA 3UJTL 3VXUD 4N0YL 4BA8A 4LVOB 4HPYL 3QXAB 3ARPA 1FO0A 5EH1A 4C56A 4OI9A 1GZHA 1DTUA 1KTRL 4R7XA 2IQ9H 2VDMH 3B3IA 1NANH 4Y5VC 1SQ2N 2ZXAA 1E4WH 1M6UA 4PJ6A 1HXMB 1TQBC 1M1XB 2ETWA 4Q6YA 2DF3A 2ADFL 1GAFL 1H3TA 1CTMA 4EKXA 4L8DA 3P3YA 3RGHA 4POUB 3JWOH 4WU7A 2HJKA 4OZIE 1R5WA 3HFML 4Y4KC 4AQ8A 4W6WB 1EFQA 2IADA 4QJ3B 1E7VA 2J57A 1V8HA 2J12B 1V05A 2AEQL 3LHPH 5L4JA 3MJ9A 1R3IH 1QFWM 2WLJA 4QD2E 4UTAH 1CT8A 2PR4H 4N8UA 4LCVA 2J1ZA 1CQKA 1HWGB 1JFQH 1DQJA 3G5YB 4JRXA 4QNPF 5E8DL 3U4BH 5C0BB 1NBYA 3FU7A 2KMWA 4OD1H 3IF1B 3ULVE 3DHMA 4ANXA 4ZMWA 5KYYB 5HJDA 4PLJD 3GRBA 1HNGA 2ZUXA 2GJ6E 1NEZA 1ETZA 4N90D 1AO7D 3ALPA 3ULVL 1G94A 2RQ8A 2H3KA 2C9RA 3O2DH 4AUUA 5ENWB 4Y16D 3IDIB 3M1CA 3C9NB 3PU7A 2PYFB 3VFSB 2J3SA 2PCFA 4Z7OE 2ZXWB 4DN4H 5T3XD 2H1XA 1MY5A 1JD7A 3LKSB 2BIOA 4PGEB 4FEMA 4X6DE 4XBMA 5TF1L 4DOHB 3IFNH 1ZA6A 1OZUA 2Z0BA 4U6TA 1PFCA 2R7EB 5I1KH 3SCMA 3HPLA 5L2KE 3L5XH 5F70A 4NJ9H 3PPSA 1X3DA 1YCSA 1ONQA 2Q10A 4G8FB 4JZNB 2BZ7A 4AZ8B 4FQCH 3C6SA 5IHHA 2OULB 2PO6C 1BFVH 5FO8A 2D0FA 4F3FB 3MUJA 4GP5B 3CQQA 1FGNL 2X4NB 3MV7B 2DLIA 2OZ4A 2DKUA 2Z31C 3UFIA 3UBXB 3LRMA 1GGIH 4PJEE 1CFNA 4D9LL 4I0CC 4PH8A 2XC8A 1TPXC 3BUTA 4I3GA 3PIQA 4NT6B 3VXSE 3L3DB 3QRBA 2VLKB 2FBOJ 4TNGA 1BIIB 1MQ8A 2YSTA 4MA1C 3GZKA 4PP1C 2GTWB 2LLNA 1UG9A 1FGVL 2V2WA 1X5HA 3TA4D 1BGXH 2AXHA 2HP4A 2CBTA 4FN0A 1VA9A 3MCLL 4NKMA 1SOQA 3OB0H 3RUGB 2MHAA 4EN3A 3WFBL 1QLEL 1YHPA 2EDXA 2X38A 4HGKC 5C6WH 1JNHA 3CLEL 4FYSA 3WNPA 1EDYA 1PZCA 2EO9A 1A1OA 2CLRA 4MYPA 4MAUL 4QHMB 2VDPL 1KIUA 2FATH 3C60D 5DEJA 2WM0A 2O6CA 4UQEA 4XH2B 2BIIA 4KXZH 2V2TA 1XH1A 1T1WA 4LSSH 2B4CH 3V4PH 3CC5A 4PJ5B 4XN4A 2VXUH 5HI4C 3EJRA 1MHCA 5C3IA 3JVFC 2MKWA 2YAQA 4GAFB 5I18H 4PIBA 2V9UA 2X88A 3FFCE 3CU1A 4QGTA 1A6UL 5EEUA 1OKEA 3LIUA 3LZFL 4JPVL 3BWAB 1R5IA 2A9ML 5E00A 5B38B 5LBSL 4G1EA 4Y4KD 4JK0D 5CO1A 3D0VB 3QRLA 3QUKA 4HEME 2VLJB 5SWZA 3O3UN 4JANA 4LHUG 2PXYC 3QJOA 3OC5A 3PDDA 4LEXH 4QRRB 5CJXC 3DMMC 1NOFA 1UXLA 5D7JC 4XNXL 5AD0B 1G0DA 1VB9A 2ZX5A 1A14L 1UFGA 4HXAL 2VM9A 5EULV 5CFAA 2BNQE 3MRIA 3OF6A 1AIZA 1D7DA 1DFXA 5DD1H 1EJFA 2C9UA 4JFOA 3ZHKA 1UA6L 1BM3H 4W4OA 4CC1A 3UG3A 3BZDA 3U2IA 3G04B 3ZDYE 4BYHA 4OUOA 1CVSC 5FDYA 4LDEB 4QT5A 5K9KA 4N5UA 3PF2A 4TL4A 1GGCL 4YHPB 1MDTA 4A37A 4TPRH 2X4TA 3KPSB 1GS8A 2BY2A 1XBDA 3O0RH 5HHOE 3LN9A 4TNWF 1IL1B 1AHWA 1Q9KA 3F5WB 4J8RB 4FQHA 3KVPA 5K9OA 1H5BA 1HHGB 3P9WB 1MSPA 1U8MA 4PJ8D 4E5XB 3U83A 4K94C 1QTYT 2E9WA 1N59B 2JB5H 3ISWA 3OKOA 3UP6A 5JO5B 5DMKA 1T22B 5JOPD 2A9NL 5F9DC 2RAMA 5DEZA 1RIHH 2ICEC 3TYFA 5CWSB 4JPIA 5F1NB 3O41A 1I1FA 2RJMA 1QFWI 3EYVB 5IB4A 1T03L 3CXHJ 3AT9A 1EFXB 2VUYA 3CBJB 5INDB 2KHAA 1AGDA 4RISH 4G9DA 2PO6D 2XWBB 3ML8A 1JFHA 4IBUA 3GZPA 2B0SL 4OAWA 4JE4B 3MNWB 3QW9A 3CD4A 2OPCA 4C83B 5DEFA 1S6NA 1SJHB 4DUXA 1ZCRA 2MQGA 2Z31D 1NAMB 5DZJA 2A83A 4OD3L 3PNWB 3ZGIA 3PQYD 1BVZA 1NBZA 3NFSH 4I1PA 2BIHA 1WC7A 1ZANH 4XAKE 5IF0A 2APXA 2WUCH 4MJ6A 3BH8B 4XNYH 7TAAA 4NUPA 3UH8A 4EZKA 1UC6A 4JG1L 4GB9A 3ZKMC 2WAHA 2XBDA 5B3SB 5BS0D 2IANE 3MGTB 2NQCA 4M00A 5DHYA 5IWLC 3F00A 4ODXB 1BD2D 1VZIA 3MGOA 4A2LA 1DQLL 1WHPA 3IU3B 4YHLL 5GGVY 5EWIL 5FLUA 5KYWA 1FNGB 1WIUA 4DFHA 1ZTXE 5DI8B 3KNBA 4YHKL 5FYJH 1QMUA 2EKSB 5IW3A 2XFXA 3O4LA 1RVFL 1F0LA 1A6AA 2B8OT 2ESVE 5J11C 2VMCA 5AW9B 1TZAA 1ZTXL 2D2CC 4HEPA 2G5RA 4MNQB 4Z3TA 2GT9A 3P73B 2OMYB 2BNUA 5H94A 1MWAL 1IAIL 2EDRA 4RQQB 5HI4D 4UCFA 4OBRA 2GHWB 4G83A 1AZZC 1INQA 2CUHA 2EDBA 4MAYB 1PEZA 1S2EA 2NY5H 3A5VA 3ESVF 2BC4A 4GOSA 3R7RA 4WJG3 5KJRH 1EZUA 3VGAB 1BHGA 3TEXA 5IMKB 4RH4A 2QGEA 3HMWL 2YUXA 2WOBA 1M7XA 5D7SH 2W80C 2WWNA 3EOAB 3WO4C 2PXYD 2AV7B 4AC4A 4BXSV 3WTVA 2IAMB 3RNKA 4EUPB 4F58H 5LG6A 3KL0A 5DTFA 4EBQH 4PJ9A 5LGYA 1JGDA 4KQ0A 3DMMD 4FLHA 4MS8C 5B3NA 2JKXA 3WN6A 5IMMA 5D7JD 1LEGA 5T3ZD 1NPNA 2E27H 1EGJH 3HI6L 1FC1A 4EI0A 2J88H 2N01B 4S1SH 2I9TB 5A2BA 3HS8A 1PZ2A 4J3TA 1L6PA 1J5OL 3OZ9L 2DOCA 3NJXA 5E5MA 3T65B 1N8ZA 3TEWA 1T2QH 3L13A 4PRHD 5ESVB 4O58H 5CGYC 4JM2F 5E9AA 1RLWA 3GUFA 5T1DH 5EUOB 4BZ2L 2R0ZH 3DTXB 5LAPA 4GAJH 5F3HA 4NQTA 5GZNA 5EF0A 3MRRA 3UTTA 1KELH 3R1GL 5KZCD 4YR6B 4MLSA 2HYMA 1FZKB 4MGXA 4FQHB 3A4AA 3SOBH 5K9OB 3MJ8B 5KVGH 4F91B 2X1XR 2EICA 3LDBC 4PJBF 5TGBA 3SDCB 3U9WA 4DGUA 3DROB 3H2WA 4L8SB 1QSED 2P49B 2H45A 1CXIA 1MRCH 1S7XB 3FQYA 1V10A 1XTMA 2W8CA 3RE0A 2TRYA 2YPKA 4B96A 4DZBB 3MO1A 4NIYE 4J2XA 4HLEA 2NW2A 2AQSA 3MLPA 2WIMA 3C8DA 5CBEB 5IJKA 3CFDA 1BBDH 5HHPB 4OCNC 4UIMB 4LMQE 3ZZLA 2FO4A 4IMKC 3GMMA 3A6CH 1KEGL 4WTZG 4G43B 4AK1A 5JXEA 5TH2A 4ORGB 1K5WA 4N0UA 3D48R 4BV1A 3B8YA 3VFMA 2GBUA 2AJUH 1YEFL 2G3ZA 5KBNC 2D3NA 2OX5A 1S9XB 1BBJB 2M83A 2R56L 4FQ1H 4ODHL 4K3EL 4F7CA 3GDCA 2HJFA 4JFSA 4RLDA 3T8VA 1O5DT 1OOAA 4BFGA 3NIGF 3UCRA 3K6NA 4AYEC 3DTDA 2V4LA 1KN2L 4WJ5A 3B5TA 2X42A 2DLGA 5GJTH 3QAQA 4TSCH 5D7KE 3DJRA 1OGAB 2VSCA 1QYGL 1FVCA 3P3SA 4AWJC 1NUNB 2D03H 5M95B 4G3YH 2XA8H 1YPZE 4Z23A 5FW7A 4KQ3H 2VE6A 2YUWA 5KYWB 4JGNA 3WIIL 4IBWA 1HAUA 2FR4B 2WWKO 2DQUH 35C8H 2QFPA 1HS6A 4FZEH 4WSJA 1XD1A 3QJTB 4JFFB 5HGAB 1RHHB 5IREA 3LKPA 4JG0L 1LO4L 2QHLA 2OMUB 3QH3B 4ZAKC 4PJFB 3I50H 2XXGA 4CDGC 4IIQC 3S35L 4KO5A 3EDKA 1GR7A 3PREA 2EJ1A 5E1AB 2XACC 4GRWE 3CPLA 4I7ZC 5GJSL 3S88L 2APBA 2MCAA 4XAWH 2IALA 3BWSA 4FNSA 3V9EA 2Q0ZX 3LEXA 3TH4T 2CH8A 3WBDA 5DTFB 4NHCL 3D08A 1RUQL 2WBJA 4MS8D 5DZPA 2IBZY 1RI8A 4XMLL 1FSKC 3STZA 2B39A 3GSRB 3DX3A 1OAKL 3S98A 2J71A 3PWLB 4UUJA 4I48A 4HMDA 2UWEA 4W68A 4U7MA 3LKRB 3H9HB 3GXTA 1G6VK 1ZVSA 4NGHL 5CGYD 4G7YL 2NYKA 3CFJB 3VWJA 4B27A 2VM3A 4XCFL 3SQOH 2X0VA 1KB3A 4X7CC 4HVBA 1NGYB 2KC0A 3DO3A 3SE9L 5I8OL 5JW4N 4Z7VB 4YGAB 2VJ8A 4Q0XH 1PF3A 2BNRE 2BHYA 3DIVA 3EG9B 4IK7A 5DURB 4NZTH 1ZD6A 1EXGA 3GI9H 3PG2A 2Y69B 2LABA 4P3CL 5ILTH 3RGVD 1I1AC 5E6IC 1HSAB 3DJ9A 5EC2A 3MBWB 3I6KA 4R9HA 1JNNL 1QSVA 4KVNL 2W0LA 2E5EA 3KWWA 1U3HB 4LDCA 5DS2A 1W2KT 5GGSY 3UACA 1RU9L 1IAKB 5IB2A 4P2QA 1Q1JL 3SQBA 4BE5A 4MD5B 1CL7I 3ABLB 3MBEA 4HIXH 3QEQA 1KXVC 4IOSD 3BXNB 4Z0BL 2HVJB 2VN6A 4JZOA 5CBAA 1KY7A 1OGTA 3X2QB 3CDFA 4ALAH 5AW4B 5JZ7C 4LIQE 3X11B 5I16A 2CHZA 1RIVH 1RERA 3S7GA 4LIQL 4Y1AE 1WGVA 2Z91B 1MCSA 5F7DB 1OL0A 2VSDA 3FO1A 4LGRB 4HIHA 1GGBL 5FFOA 4R4NC 2CLZA 1UUNA 3OZKA 2LVCA 4RNRB 5E9DA 2CSPA 2FIKA 3D09A 4X4ME 4Q6IB 3TASA 3K74B 4JN2A 3V0FA 1FVCB 2K9UA 1EZLA 4Y19B 1XF3B 3TIEA 2CD0A 3EBHA 3KM2A 2UY6B 1P5UC 1M7DA 2X6UA 1YMHA 4FOMA 3U7AA 5JOFB 2EVGA 1B0IA 3QFJD 3AZUA 3QVAA 3STBA 4QXUH 3WKMH 4B9PA 5A6LA 3RUGF 1HHIB 3O2WH 4MCZA 4X9IA 2HX7A 3QB7C 4S0TD 2G5BB 3EGDA 4JFPB 2ZIDA 2FEDC 4PWFA 2OW7A 1Y7VA 4HK0B 1DJGA 4XNAA 1IBBA 3O4OC 3X3GL 1QRKA 1F58H 2OSLB 3AREA 4ZS7L 2WVTA 4ZFGH 4PRAA 4JFTA 4H2AA 4CVZA 2WGNB 4Q74A 1X4XA 2Q3AA 3TA3B 1GHFH 2MTAA 4MSWB 1P7QB 4DPRA 1MCWM 1HQRB 1WDAA 4X4YB 1OCRB 4K9EC 1HJBC 3MRCA 3T8XB 5BUGA 2QKIC 4PJHA 4WSGA 1CDGA 1FG2B 1JNLH 3LQAC 3NCJH 4LSUH 5CGMA 1IGTA 1PX3A 4W9JC 4S1DC 1TO5A 1C1EH 3FSOA 5IMLA 3U0TA 4I3SH 4M8QB 2D7OA 4W6XB 3GPSA 1S9WB 3H3PL 5E8EB 4Z7QB 1UM5L 4MQTB 2DQIL 4OCXH 3K2IA 5IQLA 2OL3B 3QS2A 5DD5H 4GRMB 4M43H 5L8JB 3SGJC 3TBVB 2G60H 2WBXA 3S96A 3ULUC 1KLFB 2OTPA 2OZ4H 3EYUH 3FCSB 4HMCA 5GGVL 4MJ2A 1NAMH 3ECBA 3C6LA 1PL3A 3N04A 1D9KB 2E74C 1MWOA 1NIAA 2AQPA 3FSWA 2J5WA 1UVQA 5I1HL 3HG1A 2ISDA 4L4VE 1JHLH 3PWUA 2K70A 2WZAA 3K80A 4NHUB 4NFCA 5KS9E 1N6VA 2DQTL 3VGEA 2Z65C 1I8IA 1J87A 4XPTL 4PD4J 3H8NA 1KTDA 3JXAA 1NGWB 1EDHA 1ZK5A 1I1AD 2KDGA 4LSQH 5E6ID 5EU3A 2H26B 1NAKH 5AVTB 4LLMB 4TSAH 5EV7A 2HLAA 1YEWA 1KTJA 4ZXBB 4L3CB 3BO8B 5BPPA 4WUUA 2IWKA 3RJQB 2BFVH 4O9HL 3DA0A 3TPUB 4B0MB 4D7PA 3UIYA 3SYCA 5I30H 4HKJA 4P2QB 5E4EB 2DAVA 5T1LD 3E6FB 2FB4L 3VXUA 4E42B 4JHAH 4PLKC 4AEFA 5GS1B 5J6SA 5CN3A 3NJGA 2WVVA 1DVZA 1EEYB 3DUHA 4I0PC 4K5LA 3LD8B 3PWNA 5GRJH 5JZ7D 3WMSA 5LGKA 1XGPA 2VERA 2BMKB 3QFGA 3VFRB 4DHLA 3OAYH 3KVDD 2EDTA 2QQLH 2C1OA 1MHHA 4QXGL 5I75B 1EANA 1L6ZA 1FP5A 4OT1H 3DHPA 1AKPA 5AYUH 1CLYH 5HGHA 4FRWA 1RZGB 1AGFB 1BLIA 1Y0LB 1VGKB 4HBCL 4HKZA 4R4ND 4GIAA 5ISZD 4FNPA 5E5UB 4EUPH 4XNDA 4NC1C 3MMEB 2X6BA 4MCYB 4WNQA 5CJQL 5KJ4A 2R1WB 1A4KB 5I1LA 3SDDB 1E2WA 1AFVH 5I8EA 3APDA 1NEZG 4P4KC 3ESUF 3T0BA 1G4RA 3NAAL 1OP5H 2O61A 3DUUB 3VXMB 3QG7L 1B0GA 1ZSDB 2NXZB 2FYVA 1TZ8A 3GJFB 1Q9WB 4G8GB 1AO7A 1JF6A 5D1ZI 1WFTA 1XB8A 3O11A 5TDOA 2ZP9A 2FEDD 4JGMA 4MDIA 2E6QA 3NJIA 4Y16A 3U9UB 4U4BA 1BQLH 2BOCA 1YN6B 1JS4A 1M2OA 1WYJA 4BFNA 1CFTB 4NJAH 3HOGA 3G6DH 1QBLL 1P1ZB 3H7BA 4WHYG 3TWCL 4YHYB 4K71C 3LQMA 4S2SA 2OMTA 4M48H 4M6OH 3ILEA 5B1CA 2XTLA 2Z35A 2FTAA 3TIDA 2OMXA 2OXGB 4Q6KA 1T5KA 2AJ3A 4R5VA 4GMTL 4GSXA 4OLYH 5BZZA 1SYVA 4YXLH 3T6VA 3WJLC 3PXHA 5I1JL 1R3HB 5L8KB 4AJ0A 4QRBA 4LEOB 1KPUB 2BRQA 3CVHL 3SDAB 1YEIH 1ZIAA 4N5EC 1QZNA 3GSWB 2PYEB 3DX6A 5LCVL 4S1DD 3RL1A 4LHJB 2EUZA 1FH5L 4FP8L 3WS3B 4AXWB 3HE6A 3P11L 3BIKA 3KBEA 4UNUA 3ZX1A 3DKHA 1CFMA 1NPJA 3TN0B 3TPKA 1Z5LB 4RGMB 3ULUD 2X1QA 3IMRA 4D9QE 1X7QB 4JEGB 5D1XD 4GG6E 2RD0A 4KOCA 2W0PA 4XT1C 5D96B 3I6GB 4HZ1A 2X4PA 3LOWA 3K2KA 2EP6A 2FT6A 1F11B 4OFDA 3QI9C 1QRNB 3CFQA 1MFAL 3UJIL 4KKPA 4TVPE 5EUOF 4K23L 5LHDA 3FQTA 4KRPC 3RG1C 3ZE0F 1PG7H 1L9MA 3BAXA 5BRZD 3DGDA 3VFGL 4TVPL 1J9TA 3CXFA 1T6VN 5I19H 1JUFA 4OKVB 4LARL 4WW2A 1H0DA 3D39B 2IPKB 2SODB 4UZUA 4H1LA 3LNEA 4XC1L 1II4E 2VJ0A 5ADOH 5LVEA 5CR8A 1JK8B 5FUOH 1E9QA 2L04A 1IFHL 3FH8A 3C60A 5D1QB 1CF8L 1HHKB 4DAGH 4M4RA 4UTCA 1EUUA 3SJVB 4PLKD 4AI7A 3H42L 1N3NB 5LB1A 4FL4C 4O5LH 1CLCA 4LRNH 1S3KH 1FJ1B 5FM8A 1A1MA 2MQ0A 4O2FB 4M3HA 4N8CH 4H8VA 1BZQK 3WV0A 4LVNC 2QVIA 5EOCJ 1J9SA 4LBEB 2RA1A 3CBRA 1S9KC 4DKEL 3FO2B 4Y4KA 5F8RC 1I3UA 1FVEB 3CZUB 2EQDA 2A9CA 1HXYA 4CNIB 1CLZL 1AIFB 5IHBA 3NJNA 1S7TA 3IDXL 4M5SA 5C0CD 1W0VB 2HA1A 4U1SB 4WNQB 4CC4C 1MJ7L 1E40A 1CYXA 1E4KA 3O6ML 4QHLB 4XOBA 1L9QA 3EZ8A 3NQIA 2WOYA 5JA9A 1AD0A 3HMXH 3RZWA 4P4KD 2NY4C 4A6YB 3IBEA 1RKRA 2NUTA 3TV8A 1CMOA 5BZWA 3I3DA 1NMBL 4UDUA 1QFUH 1NPUA 3WLBB 3L5JA 3I6LD 1SN0A 4N24A 5L6YL 2A3TA 5T1JA 5FGRA 2XG5A 1XR8A 3IGAB 2K78A 3VQ2C 1RZKC 1W91A 4GW1A 4UILH 3C5JA 3B43A 3EH2A 4UIKL 4ZOCA 2H0EA 4PIRF 3RWIB 4ILDA 1BEYL 1BFTA 3ASOB 3F12B 1DLFH 3Q1SH 2DZEA 4Z7NB 3L2MA 4PJ8A 4OVVA 4U33A 1G5AA 4UF7C 1SM3H 4GEIA 1GMEA 1U95A 2KZWA 4BH8A 4HSCX 1R24A 3AC0A 5FXCH 5KTEL 4Z7OB 5F0MB 3WAKA 5JORB 4HCRL 3C5ZA 3NJLA 4LB8A 3S34L 1F4WH 3CZGA 4GMSL 4M5ZL 4JRFA 1MUJB 2F53E 5C09B 3IETA 5E1QA 4L8CB 4L4TE 2WP3O 5LAXA 4FKHA 1AGEA 4KITB 3QUZC 3NOIA 4R7NA 3B5HA 1DN2A 3PFUA 1IKNA 3L4YA 3SE3A 3L08A 3KD4A 3KPNB 4F92B 4I88A 2A73B 3T0AA 1IEBB 3GS4A 4L3ED 4MKTA 3PQYA 4F9LC 3N1PC 1C5CH 2R9HC 5DRWA 1A9BB 2GW5A 1K8IA 2YLKA 1XO8A 4LPYA 4HKBA 4PWIA 4G2AA 1K3ZA 3PUCA 4WF7A 1J0ZA 4PI2A 3ET9F 4XP6L 3BUBA 4JMXA 4POZD 3QI9D 4IMLA 4RIRA 3N43F 1MCKA 2VDKL 4UM8B 4W9LC 5IJVB 3PP3H 1I75A 2OJZL 4L1SA 1FL3A 4LEEA 3RTLA 1ID5I 3PFQA 4GW5B 4YVUA 1W6LA 4IBSA 2VQ1A 4Z7VF 4JRYA 1EXUA 4MX7B 5F1IA 3BT2L 3LZLA 3HG2A 4ELMB 2KS0A 2H32B 1BJ1H 2VLRA 1E6JH 4K4KA 1BD2A 3RWEA 2OLDA 1WE5A 3APFA 4X0KA 3VVVA 3K91A 3MLZH 4JFHE 3TU6A 1FV1A 2F1EA 4YHNB 4P2OD 4R90H 3QC6X 4I89A 3L1OL 4XCEB 2D3LA 4GUPA 1KJVB 5H37A 1TZIB 2C1PB 1MAKA 2GUOB 4R2GC 2FX7H 4QNPE 4NZRH 4Y5VB 3CFNA 2R4RL 3QXDA 4D8OA 3A6BL 3ZQXA 1TQBB 1KPVB 1XCTB 1SOXA 3OHMB 1YQVL 1MW2A 4N2CA 4ATTA 1BWWA 2BP8A 3DURB 1D2OA 1JF1B 4E9WA 3QO1A 3T4YB 2WNXA 4Y4KB 2DQEH 1EAPB 1MFUA 2VRKA 3D4ZA 4CSPA 4D8PB 2PXYA 4LCYB 4J3OC 3ARDB 5E2VH 3IWVA 1FLRH 1YZZA 4KKBC 3EO0A 1A7RL 4YDZA 1KJ2L 3OG6B 4P5TC 2VR6A 2J8UA 5FA4A 1AC0A 3BZFB 1ZLVH 1CB4A 5D6DC 3MRBB 4I3RH 4KJPC 2NY4D 5DHDA 1YC8A 3MUY1 4A7TA 2OL3H 3MV8E 4PRHA 7FABH 1F41A 3DI3B 3W5MA 1X5MA 3JWOL 4X8GA 3T77A 4Y88A 4O00A 3ZE2E 1JYXA 1B9ZA 1HNYA 3D33A 5GRUH 5BV7L 2NQDA 2ZOWA 5F0JB 2XHNA 5F7MC 1VFOA 3UBGA 3FTYA 4N1CA 5K1JA 4ZFQA 1BAGA 1KBBA 3NH7H 4ZW8A 1O7VA 5HDLA 3L9YA 4OM0L 4FFYH 5DMJB 4AGLA 1G84A 3FB7A 2AZAA 4K7PX 1JFQL 4BH8B 2ED8A 2BO0A 3QE5A 1QSEA 3U2SB 3GUTA 2HWZH 3U4BL 2ADIB 1LK2A 3WL9B 4MWFA 2ADJA 3QA3B 1FFQA 2ICEA 2WMPB 3N44B 5IKCB 5IGXL 1YUHA 3ZY7A 3QWRD 1SOSA 2NNCA 3O3EA 4L0PB 5FUZH 1B6UA 3VX0A 3GBMH 4C58B 1S9YB 2PO6B 4OBSA 3MRKA 1KGUA 4RCAA 4OB5H 4NQDA 4A7QA 1IM9D 2DM7A 2X6MA 3QUZD 1T1YB 3WN5C 3WEBA 3R8QA 3SBQA 2PR9A 2Z31B 1UM4L 2AXJA 3V6FB 3KWTA 5DYOB 3G5WA 4Z7QF 1TPXB 4PRPA 1S7UA 3C5XA 3T0XA 1H6FA 4RZCA 2P5WD 2R9HD 1HAWA 3W2DL 4ELKB 5F9WB 1CTNA 3I84A 2BINA 2UWEF 3F84A 1AXSB 4LLYA 4LSPH 4QRSA 5J56B 1I8KA 4MA1B 3RPIA 1UXSB 3MV9E 5FUCC 3C08H 4BH7B 5E23A 5DR5L 2YO3A 2KDYA 1FZJB 3MX0B 4ZOEA 3R8BB 2CGRL 4W9CC 4X9FA 2VQ1B 3GI8L 1Q72H 1BFVL 2QSVA 1OPOA 5BS0B 4HULB 4Y4HA 2EYTA 1PIFA 1MFEL 5C70A 2X1OA 3PGCA 5EBWA 5CJ5A 4FYQA 2QPUA 1PBYA 5M7QA 1RMFH 3BZ4B 3L3OA 5HGBA 3ULVC 1G7QB 1SDDB 4BQCA 2C4XA 1CQYA 2D0HA 3PRZA 2JJTA 3FT0A 4E9RA 1NM9A 3VM7A 1L7IH 2C4FU 2BVYA 4XVTL 5BRQA 5I8CB 4R2GD 4YK4C 1BJ8A 4AGQA 4H8PA 2DYPB 5J6GB 1F2QA 3EJUA 3QXDB 1L5GA 1DJXA 2IQAB 3QNFA 3U48A 2R2BB 5TE4H 3QUYC 2XWJA 2G4GA 3MYJB 5CLYA 5E1HB 3BDXA 2CXKA 3P02A 2GFBA 1HTYA 2F1AA 4WHTA 3X13B 3ARFC 2NX5E 3I02B 4OFPA 4N25A 2WXKA 5KBKA 3MOBH 4UMSA 3VXRE 3NMEA 4UM9D 1H8NA 3LS5L 4OCLC 3WY1A 4JLRA 3E7JA 5FV1L 5IESL 4J3OD 4QRPD 5KN5A 2WKOA 3DMMB 1QWNA 4X5PA 1CXLA 1W0WB 1LE5A 1TG8A 5D7JB 2ZOKB 2ED7A 4EDXB 4OSUL 3TNMB 4TUJB 4P5TD 5FA4B 2DLFL 4UQ2B 1U3NA 3WAJA 1E6OL 4HWBA 5CLXA 4KJPD 3K6FA 2E4FA 2CAKA 2D7QA 2OM5A 1XT5A 2F8XC 1U8LB 4JFQA 4OZGE 2EXWC 4JFDE 4U1JB 4J7RA 5I2IA 1UJ3A 1ID2A 1RUAL 4GKZA 2H3NA 2V8LA 3JWNC 4PREA 2FZ3B 1DJSA 2HKFH 3F6LA 3QDGA 5KZCB 1SMDA 1WZ1L 4NENB 4JFZL 4N9OB 4L8BA 4DUVA 5C8JA 3QUHA 5E2WH 2MJWA 2XV0A 4JS7A 2XN0A 1RZIA 4UV4H 2K3TA 3RGVA 2CHNA 2BVPB 1VKXA 5KVDE 4OIAA 2KLRA 5T5FH 3E2HC 4X6EA 3CZLA 1M9SA 2IF7A 1K4CA 1BVLA 4QR7A 5HPOA 3TJHC 5HYQA 5KVDL 3IXAB 5TQ2L 4PG2C 3V0JA 5KBDA 1P1VA 4UWQB 2HXAA 4BSVB 3LXCA 1CLOL 2G2PA 2F5AL 4KUZL 3S37L 1TLKA 4Q4EA 3N2JA 1WAAA 5LXVA 5MHSD 4IMKA 1NH6A 4TV3A 3QJUB 4R5XA 5GRJL 4AVJA 1TZHB 4OGAC 1H3XA 2DQGL 3D4GA 4NWTL 2XTJE 1CGUA 3GSVA 4DPAX 3ECWA 1NCWH 1KOAA 1S7UB 4DO6A 3GD1C 2BK8A 5FC9A 5SX4I 1PGRB 4PU2A 4L05A 4HU2A 5DD3H 3MLRL 3N85H 4KJQC 3RPIB 4GSUA 1CICD 1YAIA 1A66A 1ZSHA 3L2NA 5DDHA 2R4SH 2I9LB 3T8MA 3US1A 2L8AA 5G4NA 5EZIH 4GSRA 3SGEH 3QPKA 4FQLH 1HH6A 5A40E 2R8SL 1DQMH 1ET5A 1UKQA 3MLVH 4NYLA 5LN8A 5HPMA 1KCWA 3QULA 5IZ7A 4KC3B 1BF5A 3QFJA 2COVD 1D5ZB 4YSEA 4MJIE 2Z4QB 5ANMA 3O45A 4FNQA 4DQOH 1LVEA 2WSDA 3UC0H 4H13C 1MHEA 1SXZA 5B4MD 4P4RB 3IJYA 5J11B 2ZD0A 4LU5H 4LDLB 2CWRA 4PM1A 3IPFA 4N8VA 2BM3A 1UWFA 4DJMA 4HPOL 2P5EB 2G0LA 4BUHA 5JMOC 4JFXA 1R3KA 1RZFH 3QFDA 3ZTCC 1QFWL 3QQ3A 3QUYD 4B3VA 4E41B 1WS7A 4R97C 3VTAA 3D50A 4IIQA 1EEZB 4EKJA 4ZPVB 3ARFD 2CRZA 2GKIA 5T3XH 1P4BH 1SFHA 3E38A 4U0QB 4Q52A 4FD0A 1NFDB 2XUWA 3WO4B 2W0FB 3MXVH 1X5KA 1H15A 2EYRB 1ODAA 2X6VA 5GGRB 4O4YH 4PJBE 4ODSL 5BW7C 3HZYA 4JJ5B 1ZGLB 3FT1A 4X80L 4CUCA 5F21B 5AL8A 3CMOL 2F68X 3FQNB 2QHRH 5BQDA 2BCMA 4YHMH 3PXJA 4UDTA 2CO7B 1TITA 1JZEA 2V5RA 2BW5A 2JIXB 1BPVA 2BP3A 1YYLH 4H88L 5AOLA 3BAJA 4WSKA 3VXSD 4ADJA 4JVPA 2JCCB 3QUMA 2R0WH 2YZ8A 4Z7AA 1Q9LB 2LFEA 1N0LA 4ICXA 2X4RA 2R0LH 3PGDB 2YMOA 4LOUD 5JLZA 2F19L 1IVTA 5H8DA 3LDBB 4ZJ9A 3QEHA 3IDJB 4YOKA 2Y06H 3EOYG 1I1AA 2BVTA 4QO1A 1QQDA 2YD1A 4S1QL 4Z1PA 1E9OB 2HUHA 4W9ZA 3CLFL 4KXBA 5BJTA 4H1LH 4Z7NF 4P9HL 3JT2A 5JIPA 3BD4A 1A6TB 4NNPL 4FULA 4U3SA 5TDPA 2I24N 5T1LA 1XCWA 2FNBA 4HD5A 4Z18A 1JPGA 3WO3B 4Z7OF 5T33L 5JA8B 1NL0H 1JGLL 1WJ3A 3WDIA 3VXPA 2CIKB 5KVGE 1ZXKA 1OB0A 5HVGB 1NCCL 4ICWA 3PCYA 4IYKA 5HDQH 1KCRH 3L3GB 1ND0A 5LWYL 1KB5L 2UZXA 4OGAD 1I1RA 5GS0L 5KVGL 1AR2A 5ICXB 4R7DA 1R33A 2X89D 2QR0A 1CGYA 3FFCD 3FAWA 1A3LL 2ZOLB 3MQIA 3QIBA 4BXVA 2E59A 5I17B 5IQ9B 4AJYV 2AC0A 2X4OB 1Z0MA 4AT6B 4JFYB 2B1AL 4KJQD 5I5RA 4NNXB 4TKWA 3BD5A 4YFLF 5ISZA 3KEDA 4LSDA 1LNUA 1XAUA 4XVSH 4RMUA 4H5SB 1XSIA 5LNGA 5F6IB 2HRPL 1XR9A 4E9TA 4PVBA 4GQZA 1E8XA 5KSAC 2BNQD 2EH8L 2E7LA 2H41A 3GSQA 3U4AA 2DLEA 4RRPA 3O45B 4A38A 2ZSVA 2N56A 4B9GA 3B7SA 1VERA 3BSZL 4UV7H 1FFRA 4ABWA 3EOBB 1DBAL 1MVUA 1VEPA 3HBZA 2WHVA 5KG9A 3QSKB 3NA9H 3RL2A 3U6XA 5DZ9A 5HHOD 4ZAKB 2OXHB 1ZT1A 3KLSA 4GY4A 3B6SA 3SBWA 4LKXB 4F8NA 4XNUH 3WEXA 1M4KA 1VACA 5D7LD 2DQJL 4U1IB 2XZAL 4NZFA 3KBPA 1KIRA 3BVDB 1HDMA 1BXVA 4HWEH 2D2OA 2J1WA 2QKIA 2GAZB 3K8KA 3MLWL 5DHVA 1E5YA 3H9ZA 4AQAA 1U9KA 3T0EA 5DUJA 1JOIA 3KPRB 1MAML 4KAQL 4QMEA 3BPCA 1FSKB 4HHAA 2G9HA 3L6FA 1UACH 3ARGC 1OAZH 4X6BA 5AW8B 4ZDHA 5IOKA 5L2JA 2FWOB 5CSZB 1O7DE 3CN2A 1MVYA 4N0RA 3VD3A 3SGJA 3V6OE 1I3GH 3FTGA 4FI7A 4DCQB 2VH5L 4HP5A 3QARA 4RMBA 5D1XA 4Y2OB 2AHIA 5J9PB 3AXIA 3G6AB 3GT6A 3WGVB 4XAKD 2XKSA 1I85C 4YDVB 3OJDB 1NC2D 2VXTH 3N1FC 1FH2A 1MFMA 4DN3L 1KBGH 1ZS8A 1FNAA 3ETTA 3RRQA 1R4XA 3QJFB 3V79C 4H1LG 5AVQB 3SDXE 5BRZA 4OQTL 3D8MA 1I1AB 5E6IB 4JX0A 3ES6A 2NCMA 2IAND 2C9SA 2QSCH 2AMGA 5AB1A 3GSOA 3MROB 3Q0HA 3ZDZB 2Z7ZA 1TJHL 2BVQA 4FHJA 2YD2A 5B1JA 3VRIA 4OQ1A 3QHFH 3SQOL 5I0DA 3ARBB 1FWXA 2ESVD 4Y7OC 3I9GL 3OXSA 2P24A 4UT6A 5JUEH 3N44F 3EFOA 3VSTA 2FJSA 5H37H 1TQSA 3G3LA 4P5KA 4QTFA 1MI5E 3S36H 3HHSA 2V2XA 4NQSB 3IN0A 5JHDA 5FYKE 2O6EA 4QF1A 1AQDA 4E68A 4CGTA 2WXOA 3TZVC 3N0AA 25C8L 2WLLB 3BVXA 1TJGL 1IM3D 5FYKL 3KPQB 4YHIB 3LRSA 5AUMB 3UERA 2EE3A 4C56E 3MLSH 4UTBH 1TCRA 2CBMA 2B14A 2K0RA 5D7IA 1BV8A 1FO0L 2QPDB 3P54A 4RSYA 4BFOA 1J88A 3SKMA 1FAIH 1RXLA 4MA8L 2KYIA 1P5UB 3F7KA 1WHOA 4W9IC 3TO2B 4FTVA 4JM0A 4MXWH 3D3VA 5I1IH 1JGIA 4JHBA 2A5UA 1AYOA 2VXSH 2OS7A 2WLNA 5C6TL 5E7BA 3MRJA 1FYHB 4LEBA 1EJOH 1NUDA 1Z9SB 2LAGB 3O4OB 4GFXA 1YNTA 3MJ9L 1X7SA 1YEDB 4FA8A 3VD4A 1BAFL 1VADB 3F3HA 1KTCA 3FUJA 4JRXE 1DO5A 2XZQL 3VRJA 4A66A 3QNYB 2JJVA 4TLUA 5KVFH 4N2AA 4F2EA 3PWJB 1ESOA 4GP4B 1FL6B 3UTSA 4K94H 4HH9B 4GRLA 1ODUA 3L3JA 2B1HH 2OV0A 1RL1A 2XG4A 3PP3K 1FFPB 4KNSA 2BRRL 2OA9A 4YL9A 5K93A 2EDYA 2DWSA 1PKOA 3JZYA 1PD0A 2Q2LA 1ED3B 1NMAH 5C9JA 5GISL 1KTLA 1BA9A 1F6LL 4HJ0C 2JKSA 3CZSA 4ZTPH 3BW9A 3ARGD 1A7QH 3WFDL 1IEAB 2JI1A 3DUSB 1E5AA 1E5ZA 1MIML 3FTGB 2J8UF 4G6AC 5IY5B 4Z3FA 5F6HJ 5SX5H 4ZOBA 4LQFL 4UQCA 5LGHL 1X5FA 1OWRM 4NQCB 4EI6A 1SBSH 2ZUSA 1I3VA 1DJWA 4XZ4A 5KAQF 2HX8A 4LSUL 4OCMC 4ZBJA 3UXFA 3V5KA 1T3FA 1AZBA 5EO9A 2O5XL 4KDTA 1CJYA 3IFOA 5D7KD 5AAWC 4E0RA 5D2NA 5GSVB 1BOYA 1FLTX 1A7BA 1UQSA 2LU4A 3GPEA 3MRFB 3QIUC 4XE5B 1FNSL 1JMXA 1BVNP 3FPXA 4XI5C 2EEDA 4JL1A 4ZFFA 5C0EB 1QD0A 4I2XA 5H37G 1LO0L 4TS6A 2I60H 4ZG1A 2OZ4L 5F1OB 4P2OA 4E9YA 1PMYA 3OQRA 3CK0L 1X6LA 5MENA 1UOWA 4Q2ZB 1ZLVK 5CU9A 4CMMA 5EBGA 5CEXA 3DVFA 4I0PB 1RP9A 4Y2DC 3U25A 4IEFB 1Z9NA 1MCHA 2LFGA 3QPXH 4XRCA 1XZ0A 1ZVYA 5ETUA 5CD5C 2KQMA 4HA1A 1WF5A 2BSSA 4PW9A 4QOKA 1XGQB 2AZUA 3IKCB 4YEFA 3TZVD 5BVPL 5J4MA 1EHKB 1IAMA 3R7QA 3SPJA 2WKGA 4QI3A 1LM8V 2VIRB 3MREB 3UTZB 3T0DA 3MV01 1I8AA 2ZCLL 2E7CA 5C0CB 3SPVA 4EZLA 2XVGA 4HOWA 4DEPC 2UXVA 1HJCA 4PUBL 5IROC 3G6JB 2NNAA 3DX7A 1ZJAA 1AD9B 3K2UH 4U1MB 3UYOD 1FHNA 1C16B 3BPLC 3LXAA 4OGYL 2OMZA 4K3DH 4LP8A 4XCCL 1S5IH 3LKQB 4P4KB 4AZUA 1Q94A 2YUVA 4GXVH 4BZ2H 4DWHA 3NTCH 5FW6A 2BSBA 1AG6A 4FG0A 2ZXCA 3O8XC 4Y4FA 5SWZE 4LO9A 3NZSA 4Q9QL 1G0YR 2FX9H 2P1YA 1U0QA 4H8HA 1SY6L 3AU1A 1BQHA 2R1YB 3WNLA 1U8JA 3P2TA 2HFTA 2FQEA 2O4EA 4EXKA 2IJ0C 1HHJA 1YNTB 3T04D 1Q0XL 4G8IA 2HZHA 4HUXA 4DT2A 2X6AA 3WENA 2BNRD 1DDHA 2IDFA 4K71B 2Z93B 4M5YH 5DC9B 1DEEA 5A16A 4PJAA 5DLLA 1A6ZB 4YSPA 2NDGA 1TIUA 4LNRA 2ZCZA 3UGUA 4IOFC 4M62L 5H35B 1V54B 4XMPL 4TRPL 1BG1A 1HEHC 3CDGA 3HNTH 2IXQB 1NFDF 2AGJH 4BELD 4J27A 1QR4A 1SLVA 3LNDA 4N6QA 3SE8L 3IJSA 5IR1B 2YGQA 4CA4A 1S5HB 2IAAC 2VR3A 3G5XA 3FO9A 3C09C 4P2RA 1F4HA 2WLHA 5TE6H 1ORQA 1MCFA 4G6AD 4L3EB 3MRMB 4Y1AD 4F9LA 5EF3A 2YSSB 2P5WA 1LK3L 1T04B 1IIKA 4IK6A 5HYFA 2AK4E 3QI9B 3Q06A 2EVJA 4KZEL 5FFGA 3L9RA 3OHXC 1K2DB 1TKWB 2JSFA 4KRPB 1KJ3H 1NGQH 5AL0A 1O0VA 2R2HA 4BK5A 4AUJA 4NWUH 3QIUD 4MJ4A 4QHKJ 1GCYA 4AKPA 4XI5D 1P7BA 2K8QA 5C07D 1IC5L 1YEHH 3HN8A 2P8LA 4HS8H 3RY4A 5JIIA 2VZOA 1DYZA 1SFDA 4GIPD 4HAFA 4JHWL 4U05A 4L1DA 2YXVA 3BFQG 1QNZH 3HI1A 1UD2A 1AE6H 1WBZA 5LO7A 3UBXI 4JUTA 1YSOA 1SYSA 5TDNB 4HJUA 5CD5D 2AQQA 1WAAF 2Y0SA 1CDBA 1EWHA 3B2VL 2ZJSH 2W9LA 3HJ0A 4FQIH 3CDYA 3ZTNH 5A6IA 2BDNL 2LU5A 5CIPB 3KZ8A 1NCDH 1LP9B 3CVIL 3D0LB 3O4LE 4C55A 5JW4M 4YXKH 3CFEB 3QQDB 1MPAH 1XGZA 3RDTC 2APWA 5L88L 2XSKA 1KG0A 2YGVA 3W9EA 2DTMH 4M1CD 1QPXA 3JYCA 5TQ0H 4X7TA 4UQBA 3HUJA 1GOGA 4UOZA 4IRSC 5JNYB 2ZX6A 3EOTH 3FQRB 4RA3A 1J7VR 3P4NB 3TT3H 3SYPA 2YKLH 4YDIL 5DJ6B 4H25A 4KGJA 4DKDC 4CGUB 4MBRA 3DOSB 2ERJC 3DX8B 1KXHA 4L4VD 3QUMH 1HSBA 2B20A 3OXRB 4NQXA 2BY0A 4YSCA 1T5WA 1OSZB 3RPKA 1C7SA 5E6ZA 1N0XH 2GBVA 1ZDQA 4JQXA 3BAYA 3U9PL 5JXAH 3MRGB 4WO4C 5SWSA 1H3PL 2D73A 2IBBA 3GSXA 3V4VA 2XVKA 4DGVH 1UH3A 3O3BA 1U21A 4GI8A 4H20L 1MJUH 3CTTA 3O6FB 4YX2L 5I82A 5IM7A 4H40A 4IOFD 3GSUB 4UOW1 3MRNB 3JUYA 2AITA 1JI1A 5ESAA 5PCYA 3UTTE 4PRNB 3US9A 1J1OH 2A6JA 1OY3B 2EYSA 5KYXA 1IM9B 3QUZB 4HOMA 2X40A 4X6CB 4YHOH 2EABA 3UO1L 1XGYH 5K9QI 2HPOA 4WKZA 2Y7MA 1ORQB 4FLOA 2P8MA 5LKNA 2MQCA 1R46A 5FCUL 2IPTL 2NLJA 1CFSA 4WDIB 2P5WB 4R8WL 4N20A 2JK5A 4ZMZA 4UOJA 3F7RA 5IVZA 2CDEA 2ALWA 1CICA 1M2VA 1ZHBA 4H8UA 4AQEB 5AVRB 2ODIA 1UHVA 3IFPA 5CP3A 3ZDXB 1CLVA 4EIZC 1U8KA 2ARJQ 2NRDA 1QPPA 5DC4B 2P9RA 4Z95L 3RB5A 1MY7A 1CFQA 1A7OL 1RQ5A 5HI3C 4N0UE 3UTPE 4ZW3A 4Y1SA 3KPMB 2VW6A 2WXMA 4WCYL 3WJMA 1KPRA 4OZ4A 5DQ9A 4NRZA 4N8VG 1AZUA 3NRQA 4JFVA 3OAWA 3D12B 1BZDA 5EOCH 4Z76A 1O9ZA 3V4UL 4ZO7A 5H2BB 4R2GB 4OZHE 3FCTB 1JZJA 3FQUA 4M9PA 3L3IB 3VGHA 4NPYA 3QUYA 3T2NL 5E6UB 3BP5A 4IU2A 1IBYA 3NVQA 2Q3ZA 3D4CA 4WEMB 1T6WA 1VFAB 2CHWA 2KZBA 2FBRA 4HCFA 4BWUA 2HFFA 4UM9B 32C2A 3MLZL 4NXSA 2DDQH 2FDBP 3KGTA 4ABUA 3CIQA 2YAMA 1JVOA 4K9EH 4QRPB 3HR6A 4Z78A 3RDTD 3VFVB 5ECJE 5DHVH 5IW6B 3LQAH 4L9DA 4JKPH 4O2EA 1SXNA 3J8F7 3QWOB 4P5TB 2V3DA 3RYMA 1AXIB 1G4MA 1LO5B 2FJHB 3FC8A 4XB8A 3MRHB 3BHBB 1NUFA 3I9IA 3QHTC 3MODH 4TUKL 1MCEA 3LV3A 3ZU8A 1MCLA 3KYMA 5D72H 5IW1A 1MELA 3P9LB 2UZYB 5EBMA 5DUMH 1C5DA 2CO6A 2FLMA 2X9ZA 1I3RA 4KMTH 4NN6C 4K5NA 5HDWA 3RTQA 4D9QD 3ULUH 2LHAA 3ZL4H 3HLAA 5ALCL 1UWGL 1NGXB 1HOCA 4J3SA 3BH9B 3TBYB 1RZPA 2WYTA 2JF1A 1DBKH 2ROYA 3D1MC 4F7MB 1WQVT 1P9MA 1I8MA 3QRGL 5HHME 1KXTB 5E2UH 3ETSA 2R69H 1J05B 5E94B 1P6WA 4FZ8H 1BECA 1JHTA 1I7RA 3PP4L 4J3XA 4X8CA 2C3VA 2UWEE 3O3BB 1HYSC 1IJ9A 3HE7A 5FYLE 1N2RB 4PW3A 4JO5A 7FABL 3JVGA 3PHOB 4W9DC 3HI5L 3MCYA 2CHXA 2MPAL 1GYVA 5FYLL 4F57H 1DQDH 5T1KD 1UATA 2L7EA 4PS3A 4BA0A 4F7PB 4JB9H 1LO2L 2CXGA 5DRNB 1FPTH 2WQUA 1AS6A 3WN5B 1UENA 2BWDA 2J43A 1WG3A 2H0JA 3GBDA 4XCYA 1R0AH 2X89A 1IE4A 5D70L 1KV7A 5J12B 5DWUH 5HGDB 1I7TA 1ZHKB 1A6PA 3SZKC 4OZIB 4D0BA 4LE8A 4J1UB 3ULUF 1JSYA 2CDEB 5IVXA 2TSBA 3QEQE 4U2YA 1ACXA 4M1GH 4MZRA 3GMNB 4R4BA 1NCBH 2J6EL 1OEZW 4L37A 4NN7C 3KBHE 4NNYB 5AWNL 5EEZA 3TT1L 3WXWH 4ERSL 5KVMC 3VD9A 1WZLA 4RRPG 3TJEL 2QFRA 2Y25A 5I1DB 2LTQC 4JKMA 1FCCA 5TJWK 4DW2H 5I23A 3VD7A 1S7SA 4WWNA 4Y5XA 2DKSA 1E90A 3S97C 1FFOB 3JWOC 4R96A 5DCCA 3P0VH 2WWMC 5BV7C 4ZUWB 3APNA 4YUEH 3MZGB 4IIZA 2GJ6B 4I0KA 1ZLWH 1KCLA 3DVNB 1OAXL 4YK4B 2CLVB 4IBTA 4OCRH 5E9DE 3C08L 4GBXA 4FABH 3EBIA 3EYQC 2J8HA 3RWFB 4WO0A 2IOOA 4GS7C 3QCUL 2APSA 3PL6B 3AWFA 1U3JA 5AOMA 2VDRL 4Y9EA 3BN9C 3IFLH 3ARFB 5D7LA 5E08H 1Q8MA 3D25B 2ICES 3IJEA 2WW8A 4X6DB 3VB9A 1IGJA 3DX9B 4HWZB 2OMWB 3MRPA 4AYMC 3G5ZA 3S9DB 1TFPA 5FGCE 4XBEH 2V7HA 4YSRA 3TGXA 2ZUWA 3BGMA 5L2KB 4AMXA 1NQBA 2OCCB 4LHQB 3HZKB 3JTTB 2VR9A 5DZAA 1D6VL 3Q8BA 1E5BA 1MFCL 2F53D 4JDVB 5GS2D 1PLCA 4NUGL 1XB6A 5TPWL 5BW7A 2CK0H 4KK6C 4L4TD 2A9AA 1YG9A 2MCPH 1YY8A 2Y07L 5IBTL 2PW2B 2EE0A 5FO7A 3LEVL 1HZKA 3V0DA 5ICUA 5D7IF 4F1SA 4JGJA 3RIFF 3UYRL 4N8PA 3G6JF 4PJEB 4HS6A 4Q4IA 4P9ML 3KYOA 1PZ3A 1IC0A 4XXDA 4G7VL 2GC4C 3MNZB 4PJHE 3VXSB 2OTWB 5IG7B 4MQSB 2ZP8A 3FL7A 4W70A 4WY7H 2DQCH 4WNSA 1JPSL 1J1PH 1M71B 3U46B 1IBFA 2D9QB 43CAA 4NSKA 4P3DA 1QLEB 3MJ7A