3RYMA

Structure of oxidized m98k mutant of amicyanin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFKRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amicyanin
publication title Replacement of the axial copper ligand methionine with lysine in amicyanin converts it to a zinc-binding protein that no longer binds copper.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 24
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3rymA00
1ZIAA 2R7EB 3DTUB 2DYRB 2WO3B 1KCBA 2J5WA 1PLBA 2Y69B 4A2DA 1OCRB 2BW4A 2EILB 4G72B 1PNCA 1JZFA 4KNTA 1PY0A 2IH8A 2ZONA 1NPJA 4MFHA 4NAJA 2BWDA 7PAZA 1CYXA 3NJIA 1JOIA 1M57B 1MG2C 1WAEA 5PCYA 2X87A 8PAZA 5I5MA 4RH4A 4W9ZA 1NIFA 4A66A 3FSAA 3KW8A 1QHQA 2XV0A 2GIMA 3FU7B 1ADWA 4KOBA 3FYIB 2YAHA 3ABLB 3L45A 2N0MA 3TASA 2IDQA 1WS8A 5F7AA 4YSPA 2EINB 1OCOB 4GXFA 1JVOA 3GDCA 2FT6A 3WNJA 4DP2X 2CBPA 4E9WA 2WO2B 1GYCA 2IDTA 3UAEA 2VM4A 5LDUA 2PP8A 2XXGA 3FSZA 3TA4D 1DYZA 1RZPA 1F56A 4E9QA 4YSSA 1GR7A 1SFDA 1BYOA 3CVBA 1A4BA 1OCZB 4L0PB 4ENZA 2FQFA 4AKPA 3FT0A 2VM3A 2UX6A 1VLXA 3H56A 3KW7A 4YSEA 1BXUA 1BEXA 5I6KA 1ID2A 1TU2A 2FWLB 2GC7C 2VW7A 2XX0A 1GY2A 4GYBA 5I28A 1SDDB 1CURA 5AKRA 3NYKA 1WS7A 3X2QB 4N4YB 2PPAA 4HZ1A 5FC9A 1AQ8A 1OCCB 1B3IA 2AANA 1HFUA 3DIVA 2H3XC 2BZCA 2QPEB 5B7FA 3NJFA 1AZCA 2TSAA 2B08A 2LLNA 1ZIBA 4K9JA 2HXAA 3QQXA 4AX3A 1PF3A 2XYBA 1N70A 2BP0A 3NT0A 4KNUA 3QJTB 3S3BB 1W8EA 1IC0A 1BQKA 1AAJA 3CZUB 3IE9A 1AZUA 4DP5X 1SF3A 4BWWA 1AR1B 3UAAA 4DPAX 1SHXA 2IH9A 2IWKA 4YSTA 3WIAA 1BQRA 1XB3A 4M4RB 3MBWB 3RYMA 4UF7C 1IUZA 4PAZA 3QPKA 3AG3B 1R1CA 3ASNB 1PLAA 3WNIA 1CC3A 3HB3B 1IBZA 4BXSV 3UGEA 4YL4A 1GW0A 4BWUA 1AG6A 1UATA 3EH3B 3OMNB 4DP0X 3D12B 2W88A 1AIZA 2TSBA 3IN2A 2XUWA 3C75A 1A4CA 2BW5A 2GHZA 1AZNA 2PCYA 2YQBA 3ABGA 4E9VA 2YXVA 5D4HA 3CVDA 4F7KA 5D4IA 1QNIA 1KBWA 2PPDA 2FT8A 5I6LA 4AKQA 1A65A 2HLEB 3T9WA 3NJHA 4GP8B 5I6OA 2XV2A 3NSCA 3UACA 1JVLA 1SF5A 2AZUA 2GBAA 3X1EA 1NICA 3NSFA 2XLLA 1KV7A 1J9SA 2MRYA 1BAWA 2XVBA 2VSKB 3TBBA 1E67A 1I53A 2UXVA 1BXVA 1MZZA 3AG2B 1PCSA 1ASPA 1GS7A 1WA0X 4E9XA 2VSMB 1A3ZA 3SBQA 3SBPA 3ZIYA 2HRHA 4P5RA 3NJGA 2DV6A 5ANHA 1PLCA 3S3DB 3X1GA 5F7BA 5I6PA 3S8FB 3WKPA 4YSCA 2PLTA 2NRDA 2MTAA 4HCIA 4HCFA 2GI0A 3OMAB 1OE3A 2DWTA 4P5SA 3PXLA 2VW4A 1X9RA 3JTBA 3ZDWA 1HAUA 1GSKA 2DY2A 4PCYA 2H5UA 2FJSA 1XB8A 1NIDA 1FFTB 3H4HA 4AZUA 2IDFA 1JZHA 2P80D 1OE2A 1BYPA 2JKWA 4JHUA 2VN3A 2P80A 4YSQA 3NJLA 3WKQA 2CCWA 3EH5B 4WKXA 2J56A 2OCCB 4KOCA 4GY4A 4BDVA 3PCYA 3N2JA 3PAVA 4G7QB 1W6LA 5IY5B 4E9RA 3PAUA 3ASOB 5PAZA 1URIA 2GC4C 1MZYA 1NIEA 1PZBA 4A2EA 3AY2A 3FU9A 1GS6X 2Q9OA 3CVCA 3IN0A 3NP4A 2I85A 2XU9A 4W1TA 6PAZA 1ETJA 2QT6A 2FNWA 1JZJA 2PP7A 4E9SA 1JERA 1IBYA 3IBOA 3EF4A 3GXUB 3NJNA 1DZ0A 3T6ZA 2BP8A 2OJ1A 1AZRA 4G71B 3FSWA 1E5ZA 9PCYA 4A2HA 3NJJA 1J5DA 3NSYA 3NJMA 2AFNA 4DP9X 3ZBMA 5B1JC 2GB2A 2HX8A 5AFAA 4CSPA 4GP4B 1ILSA 4BDVB 3PLYA 3TU6A 4KO9A 1J9QA 1HAWA 5AZUA 1E65A 1MDAA 1WA2X 1M9WA 2UXTA 3ABKB 3AG4B 3UADA 3IEAA 3HEIB 2BP0B 2OV0A 4YVUA 3X1NA 1ZPUA 2RACA 3OQRA 3V9CA 2X88A 5I5JA 1NIBA 1ZV2A 2EIMB 3EHBB 2YAOA 5I26A 2I7SA 2UXGA 1YLBB 4F2EA 4BK5C 1WA1X 1AS7A 1N68A 3X1FA 2VW6A 4KNSA 4YSAA 4DP7X 3OMIB 1EZLA 3OM3B 2BP8B 4DP4X 1JZIA 2FQGA 2YARA 1TEGA 2J57A 2YAMA 3CDZA 3N55A 1L9RA 3S8GB 5B1BB 1AACA 4NB7A 2IAAC 1XMEB 4G7SB 2GSMB 3DKHA 3WI9A 1FA4A 1IKOP 4Q89A 1ILUA 1JZGA 1NIAA 1E30A 3GYRA 3QJSB 1PZCA 2BWIA 2CJ3A 1OV8A 3UABA 1KCWA 3AW5A 4ZK8A 4DPBX 2UXFA 2JXMA 5B1AB 2AZAA 2FTAA 3ERXA 2I7OA 3FU8A 1NWOA 3T71A 3T6XA 5B3SB 4F2FA 2QDVA 1CYWA 4GP5B 4HHGA 3V9EA 1ZDSA 4FAAB 3S3CB 1A8ZA 4A2FA 2CALA 4DP1X 1KYAA 3U25A 2YAEA 4YSUA 4YVNA 3ABMB 2B3IA 2IWFA 2IDUA 4BXVA 2IWEA 1EHKB 3FPXA 1AANA 3NJKA 1RZQA 3JT2A 4DPCX 2EIKB 2QDWA 1V10A 5E9NA 1NDTA 3SBRA 4DP8X 1AOZA 4M3HA 1ET8A 3CDZB 2Y1AA 3NSDA 3PAZA 5D4JA 1TKWA 3QJUB 4HCGA 1CUOA 1ASOA 1J9RA 1SDDA 2FQDA 2HRGA 3FQ1A 2XXFA 4BWTA 1L9OA 1KDIA 1AS6A 5B1KA 1RKRA 3FSVA 4FA7B 4WTQA 1JXFA 5EHFA 4X4KA 2BO0A 3FPYA 3MX0B 3QJVB 3QJQB 2FQEA 1X9UA 1NZRA 4JKNA 1SNRA 2PPFA 1E5YA 1FWXA 1ASQA 1OE1A 5TK4A 1J5CA 1BXAA 1V54B 2EIJB 4E9YA 3BVDB 2DWSA 3CG8A 2XX1A 2IDSA 4YSOA 4AKOA 2YAQA 4N8UA 2PP9A 2PPCA 4EF3A 3X1BA 1BQ5A 1AS8A 2ZXWB 5B1JA 1NTDA 4YSDA 4A67A 1L9PA 1KGYE 3WG7B 2BHFA 1JZEA 3H4FA 5TK2A 4AI7A 3OD3A 3NP3A 2CAKA 2BZ7A 2XV3A 2VMJA 2A3TA 2E86A 2HZHA 3FQ2A 1QLEB 4Q8BA 4UAHA 4A68A 1PMYA 4HHWA 2Q5BA 5I5IA 1KBVA 1MG3C 4TXVB 1TEFA 2ZOOA 1KDJA 1L9QA 1PAZA 3G5WA 3QJRB 4NERA 3AZUA 1ET7A 3SQRA 2QPDB 4G7RB 6PCYA 1GS8A 4E9TA 7PCYA 1SHWA 1NWPA 5I6NA 2DYSB 3FYEB 5B7EA 1SFHA 4UANA 2YAPA 5A7EA 4QKTA 2R7EA 1NPNA 4HALA 2H47C 4G70B 4HIPA 2JFCA 1J9TA 1OF0A 3FQYA 3AG1B 1NINA 4KO7A 2J55A 1AG0A 2CUAA 3EH4B 2WSDA 1ZDQA 1A4AA 2HX9A 2UX7A 2YAFA 2ZWNA 1PZAA 2YXWA 4KO6A 1ET5A 1JXDA 1M56B 1L9TA 1W6WA 3TBCA 1T5KA 2PPEA 3PPSA 5I6MA 4DP6X 1AZBA 3FS9A 4HAKA 2HX7A 3BQVA 4KO5A 4QLWA 2AVFA 5B7MA 2PCFA 4JHVA 1JXGA 3FU7A 2XWZA 3T6VA 1XB6A 4CSZA 1L9SA 1OOWA 1GY1A 1PNDA 2FT7A 4YSRA 3T6WA 1RCYA 1SJMA 4A2GA 1V55B 3ZX1A 2W8CA
chains in the Genus database with same CATH superfamily
4HFWB 3D3VB 4ILDA 4U1SB 3SDCC 5I1EH 4PJ5D 1DVFB 2WBJA 1JWUA 4NWUH 2DQFA 4OIAA 4C56E 4GIPD 4JL2A 4J23A 1T1ZA 3A6BL 4UM9D 3DOIA 3VYNA 1XSOA 4LZKA 4UTBH 3VDCA 5I23A 5JIMA 2CDFA 2G0KA 3KPRB 4HBQA 2VUKA 3AXLB 4JM2B 1Z0MA 1UWGH 1JZFA 1MCWW 2AK4B 2E7MA 3AQYA 3FQ4A 1FVEB 1NEZB 3EGDB 1RPUA 1TMQA 4QNPF 4K5OA 5EBGA 5CFHA 1DTUA 1WAEA 3WO3B 1HWGB 1AXSB 3GMQB 4AE0A 8PAZA 2J73A 4W4NA 4NSKA 3TJPA 4A66A 3MKGA 1LDPL 2JI3A 5F0JB 5CSZB 4JRYA 1UURA 3FYIB 1CFNA 2Q76B 3D48R 4LU5L 4LLVB 3BKJL 1KJ2H 5BO0D 3GHEL 4ELMB 5AAWA 4O5LL 3ZN6A 3BZEA 4XNZB 4YJZL 1OK0A 1TZOA 3KLKA 4PYHA 1B88A 2OM5A 1YEGL 1AKJD 2EJ1A 4AEIH 5D2NE 4HC1L 3TO4B 2P5WB 2EYRB 2WVSA 3HE6A 1TSHA 3DXAB 3KHQA 5TFSH 1TVHA 5K9KB 2FLRT 4GRMA 5E5MA 2A9DA 3WENA 1UWYA 4G59C 3DRQA 5I74C 4GKNB 1D9KA 4WWOA 2VQUA 4FP8L 3DUUA 4NBYB 4CMHB 3RU8L 3H9YA 4B9GA 1P6AB 4ORGB 3BN9C 2WNKA 1IQWH 2BM3A 4HIIB 1GW6A 4NHUA 3L3OA 4DEPC 2JJTC 3HZYB 2PPAA 3V4VL 1AE6H 1M1XA 3M7FB 1BEYL 4A6YA 4E41B 3L08A 5HYFA 3ZMNA 3UJIH 3O6ML 4QRFA 4X99A 3QEUA 4I0KA 4ZD3L 4N0CC 5DJZB 4RMBA 4R90L 3F58L 5FPIA 3R4DA 3RTQC 3HC4L 4AX3A 3DIDA 4PJBA 2BIOA 1P6FA 1A14L 3KJ6L 1WC7B 5EU7E 4NUJB 3C2AH 4OW6A 4Y1AA 4N9OB 4HIXL 4Z3TA 3WL9B 4D9LH 1ZRUA 2BOBA 2NW2B 2X89D 2V3FA 3IJ9A 2QGCA 2XZCL 4MQXD 1XCXA 3GO1L 5ITBH 1J8SA 1QO3A 4EQ3A 4Z0XB 2O4EA 4UQ9A 4F58H 4UM8B 3AG3B 4ZTOH 2CR6A 1WIOA 4YHLH 1IT9H 3O4LE 5BVPL 4A37A 1E9PA 4TYUA 5DJDB 4DCQA 3SO5A 2UZIH 2JIXA 1OTTD 4NIYE 2JKRM 1A8JH 2WLLB 4LMQI 2G3ZA 3W2DH 2UY7A 3H3BC 4F37F 1RHHA 1BFOA 5HHOA 3VG0L 1DL7H 1FDLH 1AZNA 1XR8A 3HKZA 3QFJD 2RH0A 4UMSA 5I73B 1QTYT 1NLDL 2NY0B 2V7NB 2YXVA 4I9WD 4F7KA 4ZS6C 5KSUB 3NPSC 5I6LA 2QHRH 4F80A 2H9GB 1MREL 3GKZA 3BE1L 3NJHA 3JV0A 1TYJA 1MCDA 1NCJA 3GB7B 4EZKA 3Q43A 5HI5C 3CQPA 1IGIH 4XPGH 5IOPA 4HH9B 1CK0L 2CK0H 1BVKB 4RAVA 3L9YA 3MLVH 2IPTL 3ZZLA 4OAWA 1DQDH 5L6YH 4HXBH 4XP6H 1TZHB 4CL7A 2F15A 2VH5H 1NCAH 2IDCA 1EH9A 1P2CB 1DVFC 2APBA 1UVQB 1TQVA 4C56B 3MNMA 4L3ED 5HYQB 3RJDA 1UZ8B 3S88H 5HHMD 2PF6A 5CJQL 5C0GB 3PNWA 3MKKA 5E5LA 4Z7QE 3PL6B 4JM2C 1ED3A 4HUNB 4I0PB 4UQ2A 1KGCE 2CHDA 3R7QA 5LWYH 3U1PA 4FQ2L 4X80L 1X5LA 3G08B 3M6DA 4KXAA 2VR9A 4RFOH 6CGTA 1VFMA 3AB0B 1QD0A 5AW6B 2WGXA 4L2YA 3QEQD 3RKDD 4M7LH 4P05A 4NQDA 3VXUA 1S9WB 1QASA 3U4BH 2Z4QA 2YD5A 3L1FA 3KWXA 2FX8H 3K72A 1UXWB 4R7NA 4QRRA 5KVFL 4NC1E 1YEFL 2AEIT 1QFOA 4X8JB 1GSKA 2FWOA 2H7WA 3HN3A 1CLVA 2C9QA 4XNZC 4XWGH 3IDJA 1D7BA 2DQDL 4JPKH 2R0ZH 3QRGL 1RK0A 3TO4C 3SHSA 1JK8A 4KI5E 3PJSA 1INEH 2FZ3A 3MACH 4JO4L 5I6XB 5D7JD 5IJCC 2GBTA 4WRLA 3I3BA 3TEXA 2GTZA 2LABA 1PS3A 2AHIA 3LB6C 1QHOA 5BZDA 2IOIA 4I48A 5CLWA 1ES0B 3E9UA 1FGVH 3RWFA 1KB5L 3IJSB 3QJFA 4M1CD 4BRJA 2HKFH 2NQDA 1A66A 3PAVA 4CMHC 1Z9PA 4OB5L 1B9ZA 1QP1A 5F8RC 1JRHL 1A6UH 1HHJA 2W65A 4PJ8A 1JGLH 4MNQE 2AXFA 4CVXA 1J05B 1G94A 3V95A 1CFTB 5J13B 4U3SA 3TYFB 2GSIA 1FLTX 2AJXL 3LQAH 1AR2A 4E36A 4MD5B 2W92A 3ETBJ 1OGTB 2FIRT 5CJ8A 2X05A 4LASL 2BMKA 2C4XA 4AH2B 4E9SA 1IBYA 4L1LA 1AO7A 4J4PC 1OPGL 1PG7W 3K6SB 4AMXA 1HL8A 1USZA 1VF5C 5GGUB 1FL3B 2Y36H 2AJVH 3CPLA 5K9JL 1RFDL 1I82A 2FCBA 5KVGL 3C5ZB 4GUPA 1PKQE 4A2HA 3VXMA 2D4FA 4JG0H 2O61A 3IKCA 2MHAB 1GPOH 4NYLA 5C0BE 4FTDA 3B2DC 1S9XB 1L6XA 4KO9A 5AZUA 4H8WH 3IXAB 4TQPA 2LU7A 4WEMB 2UXTA 2X2JA 4AV0A 2N59A 4HPHA 2IQAB 5I0WA 1N3NA 1WCBB 3IM1A 3O4LB 4JFQA 2BP0B 2ZJSL 3UCRA 3JVGC 3U2SA 2CR3A 4MLIA 4PP2A 3V9CA 5IBLD 1NIBA 3IGLA 4OQTA 4PJ7A 3WGVB 5MEPB 3NN8A 1J1XL 1ZV2A 4NKMB 4WW2F 3VFPB 3NZUA 2BSTA 3ILPB 4NO0D 4D0BA 4F8TA 1KZQA 1BQUA 4AENA 1N68A 3P2BA 2JNZA 5DRXA 3SQBA 5H37A 1LO0H 3F85A 3OX8B 5I73C 5MENA 2MKWA 2NY0C 1JHKH 3SDDB 1BGXL 1QSVA 3PPEA 1E5UI 1HZLA 1IVLA 4JG1H 1E8XA 2OZ4L 4NZFA 4LKCB 4UBDD 4WO4D 5FYKL 1FO0H 4YR6B 4KI1A 1LE9A 5C9JB 3VFNA 1PZ5A 2VUYA 3UABA 2CH8A 4XBPA 5LJYH 4PV9B 1DVTA 1JG9A 2CBOA 3FQTA 3RWJA 2D7MA 2GJZA 4POZC 1MHEB 1EJOL 1JSYA 3NCYP 4GP5B 1P5UA 4Z7QF 5HPMB 2EC9U 4HDIB 2YQGA 3LYRA 3D08A 4FD0A 4LDOB 1VCBC 4Z0BH 3KEHA 5D1QD 4YVNA 2OYLA 5CU9A 2A4CA 3BQUB 4WV1B 4WAFA 3SKMA 5JW5A 1XGYL 3PL6C 4FQXB 4I0PC 1W0YT 3HR6A 3IJ8A 4X6EB 4XMPH 2GK0A 3VE0B 1GJUA 3NSDA 1IMHC 1RJLA 1NOFA 4XP1H 5LQBH 1U6AH 1A7RL 3AB0C 1BW8A 1VESA 4U6YB 2WB7A 3MRBA 1ZGLM 2CO1A 5F96L 4DK3A 1QFUL 1IAIL 3K3QA 5IW1A 2DIEA 4WVRA 4XMWA 1RUQH 4TV3A 4FA7B 5A2IH 1H8NA 2P48B 2A77L 1O6SB 1YY9C 3BVWA 4QHLA 5EBLA 1ROCA 2JXMB 4ADGA 4AIZB 4PWFA 1OT2A 3PWJB 4JFHE 2BXZA 3FQRA 1N12A 3B2UD 2YOAA 1HL5A 2F8XC 3SD5A 3C5SA 1HEHC 1DJIA 1N18A 5I6XC 2Y2YA 4UDTA 1G5AA 1IBDA 4YDKL 2ZXWB 4FXTA 1DUYA 1HESA 3L5XH 4L8SA 4YSDA 3WTUA 3N42B 1NGXA 2YD8A 3WELA 4U7MA 4L4VE 4F24A 3BVNA 4R7XA 4ZUWB 2CAKA 3HR5B 5IGXL 4MNQB 3N44F 4JB9H 3TBWB 4Z7NE 3I6SA 2VWEC 4M6OL 4UAOB 1NEPA 3MC0A 5J13C 2PTTA 4H13C 3L2LA 4L8BA 1LD9B 1KBVA 4B95C 2AK1L 4RAHA 3IYLW 4G6AD 4ZYKA 3TEUA 3CLFL 3K5SA 3IDGB 3OJDA 5B4MD 3ARBB 4JK0D 4ZUUB 4B41A 4KX7A 2H3NA 3SQRA 3ZMRA 3AS1A 2Y7MA 4LHQB 4YNYB 4MASA 2DYSB 1UB6A 3MRMA 3NDZE 3VU2A 4TNFA 2IH1A 1PKQB 2ARJB 3C5ZC 1H0DA 4W6YB 2ZCKL 3QVAA 4LKXB 2C3XA 3OXRB 3SGDI 3LXBA 3MBXL 4FJ6A 4M62L 3DVIA 5J1AB 1XO8A 1L6PA 4QHUA 1M71A 2OR9L 5C0BB 5DMGC 1T6BX 4RMUA 1FORL 1ODUA 1T4WA 2V4LA 3CN4A 5DJCB 2XI9A 3V6ZA 2ZWNA 1G9MH 4FG0A 2JWYA 3RY4A 2QPFA 2E7HA 1A7OH 5CIPB 1BFVH 1QFHA 4EN3B 3AWFA 4Y4KD 1XGRA 3EBIA 3MRCA 2CPUA 3TBSA 3ZHFA 3HG2A 3GBLA 4AW7A 3S5LB 5JQ6H 4WUKL 2VDQH 4PRHD 3EYOA 2AEQL 5DJ6A 4PBXA 1P0SE 5FB8B 1CVRA 2R69A 2FYVA 3RWHA 1OTUC 5D7HA 4Z23A 4OZHF 2XWZA 2Q3ZA 4M03A 4CSZA 1OOWA 4MXVF 3LV3A 4GW5B 1FI8C 5GS2H 3SDDC 3VRJB 2DYPD 1HVXA 1R33A 1PLBA 4V1DA 2Z7ZA 3VGEA 5BV7B 5JHMA 1GA2A 3EOTL 3LKNA 3Q6GH 1BPLB 4KROB 3RAJL 2BVOA 3PDGA 4AUYA 1G7MB 4YDNA 3WHE0 1CFVH 3ISWA 3VM7A 1JPST 5ETUB 2B1HL 3NA9H 4HBCL 3L3IB 5C0DB 1OCRB 4MDJA 4PLJD 2QZQA 4NQCE 4HAGA 3LRKA 3TYGH 5I1EL 2IH8A 1BD2E 1HXMB 1VENA 5DUJA 4NWUL 3P69A 3UDWA 1G7JB 3GTTA 5AD0A 3FONA 2APSA 5I5MA 4WI2A 2QTEA 2YD0A 3KPPB 3BSZA 4KX9A 3VFWB 4HOZA 2EDKA 3T04D 4X7TB 3FSAA 1JDDA 3CIQA 4JJ5B 4UTBL 3V4PH 5J6HB 1GSMA 1LMIA 2PYED 3BQUC 4WV1C 2VC2L 3WCYA 4FQXC 3IRCA 4KH9A 3TBYA 2N0MA 1VPOH 4QY8A 1OGSA 4DO4A 1BIHA 3L1OH 1AGEA 1KEML 2L04A 1J18A 3PUUA 2WK2A 5DURD 4F7EA 4QT5B 1E0OB 4DP2X 2BXYA 4EDXA 1C5DA 5T1KA 2APWA 1KJ2L 2ZKYA 4NC1C 3TA4D 2C3VA 4CNIB 2L0DA 1BYOA 3CVBA 1A4BA 4PJFF 4WHYH 5ICXB 5C97A 1USQA 3QYMA 4M00A 4GSUA 4AEIL 2GUYA 1Z1WA 1FHNA 3ELAT 4XPFL 1ZK5A 4KI5C 3RX5A 1RAMA 3BGAA 4YGVA 5JW3L 4KZDH 5TFSL 2BWQA 3T09A 1PU0A 2DLGA 5AKRA 1GCYA 1NGYA 2YJQA 5IBUG 5C6TL 4I2XA 3GSRA 4J2XA 3LHPH 4GFXA 4NJAH 4L4VB 2F68X 1T04A 2P24B 3DGCR 1RLWA 2F18A 2VLKD 2N3JA 1IQWL 3QT2A 1ZANH 3ZQXA 1T20B 4C47A 5CD3A 1FNLA 3F01A 4GOSA 1LK3H 4Z7NB 5IVXE 4R4BA 5J6GA 4EEEA 5TGBB 4UAOC 4AGPA 2J1XA 1EIBA 5EC2B 1AE6L 4UZGA 2VLRB 4E0RB 4N0UA 4MAYA 3I02B 4HS6B 2VE6A 3S2AA 3MXWH 4RGND 4TQ8A 2IFFH 3ARBC 1KSRA 1MAMH 1AIFA 1GHFH 4F7CA 3MNWB 5EWIL 5D8JL 5ECJE 4MD4B 5I17A 4NO2A 1SM3L 1NCNA 3P3TA 4ETQB 2J43A 3T3PE 4Z1PA 1QEXA 3C2AL 1H19A 4FNTA 4NQSB 4PVNA 1T0MB 1A1NB 4QXGH 4LIQL 4PFEA 1INQA 1CC3A 3V4LA 1X4YA 4JFWA 5LB1A 1MVYA 4HMCA 2EDRA 2R83A 4B9PA 1P9MA 1R3LA 1MFAH 5CR8A 5DZVA 4N2FA 4BWUA 1GZHA 3UTTD 5ITBL 4P2OD 3GTNA 3O0LA 2ARWA 5DD6A 4F58L 3ARED 4KXDA 4ZTOL 1U2HA 3H2PA 2BOLA 3QDME 4XOCA 1IT9L 5CMAB 2XUWA 1QAWA 2YMXH 3T1WA 1FFPB 3I84A 5IMLA 4UQ3B 5BQ7B 4Q0XH 2DLEA 4EN3C 4GBXB 1ZA6B 1PEWA 1T21A 2OQJA 3HG1E 4RNRB 2DMHA 3WKMH 5HBBA 2EVGA 2UZIL 4Z7WE 1ZT4B 2EE9A 1SOXA 2YWYA 4XC3L 2XPYA 4PJCE 3AADB 4PLOB 3WDHA 3QUXD 4RGMB 4YMPA 1DQML 1W0WA 1SXBA 1W72B 3QPQC 4MQSB 5BOZG 3JWOH 4HKXB 5DU7A 1DDTA 5FA3A 2M1KA 4FNPA 2QHRL 4MA7L 2VXQH 5BV7C 1MI5A 5AYTA 4KZCA 1SOKA 1I1FB 4ZPVB 4KROC 2EDNA 4O51A 4FQIH 1I53A 2GTWA 1Q0XH 4BKTC 2V0AA 3BCFA 4YDIL 4CC4C 2W0KA 1IGIL 2A1WH 3T1FA 3ZDXB 1FFOB 4ZMVA 4A7TA 4PQXA 2CK0L 5FHBL 1NH6A 3SBPA 2HRHA 3MRFB 3MLVL 3U7YH 3L4UA 1DQDL 2YKLH 4NQCB 5L6YL 1IFGA 3RPIB 3OBAA 1IEBA 1BD2B 4YHPB 5I6PA 1BBJA 3WEBA 1J8RA 1NCAL 3BWAA 2DI7A 3ULAB 3SJVE 1GKOA 1V3LA 2N56A 2PLTA 3QS3A 4LLUB 4L8CB 1ZA3A 3S88L 1N6VA 4N5ED 2EDWA 1BOGB 1D5IH 3S5YA 4CSTA 2MTAA 2JCCA 4JFDA 1KLUA 1XSIA 5C9KA 4Y2DA 3OMAB 5DS8A 1QG3A 2FECI 4Q2ZB 1QI5A 3IU3A 1B6UA 3DX6B 1X6NA 2X4PA 5DK0A 1UYWH 2NUPA 1HAUA 2J20A 4DERA 2DQGH 1G6RB 4YDVB 3K5RA 3KG5A 4M7LL 4D2NA 5L4JA 3DVGA 1KLGB 1P7KB 1NIDA 4HUMB 3FB5A 2G5RA 1NJ9A 1OTSC 2YMTA 3QQDA 3U4BL 4ADIA 1E9QA 1VEOA 4OSUL 4KVPA 3UBXI 2VDNH 3ZSTA 2FX8L 4U4IA 2JKWA 4JHUA 4JFSA 3W5MA 1WHOA 5I71B 5LN8A 5AB9A 4X6DF 3VCLB 1XX9C 4XWGL 4JPKL 4POUB 2R0ZL 2OCCB 2H1PL 5H35B 5F3BA 4PHZA 3WN6A 1RSYA 5AKVA 1UM4H 4DWHA 5IVNA 4BFJA 1JYNA 2G9HB 2WVVB 5PAZA 1R0AL 5TDNA 5FKPA 2F7PA 2UV3A 3AY2A 1IC7H 2QADD 3X14A 3J2PA 2JK5A 5EU6E 4Y1AD 1MHHB 1FGVL 5IVXF 2RTTA 1G7PB 5GGQH 2HKFL 4H26A 1XAKA 1QACA 1A6UL 3V9FA 1JGLL 5C0CB 1DEEA 2VDLB 4GAJL 1BF5A 3D07A 3GXUB 3DYPA 3V0GA 1G7IA 1T0OA 3LQAL 2JMRA 4OFQA 2VZVA 3F7QA 3DBSA 1U8NB 3BAKA 5KSBF 5LNEA 3ZHLA 2XPGA 1A7QL 2GB2A 4APXB 1I1RA 3GEWB 4HWZA 2AJVL 1DDHA 1J9QA 1WEJH 1ZSDA 1HAWA 3T3PB 5DJ8B 5GZOD 5JOFB 1E2VA 2E75C 2FIKB 1CD0A 2C9UA 3L3KA 3PHQA 3VGDA 1AMYA 2F54D 1UXSB 2YPLE 3I50H 4L5FH 3RB7A 4KJPC 4AIOA 3I6LD 2C4FT 4HP5A 2BX5A 4P2QE 4ZUTB 3UYPB 2IBZX 3IF1A 4TLTA 4JDZA 5CEYB 4I18A 2EIMB 3ZDYE 1RQ5A 3EHBB 4N85A 2ADYA 5IK3A 1I31A 5I26A 3QIBD 2F2HA 2OMTB 4FX5A 4H8WL 5CLTA 2XN9E 2X6UA 3C08L 5FA4B 3QDMB 3VFTA 1BZ7A 1FNEB 3OM3B 3HRZB 1D5XA 2D3VA 5JPMB 5IG7B 5L2KD 2DQMA 2BHZA 1BWMA 4GBXC 3HG1B 4QXTB 1X5XA 3H9HA 4Z7WB 5M94B 2E5EA 3ZHDA 5L2KE 2IAMD 1EEZA 4D9QE 2VDRB 2VLLA 4YFEA 2C9XA 3OKEB 3GI9H 2IALB 4K5PA 3BP7A 4RGMC 2OL3B 4KRLB 1K4DA 3WTTA 1LO0L 3JTSB 5AZ2H 3OTTA 5AG9A 1JHKL 4P46D 3PGDB 3UG3A 1Z5YD 4L48A 4TVPD 2LAAA 2BNUA 3B5HA 2H0JA 2FTAA 1U8IB 1GC1C 2QDVA 3BVXA 3P4MB 4KRPD 5C0RH 1ZDSA 3DETD 3OLGA 4ONGH 4FAAB 3J27A 4LP5A 5GSRA 4KJWD 3UTSE 3QARA 2HPOA 2Z93A 3JYBA 2ORBH 2VR3A 4HWBH 3TIDB 3HBPA 1AOZA 3KLHD 3SJVB 4BCXA 2AXHA 4QJ4B 4JR9L 3BPNB 2I5YL 3HZKA 4EN2A 4HZLA 2JJSA 3S48A 1QRND 4H0IA 4LSTH 1YJDC 3QISA 5I1LB 1X9UA 2DQJH 3D2TA 3FW6A 5LQBL 2MKLC 1U6AL 1ASQA 2GT9B 3A4EA 3MJGX 3SPVB 1ZTXH 1AC0A 4I4WA 3N41B 2YLKA 3X11A 2XJKA 1RUQL 3QXDA 3FAXA 3GIZH 1FNGA 4R4NC 2PPCA 4GEIA 1HH6B 4N2BA 4QRPB 5AVUB 4N2IA 4FULA 2Z0BA 1LEKA 2WXLA 5ISZD 5I71C 4P5TD 3MUJA 2H2SC 3K2KA 3T0ED 3T0WA 1DQQB 3QNXA 4Q97A 2AEOA 1YPZB 3CUPA 4NKOA 1H8SA 3ASWA 4HKJB 3KPSE 4U1IB 4QGTA 1HCYA 3NP3A 4KMQA 2Y7NA 3W9DB 4FFYA 5DF0A 1M7UA 5IFAH 4DGIH 1YEWA 5KAQG 1JYVA 1FZMB 3DX3A 4AUUA 3KH4A 2IC2A 1ZHNA 5EU6B 1BZ8A 4IMKC 5ACZA 1MG3C 4RISH 2YMOA 4N8VA 2YD9A 3ATFA 3G5WA 1ODAA 3MGOB 4P4KD 4OGYL 1J1OL 3G5ZB 1F41A 1T4KA 4JB9L 3TOPA 3IGUA 2Z0UA 3FT1A 3KDMB 4ODXB 3VXOB 4TULH 3DHPA 2B39A 2WLYA 5IR1A 1E4WL 4P0DA 2OP4H 2Q7YB 3RP1A 5DLMH 2GIYA 1AH1A 5KVFE 2BY1A 3MV9A 3JWDC 5FHAL 1CO1A 3QS2A 2PUQT 2QR0B 3GLDA 2IXQB 1UENA 2WWOA 3LTVA 4B7IA 1PSKH 1KFAH 3D39B 1NPNA 3PUCA 1UQSB 2AJUH 4NM4L 3UAJA 1SHSA 3ET9F 4DKAA 2J55A 1JF1A 4H7VA 2XA3A 2CA3A 4MZ2A 2X1OA 1E28B 4UT9H 4U1HB 4QEGA 1CDHA 3K6FA 2YPLB 4GAAA 4N2NA 4P2QB 3R06B 2WINA 1JXDA 2WAHA 1HHHA 1W6WA 3OMZA 3WD5L 2BNQB 1KY7A 2J25A 4WFHD 3ZL4H 1MIEH 5I8EA 3LMJH 1WD8A 3EHBC 1SMOA 4LSVL 4LCWA 3TLRA 4N6QA 2XN9B 4DK5A 3BQVA 2AVFA 5B7MA 2Z92B 4I9XA 2L4OA 4URKA 2B4CL 2WUBH 3HRZC 5FO9A 1BFVL 1OHQA 3SY0B 1PNDA 5KVDH 3MRGA 1KTKE 2XQBH 3V4VB 5JPMC 5DMKB 5E8PB 5KBNC 1RCYA 2RA1A 3NAAL 4LQ1A 4KXZH 4AV4A 3Q0HA 1QR1B 3QQ4B 2AJ3A 2VMFA 3REVB 2OXHB 5J3HC 3Q2CA 2Y2WA 1A3LH 5HGBB 2ZTBA 2E8YA 5ICYA 2X12A 5E0FA 2NUTA 2OBGA 1DFXA 3EO9H 3DPDA 2P8PB 3O45B 5BJTB 4J3UA 1PIGA 4Y19D 2FB4H 2CDEB 5KVGE 5IHWA 2X4UA 3S4SB 1Z3RA 3TA3B 4JEGB 2WIIB 1KCRH 3Q6GL 4NAJA 3J8F7 4R6UA 2BWDA 2C9PA 3FO9A 3VD7A 1A3QA 4Y16D 1CFVL 1FF5A 1JI2A 1MSPA 3REWB 2C3HA 5ID0A 3TVMB 1MWOA 4O2CA 2GIXA 3NA9L 3UTSB 4KKAC 5E95B 4PBVC 5IUCA 2H0EA 4M6MH 4XVUD 4G9DA 2YAHA 1Z6JT 3C6EA 3ARRA 3L45A 4ZO8A 2NSQA 3AACA 4ONHA 3FHAA 2NT1A 2GABA 1F1DA 1WDAA 4PP1D 5F7AA 5A2BA 1C5BL 5EA0H 3BPNC 4F8OA 2MCPH 3RWGB 3V4PL 1ZT1A 1KXTB 2NPLX 4QO1B 4U49A 2VN7A 4XVTH 1Q9KA 1EEUA 4S1DC 4JHBA 2Y6TE 1ZVSB 4LCYA 1CD9B 1VPOL 2OSLA 1HZHH 4G9FE 2FBJH 3L1OL 3ARYA 3SE3A 1F13A 2JB5H 4ZSOA 1IX2A 1RXLA 4JZJA 2HLFD 1G9HA 3P11H 1DQJB 1NLBH 4KK9C 1T7YA 3HUJE 3P9WB 3QDGD 3VFOA 3IAGC 4ODBD 3FT0A 4BUGA 3P0GB 5D1ZI 1IE4A 5FYKE 4RBPK 2FWLB 1ZHLA 2P1YA 1UB5B 3QUZC 2EYSB 5SWSA 4B27A 2VDOH 4OZGA 3FUEA 3RURA 3RWEA 5FC9A 4WU5B 5SX5H 1JYWA 3FULA 4N0YH 2R39A 3BLKA 4G80A 4F93B 1XCTB 1JVKA 2EACA 2ZWYA 1ZIBA 4FE9A 5D71H 1C08A 4KZDL 4KVNL 3SOBH 3WJJA 2X28A 5F7WC 2XT1B 3PP3H 1K9TA 2ZD0A 3RGBA 4DNLA 4DT2A 4U2ZA 4AUJA 1HQ4B 4NJAL 2Z8VC 3BPCA 5DFVD 2YFNA 1GJWA 2EO1A 4ZJ9A 1LK3L 3U6XS 2UYLA 4JRXD 2FVNA 3B9KA 1R3KA 2ZCHH 1BQRA 3A24A 3WIAA 4F57L 3SYOA 3CE1A 1MLBB 4NT6A 3BSGA 3IPFA 3ASNB 4NHCH 4GRLA 3CDGA 3HAEH 2DH3A 3OKDB 1E3XA 3GTVA 2IFFL 3GRWH 2WWNA 1MAML 1TZAA 4PU2A 1UM6H 4W9GC 4ZMXA 1MWAH 3RHWF 1FNFA 2X6AA 3BRGC 4ISVB 1MCEA 1AQKH 2N7AA 5CP3A 5FOBA 4EOWH 5IMKA 1YEKH 2CO7B 5CEZD 3MV11 4QKXB 2YQBA 1L9MA 3ZSSA 1E2WA 2F7OA 1UH3A 1ZLVK 5AG8A 2ZOWA 2WHVA 1KBWA 3CXDH 4DN3H 5C07E 3QG6B 4PJ9D 1BVLB 1HNGA 2WY3B 4PJEA 4QXUH 3PIQB 3W56A 1A9BA 3QXVA 2YMXL 2F8IA 5CGMA 2DDQH 3UACA 1KB9K 5F3HA 1FCCA 1WVZA 2HCZX 5C09B 2ADIB 1P7HL 2ZKWA 1NICA 2VMDA 4PSPA 4N22A 2M2DA 4UT7L 5DC2A 3DJ9A 4MJJA 3U0WH 1BAWA 5HYJD 4Z76A 4X5WB 1HHIB 1N19A 1BXVA 3UTZB 3BKCL 4GFTB 1NCIA 4R26L 3ME0A 2VLJD 4X9IA 3VQ2C 4HUXA 5HHPA 3GK8H 2OMNA 1I8MA 2PWHA 1KEGH 4J27A 1KPRB 3UH8A 3BN9D 3KXFD 2DLTA 3TA3C 5EN3A 1JGDA 4CC0A 5DZAA 4WU7B 3HG5A 3LZOA 3FTZA 2WLHA 1Q0XL 2C1OB 5LXGH 4ZZFA 4QCIA 5AVTB 3TVMC 2A1WL 3CJJA 1VADA 2H1XA 2BSRB 1L9NA 3AT0A 3R1GL 4CILA 4RMTA 1P1VA 3K2UH 4Y0GA 3RTQD 3TT1H 2UWEE 4Q4IA 3JTBA 3PV6B 4JDEA 4PN6A 3LRLA 3H9SE 1CT8A 4EXPX 1W8OA 1NSNL 1XIWD 3DI3B 3PWNB 2QFRA 3GSXB 2F5BH 3T8VA 1L0YA 2YQ3A 4WFED 3L16A 4LVEA 2FGWL 1UC6A 1UKSA 1XWVA 4M8RA 3MROA 3MRQB 2J56A 3NZHH 3HUJB 2HFEA 1XCQB 4J3OF 3R8QA 1EV2E 3SKNB 5AW1B 4KKPA 1H6TA 1KJMB 4RX4D 1KGJA 3QR2A 2ZE0A 3ASOB 3PAUA 4P2AA 5GXBB 4PJDE 1NFDF 1MZYA 4P3WA 3ZE1B 4A2EA 4ZNEE 1CF8L 4LP8A 2VAJA 2A6DA 4MVBC 3EO0A 5KBPA 15C8H 4MA8H 1BVOA 1GS6X 3DO7A 3RNQB 5IFHH 1PKOA 3ARGB 4NZRH 3BP4B 1U8QB 3RDTB 2Z91B 3O6FB 3VRIB 4AGMA 3KPLB 1AGCB 2WXJA 4V2BA 3KBHE 2VL5A 1IC7L 1RY7B 8FABB 4I3SH 1R3HB 3P77A 2BRQA 3X3FH 1RJYB 2D03L 3MRHA 1TU2B 1MCOL 2QEJA 5HI5D 2Q87A 1WZMA 1S9VB 2OZNA 4LGRB 3TPKA 4CSPA 2J12B 2FHBA 1NC2D 1O7VA 2PMZA 1WBYB 5CZKA 4DIXA 3HPJB 1A6TB 5AOKA 5IEHA 3CHXA 3RBSA 5A16B 4W9FC 4DKDC 1JAEA 2QQKH 3D3VD 4YGAB 5KANI 2V2TB 3P02A 5K59E 3IEAA 2X0WA 3TBTA 4CVZA 4WDIB 3RL1B 3LEYH 2HRPH 2OTPA 1F4XH 4XNDA 2M83A 4NFDA 4YDMA 4JM2D 2HVJB 2YAOA 1WEJL 1DJXA 1CS6A 1Q94A 2H32B 2HT3D 3KAAA 3ZTJG 3LZNA 4L5FL 2XVGA 2WZPD 5CCGE 4YHMH 5BS0B 1TEYA 3EBGA 3MDJA 5IB5B 5IB2B 3AU0A 1JZIA 4RRPG 2R1YA 4TTDC 5JXEC 1L9RA 4G8GE 2WLMA 1IBGH 1ND0B 3K0YA 4NGHL 5C07B 4IRZL 1P7BA 3OL2A 3BXNB 4XPHL 5BZZA 4IRJA 1ILUA 3HS0B 1T2QL 1MLCB 3F7RA 1RD6A 4XCEB 1EWHA 1YDPA 2GCYA 5F7EH 1E5CA 3TO4D 3JTTA 5B1AB 1WFUA 2HT4C 3QI9A 2QKIB 1KN2L 3GI9L 3LH2H 1QHPA 5TD4A 4N25A 3LB6D 4B96A 4NZDA 2VLMD 5EU4A 5F71A 2D0HA 1F58L 4IJ3B 3DTXA 4OFKA 2DEWX 3KPOA 2OI9B 5AZ2L 1Y7VA 5BZXA 1JPTH 2UZYA 1AANA 4U6XA 4LLDB 4DPCX 2EIKB 1KBGH 4LIQE 5ALCL 3B5GA 4PVBA 1QLFA 1AGBB 5E99H 1R24A 1IEAA 2CO3A 1J9RA 4KK6D 4OM0L 1DJHA 3A4FA 4X7CC 2B20A 4DETA 4E41D 4FLQA 4KUZL 4LDCA 2V5SA 2CIIB 4RA3A 4HSAC 3FSVA 3BZ4A 4GAFB 2V7HB 2FSDA 2ORBL 4HWBL 4G8AC 4J4PD 4KU1A 4Y4HA 1NUFA 3QJQB 1T1WB 2A2QT 2B0SL 3MPCA 4ANWA 1UA3A 4JKNA 2PPFA 2NSXA 1OE1A 2NYKA 3H9SB 4NNXB 3LH8A 5ABAA 3DYOA 4GG8B 4K3GA 2F8VA 1CDBA 3VXTB 4LSTL 1Z5LB 2A0LC 3G6JE 3T0DA 1FH5H 5ACLA 2AXJA 2DQJL 4WY7H 4HJGB 5T5FA 5BVJA 1IC4H 2XN2A 4NC2B 1VFOA 4P8QA 2PWDA 1ZTXL 4OZ4B 3WJMA 4K23H 1SN5A 1MW2A 1XXFC 2I9LA 1HINH 1XCWA 1NAMA 1OZUA 3WTVA 3GIZL 3CFIC 1LO2H 1OAXH 4Q6YA 1IM9B 1RUML 5GZNA 3VNYA 3L5WB 1PMYA 3B1TA 1INDH 4CAGA 5E6ZA 4PREA 4R8WH 4FNQA 1N7ML 5DRZA 3RA7L 2ZWLT 2K3HA 2MPAH 2EXYC 3ARGC 4NZ8A 1VZHA 1FQ9C 1P84J 2FEEL 5DD3H 1T89C 3RDTC 2EYTA 3O6FC 3VQMA 4L29A 3MR9A 5CO1A 3A6CH 1RZGB 4H8QA 1D5BA 1PEZA 2H6PB 3CH1A 2NY0D 1CL7H 5IFAL 1OF2B 2X1PA 3RI5F 1H5BB 4DGIL 3RIFK 3QWOB 5D1XB 2XACC 3W9EB 2EABA 3KBFA 2DIAA 3K71B 3KVDD 4RISL 4ZT1A 2ED9A 3JT0A 4W9CC 1ETZA 2ESVB 1KT2B 2OCFD 4BFNA 4F2ME 4MMXA 4OJFH 5FKAB 3WIIH 4NCC2 4TULL 2JFCA 4TVPH 5AALA 1FIGH 4AYMC 4B60A 1JIBA 5DLML 4U1NB 5T3XD 1GZQA 1KJ2B 3LPPA 1QFWM 4PJBF 4R97B 1ML0A 1IBHA 1YECH 4A55A 3ARXA 1PSKL 1KFAL 2LVEA 2AJUL 1WFIA 1KNOA 5AQ0A 4IM8A 2P47B 1UA6H 3TPUB 2HX7A 5E2WL 4NX0A 4UT9L 4WJ5B 4LSPH 4JQIH 2AI0L 2PCFA 2DWDA 1JXGA 4JHVA 4LGPB 2V3DA 3AWEA 1XB6A 5E8NB 4FFZA 32C2A 4NRYA 4JVUA 2W9LA 4HG4K 1XD1A 1IARB 1MIEL 4LLAA 2I60H 1SJMA 5FGBC 1KIPB 1UKTA 5KJRH 3EOAB 3UIZA 1FBIH 4PJHB 1E3FA 2DWEA 4K7FA 2IG2H 1MCLA 2R2CA 1HI6B 2KLTA 4ANVA 3HS0C 1S9YB 2KC0A 3LS4H 1E8WA 1X5MA 2C4FU 4RWHA 5KVDL 2XQBL 5J89A 3TNNB 2PABA 2QLYA 3OR6A 5E6IC 4CC1A 2GQHA 2EIDA 2QKIC 2ZWKA 1SLWA 1A3LL 5JW4N 4HKBA 1S7VA 4ZMOA 4C4UA 5H4YA 3CFEB 4BEIA 5JZ7C 4KXBA 5DEFB 3EO9L 1E43A 4IJ3C 5GGSA 4J6IA 2AC0A 2OI9C 2ITCB 2FB4L 2C1PB 1QOKA 3W0WA 1ADWA 2JKSA 4MXWH 3L95A 1KCRL 4B97A 3P9LA 3ARFB 2V5MA 2HKHH 1XR9B 4DGVH 1WAAA 2V2WA 1MQKL 4JANB 2NCEA 3EFOA 1M6OB 2XWTB 3P4NA 4FFVD 5HP5A 4R96B 2X9ZA 1UWXH 4ZI8A 4YXLH 3S34H 4M6ML 2Z34A 4TSBH 3PU7A 4ZQKB 4YAQA 1GYCA 5CWSA 1KLFA 4ZNCD 5B38G 2CE6A 1OY3B 4ZDHA 2A7BA 2X4RB 4F7MB 5FYJD 1S5HA 4YDJB 5DJYB 2ZYHA 4Y2LA 4RFEA 5DA0B 1TQUA 2IPUK 3N06B 4AKPA 4TLSA 1FN4A 3CVHA 4DGYL 4U05A 2V17H 4XVTL 1B0IA 3G6JB 1BSIA 4B5ZA 3CCHB 4OQTH 1HZHL 5DMGD 4G8EA 1IAII 2FBJL 3OF6A 1RIVH 2JB5L 5GRJH 2YEZB 3HPLA 2YSTA 3C5XA 1N2RA 2DM3A 2GJ6D 3BX7C 4ODHH 4UTAH 4G1MB 2DAVA 1N59B 1CCZA 5H37H 2WTRB 3QYCA 4RDQF 1JYXA 2HXAA 1H9VA 5HXMA 1U8OA 1KGWA 4PRDA 1JPGA 1N70A 3UXFA 4OCSL 4K8RH 1AP2A 3RFRA 3MV8B 3B5TA 3ROLA 2BCKB 3EGSB 4OLUH 3W82A 4KK5C 4BFRA 3UGUA 1FVCA 2BOCA 1Z9SB 2ZG3A 2X6CA 5B38B 1FAKT 3CZUB 3I9AA 1U8KB 4ELKA 5D71L 1OAYH 2A83B 3CSYB 4X98B 3UJTH 5CM1A 1ORSB 5DRWB 4PRAA 1F6LL 2H0PA 3PS6A 3SDDD 3VFSA 4ZODA 1H5BC 4PHXA 3Q5OA 5L4IA 4PRIE 5D1XC 3QR0A 3UYRL 3QPKA 3S0PA 3LHAA 1BQSA 4GKZB 5CKGA 3LEXB 3RVWD 5ADPL 1XSJA 2HTKC 3QEHB 3WY3A 4F2MB 2WN3A 3V8CA 3BT2H 3OMNB 2V5TA 4PEEA 5FYJU 1IGYA 4P23A 2WXQA 3S35X 1L5GB 3I3DA 5LLIC 2I69A 1CU4H 2VXUH 2LW3A 4FS0A 2Y1YA 2I07B 4FFWC 4X0KA 3WIHA 5I5RA 4O2FA 2HWZH 3GRWL 4R97C 3WBDA 1MXDA 1I1AB 4RMVA 4WTZA 1MELA 4RZCB 1MWAL 3CVDA 4PWEA 4OF0A 2XKUA 5KOMC 3VXRD 4CADA 1EFXB 4WQOA 4F9LC 1P7QB 3ZYOA 1AQKL 4FQXD 1HX0A 1WWWX 1YEKL 5I6OA 1MRDH 2C9AA 3V5HB 5DWUL 4HHAA 5B39A 3KS0H 4YE4H 4UYPA 1I8AA 1V27A 2BNRE 1UD3A 3IXTA 3CXDL 3TV3H 2ZPKH 5CGBA 1P6WA 3GLZA 3IJYB 3RGHA 3B43A 3AAZA 4QXUL 4LVNB 5DVNA 3S3SA 2KPNA 1H3PL 1RURH 1EQWA 3MJ9L 4G42A 4L9LA 4V2CB 2DDQL 1ITBB 3GEFA 1PCSA 3O81A 4OLVH 6FABL 1GS7A 2E9GA 4QYOA 4E9XA 3TF4A 4I85A 2VSMB 3BJ91 2P5PA 3FN3A 3OKNB 5EOCJ 3C5JA 5F7BA 4YEFA 4Z8FH 4H2AA 5DEGB 1NDGA 5A2FA 1XF2B 2E7CA 2K7PA 3AUVA 3LNDA 5DYOB 3KNBB 4HCFA 3GK8L 4F7TB 1CLZH 2DM2A 5GSVB 3QIWB 4WCYL 3PWLB 3VQ1C 2DQCL 3ARFC 4QTFA 2E27L 2ATPA 2E7LC 2YXFA 3MA9H 3QZMA 2VERA 3WY4A 1JCKA 4QHNB 2NYYC 1YEDB 4M29A 1U3YA 3PABA 5IREA 3K2UL 2X2YA 2Y6SD 1HWHB 5CCKH 5IFJB 4L3CB 2D73A 4PB0L 2ATKA 1SDYA 1VERA 3MGTA 5I76A 3GBNH 3QUMH 1I3UA 3K6IA 4HCRA 1J8HE 3BAXA 1HU8A 1PZ3A 5FECB 3FDWA 4LEXH 4WKXA 4CDHA 3MOQA 1YUHB 1I7ZA 3GXTA 4R7DB 2CLRA 1A6VH 2F5BL 2PXYA 3MODH 4Z7AA 3L2NA 1CVSC 4HF5H 1C16A 4FDWA 3V55A 2G2RB 4QOKD 1QBBA 1NKGA 3L6FB 1PZBA 3F6JA 3P4OB 3D51A 1YMHA 3NCWA 4PG2C 4ZW8A 5TE6H 1JXJA 2Q8BH 5AAMC 3IN0A 1PW3A 4L4TA 2F53D 2O6CA 3FN0H 3HMXL 2YPKB 1ONQA 1QLRB 5CEZH 2PP7A 5BRZE 4A2LA 5FLVA 4PBWD 1FO0B 2XFXA 3OSVA 3AT8A 2L8AA 3QXAA 5SX4H 1DUZA 4MB1A 1HH9B 4P2RE 3CZLA 3F7VA 3EFFA 4FOMA 1HHKB 2Z35B 3HI1A 4ZAKA 5IFHL 4NZRL 4N86A 3MREA 1IC5L 1U8PA 5FX3A 3O2DH 1HCZA 4XCYB 3VXQB 2G5BB 2AFNA 3SDCA 1J0KA 5I1GH 1S7QB 2F08A 3QPQD 1H15B 4NQVA 2JI2A 3T2PA 3APFA 3SE9H 3UZVB 3PLYA 4BH7A 4C54A 4HEME 4OZIE 2D31A 3TU6A 1JZ6A 5E7BA 4TLKA 2WYIA 4AGLA 4Y5YA 3X3FL 4KROD 3MV7E 3BZFA 4B9ZA 3GT6A 3OQRA 2VKXA 1A4KB 1FL5A 1DBML 2QBWA 3AVEA 2CZNA 2DBJA 3FUIA 1KYUA 1RZIA 4P5MB 1F8TH 3N5AA 2QQKL 2XG5B 3MZGB 4YSAA 3U36B 3BO8A 3DBXB 4OZHB 2BP8B 1T5XB 2ITDB 2DQIH 4K9EH 3BKYL 1F4XL 2R9HD 2AEPH 2P4AB 1LEIB 3HJ0A 5GIRA 3N9GH 3NRFA 4HUVA 1Q9LB 4XN9A 3U0PB 2GSMB 1D6VH 3RB5A 4GAYA 4OCYH 1QW8A 3MLRL 5DQJB 5SWZE 1IQDA 3GGWA 4Z3HA 4YHML 4XMTA 4JM4H 1JDCA 4XMKL 2G3NA 2CJ3A 1OV8A 5FGRA 3R19A 3STBA 1IBGL 1OTSD 2R1XB 4HD9A 1QRKA 5IESH 5LAXA 1ZWIB 3HC0B 4NRXB 3LJ3A 1XF3B 3BAWA 3T6XA 4LVNC 2FEDC 1QR4A 3JSSA 4I5BB 2E4TA 5FM8A 7CGTA 2R15A 1QSEA 2IWFA 1B90A 2B3IA 4FCHA 5F7EL 2IO5A 5GGVH 1HWWA 1CLYH 2JJTA 3LQAC 3CX2A 3NJKA 4MCYB 4LHUA 1WBZB 3MNZB 4HOWA 3D0VA 3VRLE 1U58B 4OJCA 4LLQA 1OHZA 4KKBC 4LF3A 1OAUH 3ALPA 3LIZA 1SY6A 1ASOA 1M05A 5ADOL 2P5ED 3Q5TA 2OR7A 4Z7VE 4NKQB 1CFQB 4BWTA 3KLQA 4IS6B 3CIAA 5F1NA 1KWKA 1AS6A 3EDFA 1KBGL 4PJ5E 4U1KB 1EBPA 1FFNB 2YLHA 3QIWC 4TLUA 4X9HA 1K3ZA 1P1ZA 5E99L 2I32A 5A6LA 4MS8C 1T5WB 1SEBA 3TJHC 1U92A 2VLRD 3FB8A 2XX1A 3UBHA 4DUWA 5JHDD 5D5MA 4H8WC 5F7HA 1IL1B 1GOHA 3LZQA 5DHYA 2YAQA 3UZQA 3BAYA 3QO0B 4HK0B 3ZTEA 1EEYB 1TUPA 1BAGA 1KTRL 3LZFH 1XZ0B 4JPQA 4XN8A 3D0AA 5B1JA 3SOTA 2Y7LA 1J8HB 1T0PB 2CLZB 3QSKB 4X6CE 5DHEA 1GGTA 4U6HA 1RUKH 4ZMPA 4PJIB 5GRYA 1EUTA 4M4RA 5C0IB 5LG1A 2WZ5A 2PW2A 4IIQB 3MU3A 4KJPD 1VACB 1QKZH 5IW6A 2E86A 5C0AD 4PB9H 2CLVA 5LUMA 1F86A 4WY7L 3G5YB 5JNYA 2B1AL 2VSCA 4LRNL 4Y4FB 1IC4L 2CM5A 1OARH 2E6PA 4M8QB 2F9BT 2EH7L 5IMOA 3VA2C 2X1QA 4JS7A 3INUH 4KNQA 1LO2L 1OAXL 4MJ5A 3GI8H 2J6EL 2GEEA 1V3MA 4B9FA 3X12B 5CD5C 1DBJL 1KPUA 1NWPA 3VI4E 4P2RB 4R8WL 2HB0A 3KLSA 4QAWA 2B9BA 2Y4SA 4HJJH 3KYMB 4G8IA 3QHFL 5DD3L 1CIDA 4L8DB 3HA0A 1AMXA 2Z31B 3PGCB 5F1KC 3OKKA 5JLZB 3DV4B 4HFWA 1WAPA 4FI6A 4U1SA 4EIBA 1CL7L 1DVFA 1A6ZA 2DKUA 4OZIB 1J9TA 3V4PB 1J48A 1A0QH 5DD5L 3P0YH 4LEEA 5AB0A 4MMYA 1B4TA 5EDSA 3MV7B 1A4AA 3KPRA 4WNQB 3AXLA 1A6PA 4N5UA 4KDWA 2AK4A 1FVEA 4OFYA 1NEZA 3EGDA 3LSOA 3E80A 3EIFA 4OJFL 3WIIL 1VSCA 5I6MA 1AXSA 4MCNA 4TVPL 1UZ6F 2DWYA 2J8UE 4JHAL 2N01B 4BKLB 2MMXA 3KL3A 4XI5C 3VGHA 2UVEA 3FK3A 4LFHD 4PS4L 1T0NB 2WIMA 3CK0H 1KB3A 4LLVA 1R6VA 2JTDA 2FHCA 1WH0A 3VH8G 2DOCA 3T8XB 1UA6L 1V55B 5IJVB 1F4WH 4LSPL 1ETA1 2P5WA 4JQIL 2EYRA 3FQXB 4MD0A 3MFFB 3BIAX 3DXAA 3ULUD 4OGXH 2R2BB 5ESAA 4Y8AA 1CGXA 5K9KA 4UV4H 1EJ6A 3LRMA 2K4AA 3Q1EA 5KJRL 4R4ND 2V2XB 5GRVK 1DBKH 1OP9A 2H4EA 3QFJE 5TE4H 5I15L 4X4MA 3IFLH 1Z3GH 2HVKB 2E46A 3ILDA 4GSQA 4HIIA 4I9WE 3UC0H 3VI3E 1CIUA 2NNAB 2QSVA 5E1AB 5DO2C 2OMZB 2EVIA 4D8PB 4NNPH 3HZYA 4ZFFB 2XV0A 2GIMA 5LAPA 3QG7H 2R4SH 2DBLL 3DO3A 5DUMH 3C60B 5ACMA 4JGMA 3VH8B 1BX2B 3LKQB 3QZWB 5DJZA 1EJFA 4H1LH 4Z7VB 3P30H 2W07B 3QDJD 4XNYH 3G3LA 3MRLA 2EINB 3VD4A 1M7IB 2ZXQA 3OC5A 3FO2B 2CMRL 4R2GB 2LTQC 4MXWL 3OAUL 4L5FE 4PJ5B 3ZGHA 2IDTA 2UUDH 1RZJL 4NUJA 3WTYA 3HCVB 3V0VB 5C0CD 2NTSP 4L3EE 1GGIH 2BSEA 4E9QA 4UM9B 1WGOA 2NW2A 3CWGA 4JDTH 4J3BA 5HHME 1BREA 1KCSL 4MRBA 1OCZB 1Z5HA 2Y5TB 4O00A 1DLFL 4UOZA 3S34L 2EDBA 3HI5H 3I6GA 2ZXEB 4LLYB 4Z0XA 1CURA 3VSVA 4UM8A 3GNMH 1G9MC 3IDIB 3VACA 2B4CC 4BZ2A 3QEQE 2EKJA 3X2QB 3GMPA 4X6CB 4X83A 1KACB 2NY4B 3FMGH 1S7RB 4JY5H 2ZXBA 4HLEA 1K85A 4Z9KB 1N6UA 3EGXB 4IIQC 2FJHB 4MWFB 4QTIL 2VB5A 2B08A 1WICA 4J7RA 4GXUM 4AM0B 1KGXA 2J1YA 1AKJB 3KYOA 2CKBL 3OGOE 2BIIA 2HH0H 1RIVL 2WTPA 4Y4FC 5GRJL 2YEQA 3E6FB 5JO5B 2V7NA 4UTAL 5KSBB 1UOKA 1YNLH 1BQKA 4XPAH 1XQ4A 3SB3A 1B0RB 4DQAA 1SF3A 2OTUB 1KIUB 2H9GA 1TZGL 2X4SA 5CLYA 1Z2KA 3FZUC 2X2UA 4JHZA 2J7LA 2ZIDA 3CDFA 1I4FB 5CP7B 5ABZA 3DOSA 5EEUA 4PJAE 3VI4B 3GXNA 1IUZA 4OLUL 1TCRA 1S8DB 4HH9A 4Y9GA 4DJMA 4EBQL 2FR4B 1TYRA 4JFPB 3QH3B 3QWRD 4KV5F 1OAYL 2Z31C 3UJTL 1TZHA 4YQXH 1ZLDA 4D3CH 1WFTA 4OH2A 4TSAL 4C56A 2ADFL 5D7EA 5HYQA 1LLAA 5MI0B 1UZ8A 5F9JB 1ACCA 3WN5B 2TSBA 4TTGA 2Y7QB 5J6SA 3PL6A 1XGUB 2ZWZA 4FXGB 4I0PA 2QL1A 4BGLA 4FQJH 4M43H 5I30H 4MQTB 3BDYL 4FQ1H 3IBEA 4HU2A 4MNGB 3O3AB 1ZTXE 4FG6D 5T5NG 1JMXA 1YG9A 1QNIA 3TFKD 1T2XA 4JZOB 4BZ1A 4M48H 3S6CA 2EH8L 2J8UB 5C3TA 4HG4J 3ESUF 2VDNB 2VXUL 5HYSG 1S9WA 1NKOA 1WFMA 3SJVD 4XH2B 2XRAH 1EPFA 2HWZL 3OAZH 5D7SH 1SF5A 5IVZB 4WW1B 1VCAA 3B9VA 1F4HA 4H20H 2B1OA 3NABL 3X1EA 1GGCH 5LBSH 3K74B 5D2NA 5BZWA 1G5GA 2NR6C 2XTSA 4GB9A 5D9SA 2NY5H 2GEQA 1AYRA 3RVXC 3S35H 1WBXB 4YE4L 4KK9D 4HV8B 1WA0X 5FYJH 3KLAB 5DS2A 1FZOB 2EE3A 1CGSH 3LXAA 1M7DB 2ZPKL 4AYSA 4HPOH 3FFCB 1QSFB 3FRPG 3KGSA 3QUZD 4KHTH 3AQXA 4OJYA 3VTTA 3N6YA 4QRPD 3QFJB 2AQ1A 1KTJA 4TF4A 1FGNH 3G6DH 3VI3B 2IBZY 4YUEL 3MRPA 1J05A 1Y6NR 2E76C 1U3HA 5HDBE 1LJMA 3TYFA 4TKWA 4C58B 2AQQA 5CCJA 2DWTA 2R29A 3L4CA 4ALAH 1OGTA 3C60C 4HULB 5TDOA 4MB4A 1MFCL 2NXYD 4AH2A 4ABUA 3ZR5A 3IAQA 3MRNA 3K6SA 3N1QC 4H2CA 2OX5B 4KTEL 5GGUA 1FL3A 3MYZA 5IROC 1JN6B 1CLZL 2LV4A 4R2GC 1N8OE 4NNYB 1KF9B 5SX5K 3GHBH 2P80A 1JPFA 5D1QE 4HJEA 3NJLA 4XHJD 3WGUB 5A6IA 4A7SA 2ZKMX 2YUXA 3FRPB 4K7PX 5DEZA 3F62A 4U33A 1MNUH 2WQSA 1S9XA 3IMRA 5IY5B 4E9RA 3PP3K 5CCKL 1QA9B 5DGRA 2FRGP 3IXAA 4CUCA 3S2CA 3D39D 2IQAA 4AY0A 5KVDE 3O4LA 3QUML 3QEQB 2AQTA 3ZZ1A 1NQBA 4LEXL 2NY4C 3JXAA 5MEPA 4UOQA 3VFPA 4HF5L 4E5XB 3MYJA 2OK0H 2X4OB 1FVDB 1ZJAA 4NCDA 1BJ1J 3F65A 2BNQD 4N3UA 2PKDA 3EF4A 5C6WH 3E3QE 2Z65C 1JV2A 5E00B 5TE6L 2Q8BL 4TRPL 3OX8A 4GRWE 2R8SH 3MN8A 3FN0L 5D7JB 3IFPB 2D2OA 1MW0A 4WIQA 5CEZL 3X17A 4B9IA 4MCZB 4LKCA 3FT2B 4M7LT 3W3BA 4YR6A 1RPKA 3V6OE 5C9JA 1NUDA 3HIZA 4NQQA 1CPUA 4ANUA 1MDAA 1XL6A 3DC0A 2LR4A 4PV9A 3O2DL 3SO3B 1WE5A 1NCBL 2X88A 3IFOA 3UROR 3JZYA 1R3JA 3C87A 1MHEA 5D2LB 1JK9B 3SE9L 5HPMA 4PRPA 4HDIA 1RZKH 2B14A 2UXGA 2V9TA 2HP4A 5MI0C 5I1KH 3RL2B 3WN5C 3WE6B 4KQ3H 3BQUA 4WV1A 1XGQB 4KMTH 3RIAK 4GG6E 1BQHB 4QHKI 1CICD 5E9DE 4FXGC 4DP4X 4LBEB 5DD0L 4Z78A 2YARA 2KBGA 5HDRA 4X6EA 2CRYA 5A2CA 5DHDA 4L3FA 3O0RH 3WY2A 2VJ0A 3X13B 1BVNT 1RULL 5E6RB 1TTUA 1F8TL 4U6YA 4I1PA 2YD6A 4PIBA 1DBAH 2PTVA 3GKWH 3KWTA 1E5AA 4M1DH 4TQEH 3HN5A 1NCTA 1UWEH 5F44A 2HFFB 1AGFB 4OIIH 1NBVH 3FTGB 4CVWA 2PO6D 1I7RB 2ED6A 4MQXC 4K9EL 4NXSA 2AEPL 5DVKA 1KCWA 1JWMB 1O6SA 2JXMA 2VDPH 3E6HB 3OPUA 4IK6A 4JY6B 1YRKA 3PWJA 1EMTH 2IMMA 1CBVH 1FNHA 1LXMA 1QX1A 2ENPA 4OCYL 4XXWC 1CF1A 2EAEA 4HHGA 1CYWA 1EEQA 4FHKA 3HNVH 1QLEL 4JM4L 3LNHA 1WT5C 3EH2A 4J8QA 3ABMB 4S11A 5H94B 3OLIA 5BPPA 1OTTC 4PRHE 2H8PA 4NO0B 4PWIA 3B2VH 5IESL 4JMNA 1N0LB 3CFTA 4DP8X 4LAQH 5CBAB 1OOAA 5G5DB 4HUCA 4ZX3A 4MVBD 4ZUWA 1MDTA 3HR5A 3LN5A 1ZT7B 4MNQA 2OR8A 5EBWB 3WMPA 43C9B 4R0LB 3VTMA 5GGVL 2EUVA 4AYFB 3WS6C 2OKMA 3I2CH 1QBMH 1QQDA 3GPEA 5HDBB 1KDIA 1CGWA 4JRLA 3CD4A 1FLRL 4Y7MA 1C12A 3RGVD 4XO9A 4WO4B 3MJ7B 3QZLA 1CN4A 4X4KA 2BO0A 1FJ1A 3NCYS 1Z32X 2FH6A 3DRTA 3EYUH 5L4FA 5DT1L 5E6YA 3IDGA 4CN1A 3ARBA 1A21A 4IKIA 2EIJB 4JPVH 2FEJA 3BVDB 3CG8A 4MKMA 5DMYA 3FTUA 1DFBH 4H8VA 1UOVA 1YNTA 4N2AA 5E08H 3MRKB 4AMKH 5DQDH 4OF7A 2Y1ZA 1PKQA 1T66D 2ARJA 3NRPA 5ICZB 4QLRA 1EGJA 1KBKA 5D1QB 4L23A 3D33A 5IV2B 1FP5A 1IFHL 4JFUA 4AOFA 5EOTB 4GMSH 5CP3H 2PYEE 3WG7B 4OCLC 1JZEA 3NTCL 5C0BA 1O7DC 4WO0A 1TKWB 3M45A 3TWCH 4KTYA 3RNKA 1DANT 2DZEA 5DJCA 3LZFL 2QVKA 3LOWA 4XMXA 1RJZB 1S7UB 4LK4A 3NFPA 4UU9A 3RKDC 5CIPA 2A9MH 4QRUB 1RUKL 4EN3A 5MERB 3CXHK 4XN7A 2WKLA 4NPYB 4IRSD 2V33A 3QJRB 4FQQB 4MJID 1QKZL 3ZTNL 5FV1L 1OB1A 1QSZA 4LLWA 4TTDD 5FB8A 5JXED 5GRUH 1M6UA 3DK0A 3UAFA 5FCUH 1AD0A 3T5WA 2EDQA 3WFBH 5IM7B 1OARL 2ED7A 3E8UH 4ABQA 3ECQA 5CLXA 4WTWA 1R34A 4I3RH 2DKSA 5D7JC 3QFGA 3CHQA 3CZNA 4XVOA 4UANA 4M7ZB 5AOJA 3K6NA 2IGFH 2IIJA 4QJ3B 3GI8L 5D6CB 2WNGA 4OZGF 5GPRA 5DMJB 1E8YA 5C09D 4FZEH 2HT4D 4GI9A 3O9WB 3SCMD 1QFWH 4BK4A 2CUAA 2EDOA 3L3IA 4HJJL 4JGUA 3DVNB 4QRTB 2VLKE 3CSPA 5KYWB 2XKNB 3QUKB 3SO3C 4KO6A 3PFUA 4JFED 1M2OA 3DHJA 1SJEB 3H7BB 3DECA 1WITA 4GG6F 4AZ8A 3K6DA 2J3SA 1ID5I 3DX8A 2WQAA 3NBNA 5ESVA 2EDJA 3FS9A 3P0YL 4HAKA 4LCVA 4X7TA 5FLUA 3RI5K 4RGNE 1IAMA 2FHFA 2TRHA 2KT6A 4X8XA 2X40A 4QHMB 5E9DB 4A63A 5IEKB 1BZEA 4CDGC 2Q10A 4OI9A 3ULVH 2JKTM 4IDJH 5TF1L 1E27B 1E6JH 2JCWA 2XG4A 5IHLB 5TF0A 2NTFB 2YN5A 3I9GH 4MAZA 4MKTA 1YMMB 2FO1A 2J5LB 4QT5A 2DYRB 3T2NL 2X44D 4B9YA 4Z5RB 3BHBB 4HWEL 3HAEG 5DI8B 3UTTE 1J0IA 5C86A 4W81A 2GPZA 3TT3H 1MY5A 5ICXA 1U3NA 2ICEB 4L1HA 1PNCA 2A0LD 4KNTA 3Q8CA 1F4WL 2Y5QA 4IBVA 4MFHA 5KS9E 4M5ZH 1S7TB 4RMWA 5IBLC 5INCA 4Y4KB 5EZJB 3VU1A 4PJFA 4RH4A 5K1JA 1EAJA 4CBZA 3U6RB 1MRCH 2WANA 4OGXL 5CN1A 2FWUA 2V3EA 5AWNL 3UTQA 5I66A 1KC5H 2KLSA 1UXMA 2IV8A 3BH4A 3NVQA 1IGJB 4PJEF 4PRHB 4ZOBA 3HBGA 4L0YA 4W4OC 1O9ZA 5T8IA 3FTWA 1ZK9A 3FHQA 4KKZA 1VGKB 4YL9A 1NPUA 4L4VA 5TE4L 3TASA 1O5DT 4NUQA 3IFLL 1Z3GL 1T20A 3Q13A 1OCOB 4R0LC 2DYPB 1TO4A 5EO0B 4X5XB 3RDTD 4NNPL 1TSRA 3O8XB 2ENYA 1DO5A 3DIFA 4G83A 4E0RA 2R4SL 2PP8A 4WO4C 3HAEB 3I02A 3QNZB 1OP4A 5DUML 5AENA 2RBLA 25C8L 2LHAA 4HS6A 3MCKB 2Q0ZX 1VJSA 3TN0C 4H4NA 1MWAB 2Y06L 3P30L 4XNYL 1UHVA 3MNWA 4TMPA 1FV1B 3O11A 5LDSA 2FATL 4H8HA 4MD4A 4AQ1B 4B50A 4WUUD 3C6LD 1Q0EA 1J5IA 5JIIA 3VJ6A 2Z7YA 1NFDB 1ID2A 1KTLB 4HJSA 3P0VH 2M8XA 3HB3D 4NQSA 1SDDB 1A1NA 1NOLA 3R7RA 1JXKA 3WUZA 4JPIB 4TM9A 2ZX5A 2WLIA 3TTSA 5D1QC 1MH5B 4JDTL 5GGTA 4PY7B 3CLWA 2PYEB 4KZ0A 1OT1A 4JZNB 3CMOH 4HIQA 5DJAA 3HI5L 4WWNA 4UQBA 5CZXD 4LCIH 1VGEH 2XYBA 3QK0A 3CN0A 3QULB 5CMAA 3SDAB 3IDXH 4NJ9H 4AGQA 1IV8A 3FMGL 4IK7A 4JY5L 3S3BB 3LQMA 4WWKD 4GBXA 1ZA6A 4RNRA 5HY9B 4U3HA 4PGBA 1AAJA 5T3XL 2BFVH 1ZT4A 3F7YB 5BS0D 2F58H 1FG2B 3BYYA 3D2UD 3E3QC 2HH0L 3MBWB 4YXHH 1I1CA 1D7FA 1PIFA 3B2UC 4HYTB 4PAZA 4ZTPL 1MRFL 2O5XH 2XDHA 1R1CA 1YNLL 4HKXA 4XPAL 3ZE2F 4XAWL 2QTVA 2HLAA 3WSQL 4YHZL 5BMFL 2PW1B 4M7ZC 1YY8B 2R2EB 3COOA 5IBTH 4HLZG 1IBZA 1SBSH 1I1FA 4RMQA 5LO7A 3ULUH 2Y3NA 4ZPVA 1VKXB 4L05A 2WXOA 3GXFA 2FEEI 1UATA 4FNLH 4XVSL 4Y1AE 3MRRB 3GS0A 5E6ID 3O9WC 2IOOA 3V6OC 1Q1JH 4NN7B 3ZPDA 4LESA 1FFOA 1AIZA 4TL5A 1GAFL 3OG6B 2VLKB 4G11A 4OCMC 4FF9A 3MRFA 2WWMD 3FB7B 5JZ7D 3ARVA 4NQCA 2OAAA 4LPYA 1BD2A 2VOTA 4YHPA 2GITA 3B8SA 5D4HA 5T1DH 4D3CL 4GT7A 4YQXL 4KC3B 3WEXB 1DCEA 5DC9B 1FCGA 1BOGA 4P9ML 4RGNB 3EYFA 1G7HA 4PRNB 2BVQB 2DF3A 1AJ7H 4MNHB 4FQJL 4M43L 2Z9TA 4Q2ZA 5T1LA 1TXKA 3DX6A 5I30L 3FRUA 5I2IA 4HWNA 3UEZA 3HOGA 1G6RA 4M48L 4YDVA 2X4QA 1KV7A 1J9SA 2F54E 4WI0A 1DVXA 3I6LE 3OGCB 3P9MB 2J5LC 1P4IL 2Q2EB 2R1WB 4OV6F 3SQOH 2CO4A 5M95B 2Q3XA 1MUJB 2UXVA 5D7SL 1Z9NA 5KVEH 3UTTB 3BW9A 2RQEA 1JZDC 3D85A 3BOVA 1NFIA 3AREB 3VCLA 1GGCL 1UXLA 1NAMH 2KYIA 1UWFA 5LBSL 2ICEC 1U8CB 5H35A 4U1LB 3GMLB 5I19H 5KS9B 4DVBA 4M7KL 2NY5L 3KWWB 1UWXK 2DTML 1SOSA 2RGSA 2Z4TA 4GQ9L 2G9HA 2Q7NA 1C5CL 2WVVA 1Z9MA 2ZX7A 4Y4KC 3QQ9D 2NRDA 3S35L 1J0ZA 2F61A 5FYJL 4EPSA 1IB5A 2ZP0T 2WV3A 1S7XB 2F5AH 3T3ME 1CGSL 4HPOL 3MUZ1 1JWUB 1MHHA 2ZSVB 1I8IB 2BVUA 4ZO9A 1H8LA 5GGVY 4X5QA 4OCNC 3VWKD 2OJEB 3G6DL 5FUCC 4TVPE 2C9VA 5IVXA 1XT5A 2EZ0D 3L7EB 4NM8H 3ATDA 2HFGH 1OGPA 3O8XC 1WHPA 5DS1A 5GJTH 1U8NA 1U93B 4ALAL 4C83B 2ZNWA 2BINA 2W94A 2AAAA 5D1ZA 1J5OH 2G9KA 4J3WA 3APCA 3DSFH 5D1XD 4APXA 4JRYB 1KXVC 1CFNB 4PLJC 4TVSa 2K9UA 2ESVD 4AQ1C 1LQBC 3US9A 1U8JA 5JOFA 2HTKD 5FK9B 1T6WA 3GHBL 2GC4C 4Z7UE 3CX5K 1F00I 3BLBA 1TFHA 2JELL 1KJVA 4IQHA 2DQTH 1QRNE 5CEYA 3HE6B 4ANKA 3LXCA 1MNUL 3HE7D 4GNKB 3F7PC 3LEVL 2QHLA 4K0OA 2LGNA 2R4RH 5E2UH 5FA4A 3QDMA 4RCAA 3ES6B 3SDAC 5ID1B 5T1JA 1FE8L 2OJ1A 3ESPA 3HRZA 1XGPB 4Z95H 2P8LB 1D9KB 2YPVA 3DUUB 3PRZA 5IG7A 4OV5A 1E5ZA 5AW0B 3HG1A 4QXTA 5KSAA 4Z7WA 2JI1A 2GTQA 3DUSB 2OK0L 1SOQA 3L3OB 3RUGE 1K72A 3PXHA 4N20A 5AFAA 4PJCA 1X9LA 2IALA 3F5WA 3FCBA 4UILH 5DC4B 5ISZE 4BZYA 3US0A 4WFFD 1E3ZA 2OL3A 3E1ZA 3T0EE 5T3ZD 4X99B 4BQCA 3PDOB 2DEXX 1E2ZA 4WSJA 4PS3A 2AMUA 3PGDA 5AOZA 3T0XA 2OV0A 1FZKA 1LK2A 2JQAA 2W9EH 4DQOH 1KCKA 1KTBA 4Y1AB 2WKOA 3KBEA 4OLYH 3V6FB 4NN7C 4F2EA 2IV9A 1B0GB 4PGCA 4BK5C 3NEOA 5E8DH 2VW6A 3OVUB 3DJZA 2A4ZA 5D70H 3ZT7A 3PYCA 4LGSB 2Y24A 3TIDA 1R3IH 1N5YH 1QO3B 1HIML 3O3DB 3ZDZF 3BH9B 2BVTA 2XWXA 3UJJH 1AACA 4NB7A 3WXVH 1RZKL 3EDJA 2MEJB 5AYUL 2UZXB 1SYSB 1J1PL 5DWPA 4QJ5B 3GJFH 5A40E 3BRFA 4KQ3L 2K6YA 1YA5A 4RGNC 4KMTL 1CLCA 2ZX8A 1E9PB 4UQEA 4DCQB 5I1LA 2JIXB 3O0RL 4KKQA 2AZAA 2GT9A 3Q06A 4HSCX 2XICA 3SPVA 2IADB 1BFOB 4L4JA 5HHOB 2F54B 1DBAL 3GKWL 2AQPA 2DQHL 4TQEL 3IJHA 3VGAB 5I0VA 3V0HA 4BA0A 2B77A 3K4AA 4WFHE 3KGTA 3ZE0F 3WHXB 1EHKB 3QIBB 4K71B 3AREC 2ICWB 3N0AA 1EMTL 1CBVL 5E9NA 1ACZA 3SBRA 2PN5A 5BXFA 2R0KL 5FFGA 2Y1AA 4HKJA 1MW3A 3QJUB 4U1IA 5L2KB 3BWUF 4FYRA 3ESNA 3HLAB 2C9SA 2WLNA 1CDIA 4OGZA 2IAMB 2IAND 3L3JB 1KN4L 3B2VL 2Z3FA 1FZMA 1JBJA 1IBBA 1EO8L 4LSQL 3B34A 5EU6A 4Z7OF 1S3KL 5J1TC 4LAQL 5JR1H 4FQHB 3CN1A 2MQ3A 3FQWA 3ZUCA 4IU2B 1E5YA 3MGOA 4LPTA 4Y19E 2KL6A 5EC1A 3MV8D 3G5ZA 4P46B 2DWSA 4DOHE 4UQ2B 3I2CL 1QBML 3KDMA 4ODXA 3VXOA 1UACH 4GMTL 1DN0A 1AQDB 4NDMB 2CBTA 4ERSL 5E4EB 2Q7YA 3IGAB 4YFLF 5MHSD 4FEIA 4JAMA 5C0JB 1UASA 2BRRH 1IGCH 5HHNA 5AVWB 3VXSD 5J1SC 2BC4A 4JUTA 2IXQA 4KY1L 3K1KC 4JPVL 4WGVB 4P4RB 1KGYE 2Z8WC 3AMKA 1DFBL 5LG6A 5TK2A 4R7NB 4HC1A 1GGUA 4QRRB 3CHOA 5E08L 4AMKL 4XWOD 3S37X 4JREB 4TUOB 4R7LA 2FWOB 1E28A 2QKSA 3AT9A 2XWJB 4FNRA 4U1HA 1WAAF 2YPLA 1BMWA 4Z7UB 3Q2NA 4QF1B 4P2QA 4U0RB 1RK0B 4XPBH 2YK1H 3CFJA 1I7TB 4GMSL 4O02A 5BV7L 1EUUA 3HE6C 2Z1KA 4XBEL 5FV2A 4PJXE 3TWCL 3ZR6A 4KJYB 2VXVL 2WJ7A 4FQCH 4K5NA 4IOSD 5DFAA 2XN9A 5FEBA 3T4YB 3D4YA 4G7RB 4I48B 2GUOB 1EFXD 3QDGE 1KYFA 2A9ML 1OEZW 3K1DA 3SY0A 1D9KC 4R83A 1P53A 3HN8A 5AL8A 3V52H 3MBEA 1HHJB 1I8UA 2WXNA 1TVBB 4S1RH 2AXFB 3VB9A 1QR1A 4CVXB 3FQNB 3GPSA 3QQ4A 3RUGB 3REVA 2OXHA 3L3OC 5D6DC 2MJWA 1NKRA 1J11A 3MLXH 5FM4A 5GRUL 5HGBA 4P5TB 1CZ8H 4PRPD 4XMLH 3T0EB 3TBVB 4JN2A 5HTSA 4JCLA 1IGTB 2P8PA 2R56H 3HC3L 3O45A 5BJTA 1TNMA 3QFDA 2CDEA 4I3RL 1AO7B 3W37A 2IWGA 4X9FA 3TA3A 1ET5A 2IGFL 2WIIA 2AQRA 3IPBA 4GSXA 5DZNA 4D0DB 5I1AB 5J4MA 1IAKA 1JV5A 4FZEL 4HGMA 2Q86B 5E4AA 1G9EA 4DP6X 1A4JB 4JFVA 3B7YA 2YRPA 3BUTA 2ID5A 3TVMA 2EC9T 3UTSA 1S7SB 2H0FA 5I1DB 4P4KB 1TJXA 4JRXE 3UMNA 5DK3A 3DMMD 3JV4A 2APTA 3LRSA 2J1WA 1OAZL 1HOCA 2XXCB 2VM9A 2FGZA 3QIUA 3IRPX 3M8OH 1ZIAA 3QIWD 3RWGA 3SGEI 3U2SB 4QO1A 4DKEH 4AYBA 3VWJA 4MS8D 4PJ7B 3HHSB 3U7WH 1KCBA 1ZVSA 2W80C 4JKPH 3ULVL 4A2DA 2BSTB 4D0BB 4IDJL 5GZOC 2P28B 3BWZA 4IGBD 5EZLB 1JGIA 4X6BB 1RMFH 2Z6FA 3I9GL 1DQJA 2TAAA 4PD4J 5CEZE 3NK3A 3WJLC 5KUKA 1GCFA 3VGAC 1CYXA 5PCYA 5MENB 5TQ2H 4XNBA 1J7VR 4HJIA 4P07A 4XXCA 4URTB 5B1CA 3V6BR 3GBEA 1UB5A 3QZNA 2EYSA 3TT3L 3QIBC 4K71C 2VO5A 3DJSA 4WU5A 3QCUL 3MLYH 1LE9B 1XCTA 3VFNB 1PZ5B 4M5ZL 3KPSA 5DA4A 4XBPB 3K8MA 4I87A 4XCNA 5FYLD 5BUAA 1MRCL 3ZU8A 3FQTB 3TN0A 3ZKNC 2E8ZA 1KC5L 2DMGA 2FT6A 3E2HB 3EYQC 2IAMC 4EI5D 5IQ7L 2CHNA 3RZCD 4S1SH 2CBPA 1X5GA 1HN1A 3NMEA 4EIGB 5HYJE 5KG9B 1P5UB 1PZ2A 3P4LA 1DYZA 1KCVH 3DLQR 4IW4C 4YSSA 2FSEB 3UTOA 1O0VA 2VLJE 4Y19B 4YBLB 4I1RA 4P46C 1NBYA 1WQVT 2SEBB 1HDMA 3KXFE 5ALBH 3MOAH 1BXUA 1ZHKB 2GK0B 1IU1A 3J7HA 4GKSB 4N2OA 1JNLH 1IIKA 1RJLB 1MLBA 4GYBA 5E4EC 4ZXBA 4Y16B 3DETC 4B5EA 4Y88A 1N64L 1X9QA 4KQ4L 2IH3A 4N4YB 5E2VH 3AU1B 3IMUA 1ADQH 4KJWC 5IW1B 2G60H 2A5UA 2H3XC 1DVSA 2WQXA 3ATEA 4K9JA 4ZFOL 3QQXA 3KLHC 3O2VH 1JNNH 4JREC 4BHUI 4XN4A 5ABDE 2YJLA 1W72L 4I0CC 3FQRB 1WP6A 3IETB 1JD9A 2OW6A 2BH0A 2ZXGA 4U0RC 1OWRM 3C5SB 1IC0A 4WFEE 4XI5D 3MRJB 3CMOL 4PJXB 4YZFE 1KB5A 4UDTB 1ZCRA 1BVLA 1DUYB 1VGEL 3PIQA 4ZX6A 3OPZH 2ZQKA 3IDXL 1NCDH 2IQ9H 3QDGB 4M7JL 3QEGH 1BZDA 3BVNB 5I16B 3N1GC 4G6FD 1U33A 3WFHA 2BFVL 3QJOA 4G8FB 2YQ2A 4NI6A 2F58L 1SVCP 5DD1H 43CAB 4HJ1A 4RQQB 1DANU 5ERWB 3DX9A 4BH8B 1PZSA 2FE0A 1MFEH 4PUBL 2APFA 4P5TC 1HHIA 4BE5A 2MWCA 4L8BB 1I9JH 3KWVA 3T0EC 3UTZA 5ILTH 4ZYKB 5L7XH 5DDHB 2O5XL 4U31A 4WLCA 2P26A 1MQ8A 1KPRA 3OV6A 2B7DT 8CGTA 2PCYA 3CFUA 1J9CT 1XF5B 5IBTL 3ULUL 4WU7A 3ZVVA 5DO2D 5HDLA 5D4IA 5K39A 3MLWH 4NQXB 4XE0A 2C1OA 2A74B 2FT8A 4AKQA 1H0DB 1Q1JL 2X9YA 1A47A 4KDTC 4AQZA