3RYMA

Structure of oxidized m98k mutant of amicyanin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFKRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Replacement of the axial copper ligand methionine with lysine in amicyanin converts it to a zinc-binding protein that no longer binds copper.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords Amicyanin
total genus 24
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3rymA00
4HALA 2PPAA 1AACA 2XX1A 2OJ1A 2TSAA 3NYKA 3EF4A 1A3ZA 2DYRB 3NJMA 1L9OA 3WNJA 4HCGA 2GI0A 1ILUA 1A4AA 5TK2A 4YSAA 2XUWA 2CJ3A 2QT6A 1JXGA 3WG7B 4N8UA 1V55B 3PAVA 4BK5C 4HHGA 2J5WA 3FT0A 3C75A 5B1JA 1N68A 1BQKA 2W88A 4DPAX 1NWOA 1ZPUA 3T6XA 5I5MA 3HB3B 1JVLA 4A2GA 4KO7A 1ZIBA 2B08A 3IE9A 2IDFA 3ASOB 3AZUA 1PNCA 3T6ZA 1AQ8A 4G7RB 1ZDSA 4RH4A 3PCYA 1V54B 7PCYA 1NPNA 1A8ZA 1PMYA 3ZIYA 3JTBA 1ID2A 1L9PA 2BW4A 2PP7A 1ET7A 5ANHA 2IDUA 1AS8A 2I7OA 3CVBA 3V9EA 2YARA 4GYBA 2BWDA 1L9RA 3X1BA 2FQDA 4JKNA 1OV8A 1T5KA 2WO2B 3CDZA 4NAJA 4BDVA 5E9NA 1MDAA 4JHVA 3X1EA 4YSPA 2IAAC 3PAZA 3X2QB 4DPBX 4HAKA 3QJRB 1JZIA 1AG6A 2XU9A 3S3BB 2Q5BA 2IH9A 4AX3A 2W8CA 4G72B 4PAZA 2GIMA 5I26A 1URIA 2DY2A 4KNSA 4DP9X 4YSDA 1KBWA 2HX7A 1M56B 2VN3A 2FTAA 5I6PA 1J9QA 3ABGA 1AZBA 4AKOA 3SBRA 1IUZA 4A66A 3OMAB 5EHFA 2YXVA 5B1KA 2MTAA 1TEFA 1ASPA 2BP8A 3H4FA 5AFAA 4FA7B 2GBAA 5IY5B 1KV7A 1MG3C 3ZX1A 1IBZA 3S3DB 3NSYA 3T71A 1OCOB 1KBVA 3ZDWA 2UXGA 3UGEA 4HIPA 5D4HA 1YLBB 1AIZA 3H4HA 3TA4D 3FSVA 3NJJA 3NT0A 1BYOA 2GC4C 1W6WA 4UANA 4DPCX 2BZCA 4DP2X 4KNUA 1PY0A 1WS8A 1A65A 3AW5A 1M9WA 2AZAA 5I6NA 2TSBA 3V9CA 1KCBA 2OCCB 2ZXWB 1ZIAA 2PPFA 1XB3A 1PZCA 4A2EA 4NERA 1ET5A 4ZK8A 1WA0X 1KDIA 1WA1X 2VSKB 3FSWA 3QJVB 1NPJA 1KCWA 1FWXA 2XYBA 4GXFA 2B3IA 2GB2A 2OV0A 5B7FA 3OMIB 2RACA 3OD3A 1SF3A 2Y69B 4BXSV 1OE3A 2Y1AA 4BWUA 4E9QA 4BXVA 2VW4A 1N70A 5I5JA 2CAKA 3SBQA 1TEGA 5I6MA 3QJTB 4DP4X 3AY2A 4DP7X 1OE2A 4HZ1A 2IWFA 1PLBA 2XX0A 2BZ7A 3GYRA 2CUAA 1MZZA 1GY2A 3NJFA 2MRYA 1A4CA 1BAWA 1DZ0A 3NSCA 4PCYA 1CUOA 2EIJB 1ASQA 1SHXA 2ZOOA 3N2JA 4E9TA 1XMEB 3OQRA 2QDVA 5D4IA 1JZFA 2H3XC 6PAZA 5B1BB 3NJKA 4CSZA 3TBBA 4FAAB 3IBOA 3UACA 1BQ5A 3WKQA 3PXLA 4A67A 1QNIA 2E86A 1EHKB 1GS6X 2BHFA 4DP6X 1E67A 3H56A 4GP8B 1PZAA 3ABLB 5I6KA 1NIFA 4YVUA 4HHWA 1L9QA 1AS6A 2YQBA 1JXDA 2IH8A 1AS7A 2FT7A 2XVBA 1FA4A 1SDDB 1QLEB 3CVDA 3FPYA 3QJUB 3FS9A 1PNDA 2UXFA 1GYCA 1BEXA 4KO5A 5B7EA 1BXUA 9PCYA 1PAZA 4HCFA 4WTQA 3OMNB 1M57B 3ABKB 3AG3B 3DTUB 1RZPA 1JVOA 3AG4B 2YAQA 1ET8A 2VW7A 2UXVA 2CBPA 3NJGA 1GR7A 2N0MA 1ADWA 3IN0A 3NJHA 1HFUA 2PCFA 1NDTA 1ZDQA 1AZCA 2H5UA 4MFHA 2JXMA 1ILSA 1E30A 2BW5A 1NINA 3IN2A 3QJQB 2YAEA 1SFDA 3UAEA 1BXVA 3SQRA 2AANA 4K9JA 3FQYA 3QQXA 3FYEB 1MZYA 3RYMA 2LLNA 4E9RA 1V10A 3FSZA 3MBWB 1AZUA 2AFNA 3JT2A 2AZUA 3WKPA 1E65A 1GY1A 1CC3A 1PCSA 2PPCA 2QPEB 2X87A 4G71B 4W9ZA 1J9SA 1NIAA 3GXUB 4DP5X 2PPDA 3TASA 2AVFA 3NJIA 2QPDB 4E9YA 3S8FB 4G70B 1OCCB 1QHQA 4E9SA 3FU7B 2I7SA 1JZEA 3AG1B 1KGYE 3FU8A 1NWPA 1GSKA 2YAMA 2FT8A 1AOZA 1RCYA 4GP5B 2FT6A 4HCIA 2WSDA 4KNTA 1JXFA 1X9UA 1BYPA 1J5DA 3ABMB 1JZGA 4G7QB 1AG0A 2VMJA 2VSMB 2YXWA 4DP1X 1AR1B 1BQRA 5FC9A 2XXGA 1TU2A 2YAOA 3PLYA 1NIBA 2XWZA 2XV2A 4KOCA 2HX9A 3NP3A 8PAZA 4YSEA 2YAPA 1E5ZA 3ASNB 4E9XA 1B3IA 2HZHA 1SNRA 4JHUA 2EILB 1OE1A 1SDDA 5TK4A 1KYAA 1TKWA 1IBYA 1OCRB 3NJNA 5B1JC 1EZLA 1XB8A 3BVDB 4L0PB 2EIKB 1KDJA 1J9TA 1W6LA 2NRDA 1BXAA 2VM3A 2XLLA 2ZWNA 1F56A 1SHWA 2IDSA 3QPKA 3MX0B 1L9SA 2FQEA 3U25A 5I6LA 1JERA 2UX7A 3L45A 2R7EA 1E5YA 1AZNA 1I53A 3FQ1A 4UF7C 2UXTA 2QDWA 1AZRA 6PCYA 2J57A 3FSAA 2FWLB 1JZJA 3GDCA 2P80D 5B3SB 1GS7A 2IWKA 3FU9A 4A2FA 5PCYA 2EINB 2XV0A 5D4JA 1NTDA 4A2HA 1XB6A 5B7MA 1CURA 3WI9A 4P5SA 2PLTA 4GP4B 2PP9A 2GC7C 1NIEA 1PZBA 1SF5A 1WA2X 4KO6A 2FQFA 2IWEA 3EHBB 4YSSA 3T9WA 3KW7A 4BWTA 2WO3B 3NP4A 1ASOA 1ETJA 4KO9A 3ERXA 3FU7A 3IEAA 4TXVB 1RKRA 2GHZA 3T6WA 2BP0B 4M4RB 1GW0A 3WNIA 4Q89A 1IC0A 2JKWA 3QJSB 2ZONA 4CSPA 1OF0A 2HXAA 3CDZB 2I85A 4YSRA 4DP8X 4GY4A 3FQ2A 4ENZA 4YL4A 2IDTA 3EH3B 4DP0X 4AZUA 3FPXA 4YSCA 2PPEA 2XV3A 3HEIB 2HLEB 3EH4B 3UADA 1L9TA 1W8EA 2VW6A 3CZUB 4QKTA 3CG8A 4F2FA 4YSUA 5I28A 4YSQA 1NIDA 3WIAA 4F2EA 4N4YB 4NB7A 4Q8BA 7PAZA 4M3HA 2H47C 3EH5B 4F7KA 1CYWA 3SBPA 2CCWA 3NJLA 2PP8A 2FNWA 2R7EB 2DWTA 2VM4A 4AI7A 2BWIA 1OCZB 1OOWA 2BP8B 2BP0A 2DYSB 5LDUA 1PLAA 3S8GB 5B1AB 1JZHA 4AKPA 1DYZA 2HRHA 3ZBMA 2GSMB 1JOIA 2FQGA 2PCYA 5PAZA 2FJSA 3NSFA 2DWSA 2HX8A 4WKXA 4QLWA 5F7BA 1HAWA 3T6VA 1NZRA 4UAHA 1IKOP 1CYXA 3G5WA 1WAEA 3NSDA 3TU6A 1R1CA 3UABA 4X4KA 3BQVA 3PPSA 4KOBA 3CVCA 4EF3A 2HRGA 4G7SB 4A68A 2IDQA 5I5IA 5AZUA 1J9RA 1X9RA 1PLCA 2YAFA 4YSTA 2X88A 4YVNA 1J5CA 1MG2C 3TBCA 1SFHA 4BDVB 3D12B 2J55A 1HAUA 2Q9OA 5I6OA 1GS8A 4E9VA 1FFTB 1RZQA 3X1GA 3X1FA 2UX6A 5A7EA 3UAAA 2J56A 4A2DA 1AANA 2CALA 1UATA 1ZV2A 3S3CB 3FYIB 1AAJA 3DIVA 5AKRA 2JFCA 4YSOA 2A3TA 2XXFA 3X1NA 4BWWA 2BO0A 3AG2B 3DKHA 2YAHA 4W1TA 2DV6A 1NICA 1WS7A 4E9WA 2EIMB 5F7AA 1VLXA 1PF3A 3KW8A 3N55A 4AKQA 4P5RA 2P80A 1A4BA 3OM3B 1SJMA 3PAUA
chains in the Genus database with same CATH superfamily
1QZ1A 2WVVB 4J3OC 4QXTA 4ELME 3WEMA 4S1DC 5DVKA 4Z7WE 3CFNA 4AV0A 4OI9A 4PMEA 3NGBC 2NY0C 4AGNA 1HQ4A 4G11A 4KHTL 5IV2A 3EF4A 3TESA 3CMOH 1RUMH 3QAZB 4L3AA 2ESVA 5D7IA 1C7TA 2E3VA 3ARDC 4BFIA 1KLUA 2QPSA 4XTRD 5HHMD 5EU6B 4FXKC 1QA9B 4XNXL 3TPUA 2F5BL 4BK5C 1JZ7A 2AXFA 4HT1H 4LEOA 2XN2A 4Z8FL 4XCFL 3VXNA 4L23A 3QPQD 5TF0A 4XR8C 3T6XA 2CHXA 1SGKA 2IPTH 4LCWD 4G42A 4IU3A 4PWEA 3B8SA 5BZXA 1D5MB 1IBHA 3HZKB 5IW6A 5HPMB 4LLMB 3QWQB 1JFQL 2ICEC 2AJZA 1QFUH 4FXTA 4ZW8A 4H8PA 3KPMB 3QUHA 2FAUA 2X2YA 3QP3A 2FATH 4M7KH 1IFGA 4P5KB 4U1HB 4DVBB 1ID2A 3M1CA 1MNUH 1YUKB 2CIIB 1BMZA 3WXVH 4PLJC 4ZTOL 5EZIH 5IEHA 2IDUA 3BP6B 1A7OL 3X1BA 1MRDH 3WELA 2JWYA 1MCOL 5K9JH 2APTA 5EWIL 3KLDA 1X3DA 1FFNB 1AR1D 5LUMA 4ZSOB 4GKSA 4POUB 5IREA 3U0WL 4L8CB 3FO0H 1HWGB 2FO4B 3BP4A 2X2HA 4KHTH 2A6JB 2DQTL 1Q72L 3HBZA 2FBOJ 2VT0A 4XN7A 2FX8L 5K69A 4XGZB 5IT2L 2A9AA 2VGLM 4PJGB 1CL7L 4TULL 2CR0A 2APXA 2BVPA 2WKLA 4N5ED 2CO4A 1TTRA 3MLZL 3ES6B 3K0YA 3G6DH 3Q0HA 2BVQB 3ZE0F 4GSQA 5MI0C 2IAND 4HYTB 43C9B 2YPVL 3BKML 1Q9WB 3WAKA 3ZX1A 4CUCA 3S3DB 3MBEA 4N2LA 5GIRB 1CDIA 2Z35A 3DRTA 4ZS7L 3WTSA 1ZY9A 1U93B 3L9EA 4PG2A 4PJ7A 2APFA 4U6VL 5F7YC 5HYIA 3AUVA 2IAMA 3THMH 3BVNA 1UWEH 3FULA 2NY3D 5LNEA 1QRNE 2FGZA 5EOTA 3S97C 1G9MC 1T5XB 2H2SC 3NTCH 3WUWA 3WTXA 1PZ5A 2QV2A 5DS8B 1U42A 2XKNB 3VDBA 1WC7B 4XWGH 2FNBA 2M26A 4ANWA 5I6NA 2BNRE 3CPLA 1CFNA 2WTRA 3GI8L 3EIFA 3O2VL 3BKYL 4OF5A 1K4CB 3ZKSD 3GF8A 2B77A 5A3IC 2VSKB 4YXLL 3QQ4B 4DGIH 2I9LB 4F8PA 3EJSA 3QISA 1ULVA 8CGTA 2XN9B 1J05B 1ACYL 3V0DA 2WXKA 4U0QB 4X50A 2WBXA 3T0ED 4BXSV 1SM3L 2Y1AA 5KW9H 5IVOA 1DUZB 2WQSA 1AOHA 2EDQA 2YKLH 5D5MF 5I5JA 3RU8H 5IBLC 2BMKB 1XHHA 5MEOA 1HQ4B 1JF5A 1GC1L 2GQHA 4NT6B 3VD4A 1OP5K 2IWFA 4MMYB 1LQBC 3ZSTA 3K3QA 5KVEH 1MZZA 4LPXA 1KCRH 3G9AB 5BOPA 5D1XE 4NO2A 1ZHKB 1EEZA 2VITB 1BAWA 4L4TD 1QEXA 2X4QA 1N5AA 3B6SA 4J6RL 2UY7B 3KHQA 3GK8L 1IZKA 1ACXA 4NM4H 5KSUA 4B0MM 1LHZA 1BVOA 1AHWC 4GRLA 4UIMB 4I3GA 5B39A 2IXQA 3LXUX 1TFHA 4IOIA 1JZFA 1XIWD 4YWGH 4BK5A 5B1BB 1FDLH 4CSZA 4TVUA 1U8LA 3C6LB 1GS6X 2HG0A 2BVOB 4O9HH 1NAMH 3S96B 5JOPD 2G5RA 4YVUA 1QQDB 3WD5H 3RURA 5HDOA 2YQBA 1EEQA 2OMVA 3DJSA 2J1KA 4Z18A 1TNNA 3IRPX 2XC8A 4QEGA 2ZAIA 5B1CA 2VC2H 2FR4B 3LCYA 3OKYA 5EF0A 2AXJA 2EH8L 2V2TA 2YPVA 4KKBD 4WTQA 4XX1E 3HZYA 3LNGA 5JHMA 2DH2A 2KPWA 1JVOA 3LHAA 5EUKA 4XNYH 5CBAB 2CPCA 2ZSWA 4GUPA 4JRXD 3WOVA 1AXTH 1EERB 3QNFA 1ILSA 1H3GA 3L8QA 3PDOB 1NINA 4N3TA 5F9JB 1MXGA 5CCGE 1CTOA 2CM6A 3D09A 1SFDA 4JHWH 1BXVA 1JV5B 4K3GA 1ZT7B 2BCKB 2FECI 1A6PA 1DBJH 4TVPE 4PCTA 3WJJA 2NPLX 2VXQL 2C34A 5JHDA 4ZOEA 5KZCB 3V0FA 2WXQA 5DK3A 4F93B 1SN5A 5JIMA 3U1PA 4GRWH 2LLNA 35C8L 3MJ9H 1D5IH 1F4XH 3FQXB 5TH2B 5JNYB 3QXDA 1ZLEA 4KJQD 4GW5A 1PZUB 2BIPA 1ERNA 5L4IA 1U2HA 2D3NA 1NMBL 3VQ1C 1AHWB 2C3WA 3U7WH 2D0GA 4OZ4A 5FA4B 1CT8A 3OKLA 3MLVL 1Q0XL 3V95A 4J39A 1TVDA 3KYMB 5DA4A 3TASA 4BQ9A 4ZFZB 1NCIA 1NCAL 2ITFA 4G70B 4NQSB 1SXBA 2O6EA 1OF2A 2DQEH 3TPKA 4WY7L 2BDNH 2I7SA 3V0IA 4HD5A 3ZTJH 5EH1A 4M5YH 2EEAA 5AKTA 3EOAB 3NZ8A 5D7LB 2NX5B 1PD0A 1MRFH 4WFFD 3DXAD 4HCIA 1UCBL 3QH3A 3CZFB 4UDTA 1JXFA 3DC0A 1YO4A 4UQEA 2XVGA 3LPPA 3CHSA 4DTGL 3QXAB 3ZMRA 2MPVA 5FKPA 2B4CL 2D7NA 1WD9A 1MNUL 4IRSB 4CMMA 5DRXA 5DLMH 1HXYB 3V4VB 1D9KA 3DK2A 2IQ9L 1R5VB 5C9JB 2F61A 2NTSP 2Y3AA 4U05A 3BSZH 1MWAA 1H3PL 3EO0B 4NZRL 3ULUL 2DBJA 4E9XA 4EIBA 3AREB 4URKA 4WDIB 1JZ6A 3GXMA 4GUQA 1JNHB 2IIJA 1LP9E 4EZMA 2KZKA 4RA3A 5EN2B 4P46B 5JUEH 4U1MA 2BY0A 1WDAA 1N26A 2H3NB 4M93B 1M71A 3REWB 3TZVB 4A2MA 1KJ2A 4MMZC 3R8QA 2GJ6E 4JW3A 2P48B 2WUCL 3GMRA 4HLZH 4N2IA 2P7TA 3ZOAA 4PCKA 4MDIB 2DQHH 3MX0B 1L9SA 5I8EA 1L0PA 2HVKA 5DEFA 4PI2A 1A3LH 1A3LL 1GJIA 1XCQA 1T1XB 3TT1H 4GRWE 3NACH 3EJCA 4IKJA 4ODWB 3MUJA 2O5YH 4LLUA 1X5AA 1VGKA 2QADC 3GDBA 5EEXA 2XACC 2F54B 3N42F 4A2FA 1KXQE 3GJFA 4JG1H 1BOGA 1NL0L 5L6YL 2ZE0A 5D4JA 1F4WH 1G0XA 1XB6A 3CFTA 1A6WL 3W11D 4LSQL 3PP4H 5CP7A 3SDXB 3A21A 4GP4B 2PYEA 3CZLA 1VRSA 5D5ME 3S36H 1I1YB 1BLNB 2OP4L 2F74B 1RK0B 4PJCA 4BCZA 4XMZA 1OGPA 2CDGB 3FQUA 4IU2B 4NT6A 2FBJH 5D1QA 3QZWA 1R5WA 1ECYA 2XWJB 5FHBL 5DJYA 3WIHL 1FH2A 3SJVB 1O7DE 3SPJA 3EGXA 4LSUH 3LY6A 4M4RB 4DTGH 1A66A 1AQDA 1NBZA 2CXGA 3ULVL 3SE8H 2X9WA 3JWNH 5IF0B 2EAEA 3JBG7 1BJMA 3X13B 3CH1B 4WO4C 3QJSB 4IIZA 4OGZA 5A2JH 2VCOA 4ZDHB 1OSEA 5GGTA 1E27B 4P5MA 1SXAA 4P2YA 4WEUD 2X1PA 3ISRA 3FUEA 4JZJC 4YSRA 4HSAC 3RNKA 5M95B 4EXKA 1I82A 2QLVB 5BS0A 5JXEC 2QQQA 1FVEB 2EZ0D 3CK0L 5F0MB 1T1ZA 1FF5A 4OJDH 3NCWA 4DSYA 4O2FB 1SJHB 4MSWB 4FZ8L 2P8PA 1RH8A 3LKQA 3KYKL 2M83A 2IJ0C 1ZA6B 5I28A 3NZ8B 5KS9E 4QMEA 3NCEB 4NB7A 3HOGA 1SYVB 1PYWA 2KLTA 1XF2A 2XJKA 1CYWA 3SBPA 2ZUQB 3WTUA 2FO8A 3QRGL 3NJLA 5D2LE 4FI6A 5BXFB 1X7QB 1U8CB 5HVHB 2WXOA 5F3FA 2JCCE 4OCNC 4XAKD 4KQ0A 3V4VA 4TQ8A 3F64A 2BP8B 4EI5B 1X5MA 1UM4H 3EOYG 1WZLA 5J1AA 3NK4A 5HI5D 4PS8A 1RZGB 1XWVA 3HE7D 3R4RA 1KYOK 1NEZG 3NFSH 3H42H 2HKHH 1LO4L 1OZUA 2DWSA 4QLWA 5I8KH 2MWCA 4MJ5A 1KFGA 1IM9D 4PIBA 1OPOA 4N90E 3BMWA 1P4LA 5EU6E 2V7HB 2N1TE 4NS0A 2A6JA 4CMMB 2OJEB 1IAIM 4XPFL 4BHUI 3LSOB 1F1DA 4EF3A 3P9WB 4IGBC 2AJUH 3WNNA 1OP3H 2CUMA 4XPGH 1IL1B 1K85A 5ADOL 5JOFB 3UYPA 3RL1A 2YS4A 3RIFK 1XTMA 3OAZH 1HAUA 1XMWA 4TOYL 1ZD6A 2X9ZA 5HHPB 3C6LD 5IVXE 1TVHB 1UATA 2H2SD 5I71B 1XR8B 5IB3B 1JDDA 4K7PY 4MA3B 4XO4A 4ANVA 2ROXA 3QCUL 2BVOA 1MWOA 3CXHK 5HHOE 1CS6A 5AW8B 5JOFA 2HRLA 4ODUA 4WCYL 2X12A 4YHOH 1QKZH 3MZGB 1SHMA 1JWMB 3TBYA 2MPAH 1PKQB 4NI6A 5GGTL 1ADQH 1WZ1L 4D0BB 4WO4A 3X11B 3FB7B 3OM3B 5ANME 4GRLC 5HVWA 1JPST 3RZCD 4UU9A 1TTAA 4DEUA 2R0LH 3CBKB 1YEDA 2OTUA 2G0LA 2E8ZA 4PGDA 1KJ3H 1S8DA 2G30A 3MJ8A 3IMSA 3BZEB 1GCYA 3CPUA 3GS4A 1L9OA 2AS5M 3PQYD 4HPYL 4KMTL 1R34A 4PBDA 2Z0UA 1NC2D 5FCUH 2VR6A 4ELMF 1A6VL 4XOBA 2B4CC 1G5AA 2V2XB 3U0PA 4JO5A 3DGGB 4EVNB 4AW7A 3GSUA 4ETYA 1W0WB 3CCHB 3INUH 4ELMA 3JWDL 3OSKA 2YSTA 4P4KD 5B1JA 2E46A 4RWYL 2A6IA 5TPWL 4LDOB 3ZKXC 4ZFGL 5DD1L 3SE9H 1LVEA 2WVSA 5KSUB 1MPAH 4YEEA 4WK2B 3S37H 4M9OA 3AXIA 3PWUA 1JZDC 2D03L 2DAVA 4LBAA 1EXGA 3T3PE 2ZKMX 2Y23A 4Y4KB 2RD0A 2C9AA 1CDUA 4LAQL 1SOKA 3G7TA 4YXKL 3FB5B 4MXVE 3UCQA 1Q9LB 4ZO8A 3SOTA 4M29A 2WWMD 2PP7A 3MTRA 3CVBA 4X5QA 3KH4A 2BCMA 3JYCA 1FL3A 3WY1A 2JCCA 5C07D 1TQCC 2WO2B 1T04B 1UWGL 4BE6A 2E75C 4X6DB 2WLYA 1EANA 3CLEL 4MD5B 2H9GB 2KLRA 2GITB 1E9PA 2K70A 3M07A 4W9IC 4GXVL 4F7MA 4G9DA 1W72A 2VN4A 4ZZFA 4JQXC 2QELA 5I19L 5L8LB 2E7HA 3S3BB 3Q13A 4OQTH 3IYLW 3QUZD 2CKBB 1MJ7L 2HKFL 2VN6A 4ZUWA 3BMVA 4JFDE 2WW8A 1FAIH 2GVYA 2WXHA 1QSFA 4M7LH 3ARDD 1HZHL 2C7FA 2AV1A 3JWOC 2V5MA 1DQDH 3MJGX 4ZG1A 3EDDA 4K3HA 5DMIH 1KCSL 3C2SA 2L7JA 2B3RA 3M1BA 1CLOL 1QSVA 2NY7L 4KXZH 3PGFH 3H3PL 1N9PA 3QZMA 4LVOB 1AYRA 1HN1A 1I7TB 3CN2A 3KYKH 4B7LA 4FA7B 4G8GD 4DW2H 2QGBA 1W91A 1EJOH 2HAZA 4QRTA 5BNXD 3K6DA 4HIPA 3OB8A 2PWGA 4NKQB 2Y4SA 2NTFB 4XN2A 5LBSL 4AT6A 2X6VA 1BYOA 2F1AA 5KOVC 3BVNB 3EBIA 4KKNA 1ZVHA 1GIGL 4HOMA 3STBA 4H13C 4YBQC 4KY2A 2WXGA 1FFPB 4ZUTA 5HDLA 4QRRA 1QI5A 2TSBA 5CD5D 2EDXA 3OLDA 3VFSA 4AIZA 2R4SH 2B5IB 3C5SB 2BSED 1ZIAA 1XB3A 4FLOA 2DEWX 1FNLA 2HT4D 1IRAY 3NVQA 4FKEA 2DJ4A 2ATKB 2VKXA 4ONFH 4MA8L 3DNKA 3QJVB 1X5KA 1I3VA 3FO2B 4LVHB 1JVKA 3WFCL 4EKXA 1JGLH 4FXKA 1D9KB 4NRZA 1BOYA 2J8UA 4HWNA 4FNRA 1U8MB 4HJGA 4Y19B 3ZSSA 2Y24A 4N0FA 4PJXB 5IB5B 2Z7YA 3QDME 1FIGL 3A3YB 2AJSL 2GJ6A 3O45B 1HH6B 1M7XA 3QJTB 3N6YA 4NQED 3D34A 3WHE0 5A2CA 2YD6A 1B2YA 4GMTH 5D7IB 5DUPL 1A7PH 1YC7A 1C16B 4TMPA 1QBML 4NRZB 3NJFA 3PRZA 3L3JB 1OGSA 1KGCE 3QDJE 3NSCA 1T66D 1WBZB 4UT7L 4O4YL 1EBPA 3NCJH 1K4DA 2F7OA 4I88A 3BFQG 4P04A 3KCWA 1CXHA 3ZDYE 4BKLB 1OAKL 3LPWA 2VLJE 1WBYA 3LKOB 4GKOA 3CDCA 4NQQA 5FYJU 5GS1B 3ROLB 4JKPH 2FEJA 3DX8A 1XF2B 4WKZB 3SDCC 3TBBA 1YJDL 4CNIB 4PJ8D 5DGQA 4ADJA 1JHKH 1U2CA 2K1MA 2VZ1A 3K81A 4KJWC 4OD3L 5HGDA 1FP5A 3VDAA 5BMFL 5IQOA 1KY7A 3ULUH 2V8LA 2EH7H 2APWA 2CRIA 1SYSB 3L1GA 1R0AH 1BPVA 3D05A 5JIPA 3ALPA 5I76A 3O6LH 1MEXH 3TNMB 1G7MA 2CKBA 1U9KA 5JQIB 1FA4A 2B5IC 1BJ1H 1TZIB 4NRXB 3GRBA 2WWKO 3T3MF 1HHGA 1UB5B 3E6FA 2IFFL 3DYOA 2DJMA 5HDBE 2VMEA 5KSVA 9PCYA 2ZD0A 4N2EA 1C5CL 2DI8A 3UCRA 4IGBA 4WO4D 4KDWA 3LRGA 3M1BB 3O9WB 4LSDA 4G6KH 4HEME 5AYUL 3TV3H 5I73B 2XZCH 2UWEA 4NSKB 4PJGF 3W2DH 2DB8A 4KRPB 1VENA 5DHVB 5DUMH 3QJQB 3S5LA 1D6VH 1S7QA 1PX4A 3UAJD 1F1AA 1HXMB 3ETSA 4JY6A 4NQXA 1NDMA 1CFQA 3M17B 4MJJA 2DDQL 2EABA 1V10A 3L5WA 5L88L 3ZKMC 2ENJA 4AGQA 4EJ1C 3DX3A 1JSYA 5ACZA 3H9SE 1RD6A 2WUBH 5IHUL 4M3JA 4S1QL 1I8MA 3UP1A 1D5IL 1MCSA 2X4PA 5CJBA 4JM4H 4HFWA 3O6MH 3KPLA 3V6ZB 4L8SA 3CHRA 1OQXA 1Q9OB 3GMOB 2DWEA 4ENEC 1F90L 5JUEL 3AY4C 4KXCA 4LP5A 1IQDB 4NENA 5I9QC 3MRCA 1EQWA 3CSYA 4TVSa 5AVWB 3AG1B 3GIVB 1GOGA 2IDCA 1HSAB 4M7ZB 4Y16D 3MI6A 1QMUA 2NUPB 3HMWL 1H6FA 4JL2A 3P11L 1M6OB 2MKLC 3DVFA 4K71B 3GO1L 4FD0A 1ZT1A 4K7PX 2APSA 5F3HB 5AW9B 1JZGA 5EUOE 2MCPL 4NO5A 5HJDA 3U6RA 3W82A 1J18A 1DN2A 1TZOA 1YEKL 2EXTA 3C6EA 1TR7A 1N0LA 4FNQA 4H4NA 3SO3C 4ELKA 1H9DA 4Q9QH 3CCHA 1YY8A 2OX5B 1OL0A 4HUVA 1NBYA 1D5BA 3MLUL 1JD9A 5DZLA 2ZPKH 2YPLB 4G1EB 1OCRB 4YZFF 3CFBA 2VISA 4Q9BA 4X5WA 3QQ3A 4Q7DA 1I1FA 1RVFL 4IJ3B 3TNNA 5TGBB 5JMOC 3RL2B 5AYUH 4TRPL 3QZBA 3T4AC 1LE9B 3C8KA 2F7RA 3BISA 3L3DA 2W91A 4I7ZC 3VRLF 4PJEB 1F45A 3RTLA 1JHLL 1L7IL 2YPKB 4LCWA 3I75B 3MNMA 3MRIA 1HIML 2EYSA 2YXMA 3UTOA 4UQ3A 2PMZA 3FUJA 3KJ6L 2FX7L 4NIKB 3DYMA 1G6RA 1F5WA 4O00A 4PVBA 1A25A 3IDJB 2FGWH 5GQBA 5C07A 2XQBL 4XP9H 3HFML 3FU3A 1ZK9A 1XGQB 1BZ8A 5ITBL 1F4YH 5EF2A 5IJBC 5K1VA 1QRNA 2W5PA 2VXSH 2VXTH 3C09B 3G6JF 2YGVA 4HIHA 3MCLH 2OW7A 4X9HA 1URLA 4XT1C 3TX4A 3VXSD 2WO3B 1I4FB 3NP4A 4FQ2H 5LKNA 1YMME 5F1KC 4HAFA 5D7IF 5AVYB 3T6WA 5CEYA 2NCMA 4KAQL 4P2RA 5AW2B 5HI3D 2FL5A 1SEQL 5CFHA 2RQ8A 1I9IH 3SGEI 1INQB 2MQCA 1RERA 2J3SA 4FABL 1CGVA 4F2MA 1EFQA 3O4LE 4YHPA 4A7GF 2G60L 2C3GA 3WKMH 4MKTA 2VIRA 1BVKA 4YL4A 1HCFX 1EZSA 2ICWB 2XNAB 3UPRB 5DK2B 2FJFB 3RWEB 4ZUSA 1RUAL 3LQZA 4N2FA 3QRBA 2ZUUA 2CGRH 2XV3A 3BH4A 3QDJB 1KB9J 4UUJA 3EJQA 3HC3L 1FZOB 2MCMA 3FFDB 3N43B 2CG9X 3IVKB 4BSWA 2A73B 2VN7A 4BFBD 2FEDD 4S1QH 5DHDA 1NJ9A 5T5FH 1Z9SA 5GHWH 3V9FA 3OJDB 3OR6A 3VD3A 4JK0D 3LTVA 4YIQB 1FVCA 2NW3B 2WTOA 2Q3AA 3Q1EA 3AROA 1OTSC 2DWEB 4OZHF 5BO0D 3QJHA 3K2IA 5HY9B 3BXNA 1NSNL 4YK4C 5D1ZA 3U79A 3D3VE 4GB9A 3BAJA 4UILH 4GKLA 4Z7OE 2P8PB 2BP0A 5C0JB 4K9EH 3V0VA 3KPRD 1ACYH 1ZE3C 2OFQA 2XETA 3U36B 4N5UA 3TV3L 1DYZA 4HX1B 4X9YA 2HJKB 2GSMB 1MHHA 4XP5H 4JPQA 4N25A 1ND0A 2ARJQ 1NGPL 2YGQA 3M17A 2NR6D 4IBYA 1YNLH 3QG7L 1J10A 4MAYB 3ELAT 1BAGA 3UZEC 3V4PL 2VERA 2VNCA 1NFIB 3PHSA 3T6VA 1CYXA 1XQ4A 3G5WA 3M7FB 3APCA 3ILPA 3T2QA 1UXWB 3TFBA 4KDTA 3RUGF 4C8XA 4ZNCD 2LVCA 5C0GA 1E4XI 2DMHA 1BWWA 4FTVE 5C0AB 4R7DB 2HRGA 2ZKXA 5C3IA 5CCKH 5FB8B 2YGOA 3OAUH 1X9RA 1PLCA 4HDIB 4RGNC 4PW9A 3NFNA 4OZFB 1OXYA 2PW1A 2XZQL 4Z7WF 2Q2EB 5MHSD 2J55A 1FFTB 4FNPA 4PRNB 3X1FA 2WOBA 2Q86B 4PJ8B 4ZO9A 1CTNA 1ZKAA 3IU3B 3Q2CA 4ALAC 1VADA 3VI4A 4HSCX 4M43L 4FJYA 4LPYA 2VDMB 3GI9L 5DWPA 5DK2A 2KT6A 3PABB 2ED6A 5EUOF 4OV6F 4BWWA 1Z9PA 2BO0A 5F2FA 1AO7E 2YSSB 2PW1B 1OM3H 5JW4Q 3KW8A 5AZ2L 5C9JA 4HALA 1HOCA 1LL1A 4M5SA 4XPHH 4F80A 1M6UA 3ZTNL 5EZJA 1QLRB 1S46A 2H26B 4FZEH 2HH0H 1GAFH 1UWXH 5DMGC 3QH3B 4AVJA 4Z23A 3B37A 3IAGC 1HQRB 2J6WA 3QHZH 4TLUA 1LO2H 3WE1A 4I1NB 4OQTA 3SE6A 3SE3C 2QT6A 5D72L 4LASL 2AQSA 2ENQA 2H2PD 3QIUA 3FT0A 5CGYD 5D2LA 2J5WA 3TVMC 4LVHC 1DBMH 1OGAE 2W88A 4M8VA 4XC1H 1ZGLP 3GZOA 2EVHA 4GI9A 4U6XA 1VACB 4LVOC 5D93C 2YQ2A 1YMMA 2E4TA 4XXCA 4KZEL 2AGJH 3QPQC 4JDTL 3RILA 3IE9A 3ASOB 4HQQH 2BH0A 3ZXAC 2VUYA 3QZWB 5FHAH 2ZF9A 2HFTA 1JGLL 2O6FA 2XJLA 3B7RL 3OKEB 1LE9A 2V9TA 4LHUA 5CP3A 4KTDL 4ZMYA 4ZD3L 1DQMH 4QRFA 2DD8H 2X28A 2Z4QA 3OXRB 5HD8D 4RDQG 4N1CA 3SGEH 3V9EA 5TPWH 1I1CA 3A6BH 1L9RA 3CVIL 4NUPA 4TNEA 1Z5LB 4NOFA 1F58L 3CDZA 3T0EA 4GXUN 1RIVH 3LH8A 4FQXC 4BDVA 5ICZA 2F54A 3QJHB 1HINL 3NJVA 3X1EA 2D7QA 3MBEC 4HIEB 4FGMA 2LU3A 2P9RA 3X2QB 3FAWA 1KEMH 1F41A 1FORH 1GOHA 9CGTA 1RZIA 3DX4A 2NY1C 4PV8B 1P5UA 1QI3A 4AXWA 3NGBB 2YD4A 4B9JA 4JJOA 1HSBA 3VXNB 5AG8A 2A73A 2A38A 3WMPA 2CBOA 5IVZA 3L3IA 2BRRL 5C0DA 3RPIB 2NXYD 2OMVB 3VYPA 1Q0EA 2YPLD 5EU6A 1XGUB 4K3EH 3QDJA 4LCYB 4K94C 3AT9A 5H2BB 2ZUVA 3G5XA 3BSZA 3B9DA 1SQMA 1S5HA 2MTAA 1A3RH 3H8NA 4KROD 3U4BH 4ZW5A 1DQDL 2ZKYA 1U3HB 1EJ8A 3RGBA 3IT8D 5C7XH 5JHAA 4RFOH 1RZ8A 3NSYA 4WJKB 2ZKHH 3D9AH 1OHZA 2UY7A 3ORJA 4AVKA 3JT0A 2EVGA 3NFSL 1YRKA 1C8QA 2I27N 2D7TL 4JKLA 2J44A 3HHRB 2AV7A 2X4UA 2IPUK 3L9RA 3HG2A 3IRCA 4NPYB 2YK1H 4JVPA 3JUYA 3KWWA 3TO4A 4DPCX 2HJFB 2MOGA 2F53E 3HHMA 5DRNB 5JW4M 4N6RB 3DETC 4K73A 5C0FA 3GRGA 4Y1AD 4WIQA 2IAMC 3V9CA 1FG9C 2K6ZA 4JO2L 3PJSA 4Z7NB 4A2EA 4N2BA 3PFUA 3A67L 4PWIA 5D2NA 1WA1X 3FBQA 4PJ9B 1EEZB 1NUGA 4ZODA 5BRZA 2HMID 1A21A 4UT6A 5FW7A 4P8QA 5ISZD 2VRKA 2FWOB 2H0JA 4P2RD 4PVNA 4NWUH 4ODHL 4XVJL 5IBTL 2QKIB 5I8CB 4KKPA 3CMGA 2YEQA 4U1IA 5D7HA 4MXWH 1I7ZA 5TDPB 2OMTA 4N2OA 3NPZB 2F0CA 5ID1B 4RGOL 1G9EA 2R1XA 4Y4FA 5E6YA 1ID5I 1BVLB 1QSEB 1LP9B 4R26H 2VISB 5JXAL 2BVEA 2ERJC 3I6SA 2YGNA 5AALA 1QW9A 4BSJA 4X6BA 1O9VA 4FFWC 1Z7JA 2B9AA 3QDGA 4TN9A 3FFCD 1HSAA 2AQ1A 4ENED 4DGYL 4J7RA 1I7ZB 3VB8A 4I2XB 3EXLA 1XF4B 3WIIL 2Q3ZA 1QBBA 3BRDA 3ZTDC 5HVFB 3DLQR 2ITEA 5AZEL 4NQCD 4R4FL 1PLGL 3BPOC 3CD4A 3PDGA 3FT3B 3KCPB 4U2YA 5F9AC 3TN0D 1LEGA 3OHMB 1C16A 5JDJA 2H32H 3PXLA 5E1GA 4A67A 5H4ZA 2QSVA 2JIXA 4I18C 3VWKD 4XPFH 3S96A 4E41D 3NRQA 2K9FB 4K07A 4YHOL 1II4E 3EJUA 1MFVA 4HIJA 4FQQB 3SE4A 4L9LB 1SXZA 3II3A 4N0UB 3LKSB 4V33A 1QHPA 3BD4A 12E8L 2XCMC 2ILLA 5C3LD 4D9RE 4GRLD 3LS5H 2PCPB 3EGSA 1K72A 4CW1B 4GW1B 1ES0A 1T3FB 3CUPA 4UT6L 1VFOA 3QXTA 3EJTA 1YMMB 4X80L 4J5VA 1PIGA 1Z9NA 1G9MH 4MMXA 3ULAB 2QZ5A 3BW9B 2H6OA 15C8H 2AJ3B 3I84A 4OB5L 4TV3A 3RBGA 5IGXL 4UM8A 5IQ7H 3E6FB 3V4UH 3FQYA 1CXKA 5KS9F 4RQQB 4F3FA 2OZ4L 3VXUB 1NLBH 1TQSA 5IMOA 3PWVA 3BESR 3PIQA 5C0BE 3AXHA 1X5LA 1D5RA 2AZUA 1ZANH 3JT2A 3ZGIA 5HGHA 3L4UA 5DZPA 5E9DE 4HPHA 3FONA 2PPCA 2CD0A 1T5WA 1CT8B 3OKLB 3X3FH 1RZFL 5EEVA 1MW0A 4FXLA 4RBPK 2AVFA 3ESNA 2XTSA 4QPEA 3IJSA 1D6VL 2AI0L 2ZCKH 1FHGA 2VDQL 4LEOB 1WBZA 1ORSA 4L4VD 5SWZE 1XGRB 4XI5C 5I1CL 4PRPA 4QJ4B 2IQAA 1RIHL 2FT8A 3TWCL 3WY2A 1CR9H 4KK9C 1S7VA 5H35B 3TVMB 3ZQXA 5BS0E 3VFTA 4P4KC 3L13A 1AG0A 4R8WH 1NKOA 4P5TA 3D0VA 3SPVB 1SDAB 1RK7A 3QCTH 2UV3A 1OW0A 4JM2B 4NNXB 2HX9A 4GAJH 5FA3A 5KBMA 4NBZB 3G6JA 5BMFH 2VRQA 3CH1A 4G8IA 4RRPA 3CWGA 4D9RD 5C09B 1VSCA 1Q1PA 3FT9A 4EE2A 1P4IH 3MRDA 1XB8A 1ZSDA 4AUJA 4JLRA 4L1HA 5CKAA 2ICWI 3BLBA 1KCVL 3VI4E 3ZUNC 2O5XL 4J3OF 2H1PH 4PJ7E 1G0YR 3EYUL 1UEYA 3C6LA 3ZZLA 4RVBA 4Z7VB 4PRBA 3CE1A 1E5CA 3RB7A 5IROA 5J12C 2R0ZL 2EDFA 5T1DL 1J1XL 3QORD 3W9DB 4MS8D 4QRTB 5B3SB 2LTQB 1GYVA 4MYPA 3WD5L 2ADIB 3BO8B 3GJEB 4YS4A 1ZTXE 3FN0L 3PIQB 4B41A 4JFYA 4Z3EA 1W80A 3QEGL 1NTDA 1YNTB 3BKCH 4A2HA 4W4NA 4KKZA 4QXGH 2VO8A 4IYKA 4LLVB 4XCNB 4P5SA 3WEOA 1ZLVK 4JBSA 3B2MA 4KJYA 4ANKA 5D71L 1BFSA 3N1GC 3BIKA 1UXLA 1SF5A 3PAYA 4DVBA 1WK0A 3BFOA 3MX0A 5D5MB 5JPMC 1NCDH 3ELQA 2R2BB 1HHIB 3T9WA 1E6JL 1VAHA 2FSDA 3ZT7A 4LF3A 2QBWA 2EDTA 2QFRA 2JLLA 4OFIA 4U6HA 5EN2A 1TKWB 1Q94B 5BZZA 3ZQWA 5GS0C 3NESA 3VQMA 2GK2A 3PV6B 4U1IB 1QUNB 4JY4A 1YUHA 5ES4B 3T0BA 4GT7A 3KPNB 4AGLA 1NMAL 3MUY1 3LVTA 3P9MB 5IGXH 1HILA 4DP8X 5BO1L 4JDVB 2DEYX 3US9A 1EEYA 1M4KA 2ZXGA 3P4MB 1HHKB 2NXZB 3D4CA 3PJSB 4M48H 4Z7NF 3QFJE 2RCSL 2DTMH 4HUWB 1ZHLA 5EU3B 4NO0D 3CFUA 3PL6D 4E36A 1ETA1 2YBRA 1IGTA 4KQ3L 1JUFA 5FR3A 2F19H 5SWZA 2WLLA 3ZDXE 1INEL 1XF4A 2H47C 3S36X 5GISL 4HV8A 3MYZA 3PWUB 2FO1A 2AITA 3D07A 4O5LH 2YKKA 2X40A 4FJZA 1DQQA 3FTVA 3VGGA 3QDGD 4UINH 2C1OB 1AC0A 1ZJAA 3MUHL 4QRRE 4AQEA 2IC2A 3IDGB 5AZEH 5JPMB 4YXHH 3AU0A 5D7JA 2G60H 3MLVH 4RMWA 3WKML 5DD3L 2FQGA 1QFPA 3CN0A 3RKPA 1NJ9B 4OCYL 3CVHH 5ESAB 4LDCA 2C26A 4I5BA 4JUSA 4PY7B 3T2PA 4NWTL 3KXFB 4WI8A 2WYHA 1W15A 5MP6H 4MAYC 4HKZB 3IPBA 1S7SB 3UBXA 1WAEA 1G5GA 4GBXB 5AB9A 1XXFC 1S8DB 3D85A 2P5WA 1FO0H 3BZFA 1RJLA 3TIEA 1OGAB 4HHAA 1LO0H 4LVNB 2Z93A 2Z91B 1KGXA 1B90A 3CFMA 5E5MA 3BPOB 2NQDA 3UC0H 2IALB 4WSKA 1ZMYA 4KRPD 1U2YA 1J5HA 2V37A 3HBPA 4KXDA 1NCHA 4QLRA 1DJZA 1G87A 3W11C 1Q8MA 4TVPD 3V5KA 3MXVH 1RZQA 1ZT1B 3BEVA 2LFGA 5B38G 3VWJC 2XQBH 4JRYD 4XP9L 3V0AC 1H6TA 2NDGA 3AGVA 1TZ8A 1OHQA 1G7QB 4J6RH 3FYIB 4JQVC 5KSAB 2NXYC 2FZ3B 1J8HA 1R3HA 2ERJB 2NY5C 3DIVA 5AVXB 5HYSG 2VXVL 1YDPB 3LDBC 1D5MA 5IB1A 5INCA 3UO8B 3AU1B 4IHOA 2ZUQC 1YPZB 3T8VA 2DV6A 5D6CB 2YMOA 4WENB 1FZJB 1MCBA 1VLXA 1VHPA 5E6ZA 2XRAL 3CVHL 1T7WA 2KBGA 2Z31B 3DOSA 4GRLB 1R24B 2CO1A 4XNUL 3W9EA 2VDKL 4GAYA 1RVFH 4KZ0A 5DS2A 4WLCA 3C60C 1ZLUH 1BCIA 1VFAB 1UUNA 5KSAA 4LFHD 3RIAF 4K7PL 3EG9A 2J20A 2OZNA 3O6ML 4LEXH 4OFVA 3NG5A 4EDWH 4G43A 4YAQB 2HFFA 1KN2L 4EEEA 3C8KB 4NEHB 2D31A 3QULB 3VNZA 4MCZA 4N8UA 3CX5K 3W81A 3VXUD 2R8SL 1M2VA 1EAPB 4X8JB 3CFKA 1FGVH 2W60A 3ECBA 3RWFA 3ZHFA 3U48A 3VFOB 3HKZA 1S3RA 3BT2H 1DBAH 4LL4A 5I5MA 1DQML 3SQOH 5EBWB 4KFZC 3HHSA 3SO3B 2YD8A 3DIDA 3OPUA 3VFMB 3UTTD 2X6BA 3AZUA 3VRIA 4G7RB 4M6OL 1FE8L 4MJ5B 3EYFB 3B3BA 2JSFA 4UDUB 2WTRB 2LOEA 2C1PB 3LH9A 1V3MA 5C6WH 5FUZL 1H0DA 2DLEA 3CH8A 3P3RA 1B6UA 3WN5B 2GPZA 3IFLL 3ABZA 2GBVA 4XZUB 1S6NA 4MB3A 5E4EC 4WU5A 1F58H 4HETA 3BPCB 2I7OA 4YR6B 5C2BL 5DDHB 2UUDH 5CD5C 4OI7A 2R1YB 1KTJA 1X5YA 1I8KB 1DQKA 1MN4A 1EXHA 4U1SB 2R29A 3RGHA 3A4DA 3HG4A 5IWLC 4HFUH 4OCRH 4K8RC 5T3ZH 5I75C 1FL5A 1A9EA 2DL2A 3BUQA 4JFPB 4L3CA 5GS0D 3GBDA 1G1KA 4HOWA 2IBBA 3D1MC 2H8PA 2C3HA 1Z6JT 4P9ML 2FDBP 4XBPA 5I1IL 3BPCA 1XDTT 3LV3B 4IHBA 4PV9A 5EO9B 4K3DL 3IBEA 1UUSA 2NZ9D 1NAKH 5E8NA 1URIA 1DSYA 4PJFF 4LKXB 4N0RA 2YHGA 4DP9X 1VZGA 2DQDH 4YSDA 1YC8A 3MRBA 3RWIB 3T8XA 3D8MA 1IMHC 3BGAA 4ZW6A 1CGSH 3CQQA 3GSRB 1KB3A 2D9QB 5E4IA 3AGWA 5D1XC 3HAEA 4GMTL 1IT9L 2PYEB 2XG4B 4M43H 2W0FA 4Z7UB 2DMGA 1A14H 4U33A 1XF3A 1XZ0B 4JFHE 3H9SB 4FZEL 4TUUA 4RZKA 2PWHA 5HTSA 1KBVA 4EUPH 3UGEA 2GKIA 3QB7C 3SE4C 1YECL 4K94H 4N68A 1V7NL 3IDNB 2XWJA 4EN2A 4WZ9A 4MZIA 1A4JB 2D03H 3S4SG 3H4HA 3N91A 2HFEB 3K91A 2Q8BL 3RWCB 2YPLE 2PTUA 2J7LA 4J8QA 4N5EC 1JHTA 4IDJL 4K3JH 4NN5B 4UNUA 4XXDA 4JO3H 4ZO6A 4PJHB 3GMQA 4LXFA 3F6LA 3AW5A 3MMEA 3TIDA 2VAAB 3MA7A 4RMBA 3SDDA 3L3HA 4NYLB 3EFFA 4ZUSB 3RWEA 4XHJD 3SJVD 2VJ8A 3VFNA 4GG6E 5HY9A 2Z31A 3DOSB 3BSHA 3N0PB 1Y07A 2FH6A 2WBWB 4IRZA 2A83A 2OZ4H 3AREA 1M2VB 2HT3D 3BIBX 4XE0A 2B3IA 3Q06A 3QC5X 3WDJA 1U8QA 2FSEB 3E2HB 3DYPA 3VI3F 4CC4A 1Z9SB 4LKCA 3Q5YA 4OKDA 3BPLB 4QGTA 1HL8A 4GKZA 3BAEH 4NKOA 5DHXB 3PWJB 1ZJBA 2W81C 2P49B 1JDCA 1F86A 1WZ1H 2TRYA 1EVTC 1PQZA 4XO5A 5JW3H 3LAFA 5C09E 1FGVL 1LQSR 3RJDA 2YFNA 4M7JL 3MTXA 3CHQA 1AGFB 5J9PB 1R24A 5FV2A 2QR0B 1A4CA 3N1MC 3G6JB 3V0WL 3IGUA 2LR4A 2VKWA 1CQYA 5E9DB 1CUOA 4C4KO 4XMLH 5D6CA 1L5GB 1T0MA 1P5VB 4OD2B 4G8AC 2XN9E 1BM3H 1G7JA 1QWUA 2ZICA 3EOTL 1SN0A 5HVGB 1MAMH 4MXWL 4RAHA 4QIRA 4PS3A 1CYGA 2QSCL 1FQ9C 4GIAA 1CWVA 4M5TA 3T0EC 1G7QA 5CILL 2BWQA 2H3KA 5FECB 4MD4A 3QUGA 1JZ2A 1MCCA 1F6LL 4HMDA 4UV4L 4K5NA 2MQ0A 2E6QA 5D2NC 3A4EA 3SE9L 3HE7B 3SDAC 4IK6A 3U9PH 4ETQA 1GTFA 1U8KB 3W0WD 2FT7A 3L3KB 2WB1A 1QZNA 1SDDB 4TF4A 3F7VA 4KAQH 3QUXB 1VPOH 3CVDA 4DGYH 4NQSA 2UXFA 1H8NA 2CDEB 5AAMC 2WXIA 3VFRA 1ZLSH 5B7EA 1G6RB 3GSOA 3VXRB 2OMYB 5FGSA 5D1XA 6CGTA 2B39A 1LEGB 3OHXB 3AG3B 2L7UA 2WC7A 2YK1L 5JA9A 3H85A 2UXVA 4YXHL 4BA8A 1EFXB 5IM7B 3NJHA 5MEPA 3KPNA 2JJVA 4GW5B 4FQ1H 2L3BA 1HNFA 4FI7A 2FJHA 4MFHA 5JLZA 2BW5A 2ARWA 1KPVB 2YD1A 2C7UA 2VUKA 1NCAH 4PR5B 1MWAH 2ZKHL 3D9AL 3SODB 3UAFA 3C5ZB 1YMHB 2EEXA 4IQHA 2VZTA 4TYUA 3DJRA 2CXKA 1MH5B 5DQJB 2NY6C 4J4PA 2VZUA 3UBHA 3VWKC 4F37F 2BS71 5AW5B 3LD8B 5IBLD 1J48A 4PJIB 4NXKA 4PTUB 2QTVA 4HUVB 2AFNA 5I30H 5I30L 3FHQA 1UJTA 1KLGA 5DUBB 3CUPB 2VDMH 3F58H 4ZUUB 4PJCF 4Z0XB 5LBSA 1IAOA 3IFPB 3NCMA 2E0PA 3L7FB 4FQLL 4PWJA 3TBSA 1BAFL 1BF2A 1F6AB 2K8QA 2VXQH 2NY2B 3GMOA 4HPOH 1PKQA 1DEEB 1IM3A 1ODAA 2V0AA 1T80A 1QHQA 3GM0A 3N04A 5BRZB 2NUTB 5EU3A 1UH3A 4FTVD 4FNLL 4XVJH 3EJPA 3BLPX 3MR9A 1GSKA 4I4WA 4JB9L 3SDAB 4URTB 3HZMB 4Z7OB 5ISZE 4ATTA 3O11B 3K6SA 1FLTX 1J5OH 4OLVL 3OF6A 3KGRA 4F8QA 1X9UA 1UT1A 1IM3B 4NC0B 4ZT1A 2VSMB 3CDFA 5EF3A 5T3XE 1M05B 5DWUH 3RY6C 1KOAA 2HG5A 3EDEA 4I48A 4YHKH 3U9PL 4PJEF 1CD9B 3FTSA 3CGTA 5BQ7A 2C3VA 1ZWIB 2QPFA 1LMIA 4TSAL 2XZAH 3AQXA 1UM5L 2BXYA 2G75A 3HS0B 1P5VA 5J5EA 4XX5A 2Q7YA 4F7TA 1KYAA 3TM6A 3N9GL 3BUDA 1TQTA 1WFMA 1W2KT 1C08A 4QRQB 3DVIA 5DC4B 2EIKB 2QVKA 4LDLB 2NY0B 1PL3A 4BZ1L 1W6LA 4Q58C 5K1NA 5IFAH 1F56A 1SHWA 4OCMC 4FFTA 1BZ7B 1OAUH 4JG5A 4R3SA 5F9OH 5CEZL 2GEQA 3QG6B 4J8RB 3SBWA 4WGVB 1VIWA 1T0PB 4G8IB 4OLYL 1I53A 3TGXA 4F91B 3RPIA 1KNOB 3O6FC 2OSXA 3MRLA 4EN3B 1NCDL 4ZZKA 2X1QA 3QZWG 3DPBA 2IWKA 4GEIA 3E9UA 5E2VL 4P23B 3MRQB 2VR3A 1WG3A 3A5VA 1EMTH 3SDDC 4TOYH 4E68A 4DGVH 1CURA 3RVXD 3VXSE 1F00I 2X7LA 4MMZA 3NCXA 3L3HB 3BRGC 3SYCA 4UTAL 4N0YH 5ITFB 3VSTA 1AGDA 1MY5A 2AGJL 3MCG1 4L1SA 4BH8A 3IU4L 4O2FA 2YR3A 4L3EB 5I0WA 3LN9A 2CCVA 1DBML 1GYAA 5L8JB 4MKMA 1MFBH 4PJ9D 1AY1H 5KYNA 2A77L 3V0GA 5KVGE 5AB2A 2JKWA 3N1PC 4L5FH 5AL0A 2UWEF 3P2BA 3SDCB 1IU1A 5D6DA 2ESVE 4JCLA 5DUML 4ES9A 3DO4A 3KYOA 2ZUSA 1FFNA 5KJ4A 4OJEH 1TTBA 1M05A 3V0JA 1KXTB 4Z1PA 1TJMA 2WINA 3HE6A 4RZCB 3UBXI 4FKKA 3TBVA 5CAYB 1C5CH 1CE6A 4OGYL 1CVSC 4OIFA 2DQIH 5DZAA 2CLVB 3BUTA 1G7HA 4P3CH 4F33B 4CVUA 3CZUB 2ZP9A 2G5BA 3UZEA 1R4XA 4Y16A 4HKXB 2DKUA 1MFEH 1PG7L 3BHBA 1C5DA 2BHUA 3OWRA 4H88L 4PJDE 5I66A 3R7QA 1CR9L 3AAZA 3GI9H 4J1UA 4APXB 2XXCB 5HYSB 4MNGA 1X5XA 2EACA 4N0YL 4R0LB 3ZZSA 2DICA 3QUYC 1XIWB 4JE4B 3SDDB 1JPSH 3TP4A 1FL5B 4LCIH 3RFZC 4XWOC 1ZV5A 1KPRB 1JPFA 3AB0B 2N0KA 1C12B 1EUUA 3MV9E 3E8VA 4J3OH 2CCLA 1LO3H 4XPBL 2R27A 4Y89A 1YEGH 3FH8A 5DEFB 5IJKC 5IOKA 3ZE0B 1TYJA 4ZMAT 4KZCA 4AG4H 1A7NL 5F72S 1SLXA 1F8TH 1WHOA 1ZA3B 4I18A 3IAPA 4NZUH 3GSWA 4QRBA 3D0LA 1HKLH 1OCWL 4CU8A 4UBDD 4DQOH 4X5RA 2HKAA 2KI6A 4HJ0D 2DQUH 4TPRL 3OR7A 2P3YA 5ECGA 1R1CA 4Z0BH 3WNOA 3HCVB 1I31A 1XBDA 2W0FB 4PJAF 3GM8A 4CJ1A 1RUPL 3EADA 5FB8A 2IDQA 1RP8A 4FQQA 3M7OA 1SMAA 4K5PA 3W5MA 4CGUB 3BE1L 1DANT 5CCJA 4PGBA 3NZSA 4YWGL 3WEXA 2OKMA 2YOAA 4KY1H 2VE6B 4JS7A 1H5BB 1X6LA 1PEWA 3L16A 2HLAB 3BYYA 3DVGA 4HS6B 1M1XB 4LRIA 5DZNA 4K23H 4RMRA 2F54E 3H6JA 5JZ7D 2WP3O 5IBUG 3I6GB 4JDZA 2OR8A 4X4ME 2Z31C 1U8IA 3W56A 1CFSB 4B50A 1F11A 1B4RA 3BSGA 1GC1H 3ILQD 2CO3A 3Q5OA 3VH8B 3FO9B 4QJ3B 3W9EB 4LLQB 2O26U 1UXSA 3D6GA 3MJ6A 1FYTE 4LCUB 2QLYA 4U1JB 4X7DC 4ZOCA 3H2WA 5E8PA 1CDHA 3FF7A 2XX1A 1QVOA 2OJ1A 4KRNA 2FYVA 3VE0A 4N6RA 5FYKH 4WHYG 4YIQA 5INCB 5KAQF 4XP4L 4MD0A 2VLRB 1CG9A 4NC1C 2WOYA 3D18A 3V7MA 3TZVC 4FABH 5CJOL 4B60A 3BH8B 4MBRA 4FMKA 4JO1H 4UYPA 4YN3A 5KG9A 3WG7B 2ZCZA 3PAVA 4HHGA 4H26B 3L2MA 1RPKA 4GLRI 5FGCB 4HCRL 4R7DA 1VFAA 4JM2D 5JO5A 1DTUA 4LKCB 2D3VA 3MOBL 2NYZA 4H0HB 1HEHC 1BG9A 1XCTA 5ICYB 4XCYB 5TDOB 1ZT4A 3FK3A 3PNWA 3RWJA 2A0LD 1O7SA 4HIEA 5CN2A 4AGPA 1A6TA 4R96A 5SX4H 4MAYA 4RH4A 3MREB 4Y4HB 4G43B 3WIFA 1LTXA 4O2CA 3H7BB 4D9QE 5GSRB 1D2PA 2WIMA 4P2RE 3VWKA 3GSNA 2ZKWA 4NOBA 3U7WL 5E4EB 1MFMA 5JHLL 1R46A 1HIMH 2D3JA 2FQDA 3JV0A 2EEBA 3QUZA 5D7LA 1N67A 5DJAB 1XL6A 2RA1A 4XZ4A 3RTQA 4N0CD 5L8KB 4A6YL 1P6WA 2CMRL 3WS6A 3Q2LA 2F1BA 4F7CA 2E9GA 4JFHD 4DPBX 1HH9B 5AVZB 1YHPA 5J9PA 4WFED 5IROD 1NLDH 4HHAB 4Y16C 3HI6L 3SD5A 4A7VA 2Q0ZX 1OZTG 1OANA 2UYLA 4OZ4B 4MA3A 1W0VB 2Q76B 4FYQA 4AX3A 3I75A 3EYOA 1WICA 2WKGA 4BK4A 3IJEB 2W1NA 4ZX5A 5SWZB 1HYSD 1I85C 2W59A 1F18A 4YXLH 2FYYB 3NH7L 1HINH 2HX7A 1E9QB 4G3YH 5F96H 4EI0A 2DQ6A 3LIZL 5CEZD 2NY4C 3FB7A 1B4JH 3V8CA 3HN5A 1C1EH 5GJTH 2F19L 1TEFA 1CICB 3HA0A 2D7MA 4XBPB 1HNYA 3LSOA 1Z0NA 2CDFA 2WQUA 3HI1A 5F9JA 1WVZA 1RZ7L 1E6JH 5I1HH 1KYOJ 4MMXC 4WI4A 3C9NB 2NXZD 1QFUL 3OC8A 4NAQA 3FCBA 1K4CA 1T0OA 2YMTA 4FXGC 4PEEA 4U6VH 4G8GE 3P0YL 4KK6D 3COOA 1RL1A 2HUEA 4JFDD 3RWCA 4LCIL 4IRJC 4EDXB 4ZMVA 1JRHI 3IXAB 3B9KC 2OMUA 4MLSA 4KX7A 3QJZA 4ADGA 1A65A 4GW4A 1IT9H 3OKKA 4PBXA 1P9MC 5L2KD 3TA3D 5C0BD 1FFOB 2PO6C 2C1PA 2WK2A 1BHGA 2Y06L 4I2XE 4YDLB 1I8AA 4XP6H 3VXRE 5EFIB 3ARVA 1SVBA 1EDHA 1NPJA 2VZVA 4G7VH 4K8RD 4Y9BA 4NPJA 3VW3L 3DO3A 1DVQA 4G82A 1JUFB 4R5VA 5EBWA 4MJIA 1XAUA 4A7QA 4JZOB 4BWUA 4XPHL 3A6CH 3TYGL 1OOAA 1T83A 1MXDA 3S88L 1V05A 3DSFL 3SBQA 3VD2A 4DP4X 1Z2KA 5D1QB 5BV7L 4QHUA 1NCWH 4WFFE 4YAQA 1JF6A 1WPCA 3CZGA 5GGQH 4IRSC 1CFQB 2ZQKA 5L0QC 5C0CD 3T04D 3L5IA 1S7TA 4ZQKA 1RXLA 2K0RA 5CJQH 1S7QB 1WUZA 3U30C 1IGJB 1NAKL 5FF6B 3BH9B 5LGHH 3U82B 4B6ZA 2QDVA 4UI2A 3T08A 5JQHC 1QTPA 5F8QC 3AAZB 3PHAA 3KVPA 5CMAA 5L4JA 3V79C 1SY6L 1BQ5A 1JGUL 4RA0C 1E67A 4Z7VA 2F9BT 2PXYD 2AK1H 2GJ6D 5KOMC 1RAMA 1EZVX 4U1HA 2LLLA 5HYJE 5LN8A 2OAAA 2IH8A 1JYXA 1MNNA 1DUYA 3IXTB 5FWQA 5BVPL 1QLEB 4MAYD 5HHQA 5GGVH 3DMMC 1CVRA 2Q3XA 2A6DA 2UZXA 1Z0MA 1ORSB 4G6JL 4BZ2L 1NAMA 2Y7QB 1MVFA 1WAAA 3SO5A 7CGTA 4WWKC 4L3EE 2EH7L 1IC1A 2VW7A 3WFBH 4EI5C 2BNRB 3O6FD 2DIAA 1Y6KR 1CFVH 2N0MA 5SV3A 5E00A 4WEEA 1A5FH 4W9LC 4XAWH 5F7HA 2VLJA 2WANA 1E30A 2J12B 3S88H 3IN2A 5I15L 4R4ND 4G9FD 2HJKA 1R3IH 2WLIA 4NAMA 4ODTL 5ALBH 5DYFA 4FMVA 2V2WB 4NKIH 1KXHA 3PUCA 1WH0A 3V0VB 2DQFA 2C4XA 4RQQA 2YMXH 5GJTL 4F3FB 4JZOA 3UIYA 2MFNA 4IIQC 5DWUL 5EEZA 2B1HH 3OKNA 3DX7B 1U6AH 5B4MD 5BPPA 2R2EB 1GY1A 1HEZA 4MJID 5E2WL 4F2MB 1NGPH 1XGQA 5FO9A 4X7SH 3RPBA 4AIXA 3FRPB 4XN9A 3RI5F 2BSRB 3CMOL 5T5NF 3ULVE 3ZHDA 3WY4A 3EO9H 3GXUB 1J5OL 4OKVA 5LG1A 3E0GA 5TE6L 3RIKA 2PPDA 1RZJH 5KVMC 2QPDB 2J73A 4JB9H 1A6WH 3OZKA 5I1LB 5D96B 5IW3A 4YFLI 3FO2A 1GYWA 3NFPB 4XBGB 5DQDL 1YQVL 4FQXA 4LL9A 5DTFB 2OMUB 3H0TB 4PRPB 1IGTB 5DHYB 3LVEA 4QCIA 5DRZA 4QRRB 1S9WB 5E2UH 1JZ3A 4HIIA 4LLDB 4OF6A 1BG1A 5IESL 3FRUA 1TLKA 3RL2A 2NNCA 4AZ8A 3NN8A 3Q5TA 2Y06H 1UJ3A 2WN3A 3T8MA 2YXWA 3U83A 2PCXA 3P40A 3WMQA 4WGWB 3B7TA 4A6YA 3LIZH 2E6PA 1E42A 4KK8C 5DMIL 2N3JA 4ATWA 1J5IA 2XV2A 2YD7A 2QTEA 1MW2A 2AQRA 3HI1B 3P3SA 4NNPL 5D1ZD 2Q6WB 3KBEA 4OQ1A 3K71B 3HRZB 2W38A 1L6XA 4YHML 3J27A 2JI1A 4H8VA 1TKWA 4N0UA 2IFGA 3CFIC 3DX0A 5C71A 8FABB 3SYOA 2FYYA 3FDWA 1C08B 1UOVA 3IDXH 4YDMA 5TGBA 3IWVA 1B9KA 2BOCB 5T1LB 1X5ZA 3FXIC 3DUSA 4J3OG 4RWYH 4P05A 5I6LA 3FT2B 2R9HD 3PDOA 4LO9A 2E6JA 2UYLB 3VXOB 1ZWIA 3S34H 4JRWA 3C6SB 5IHHA 2QDWA 1IAII 4IOFC 4G8GB 4DN3L 3JWOH 2FWLB 1U8JA 1YEJL 2XIBA 3DURA 3PP3K 2X4OA 2WLLB 3FUNA 3OSVA 2IXQB 2E7MA 3BO8A 3GJEA 2EYRB 4OGXH 2ADIA 2EINB 2BOBA 1FH5L 5TQ2H 1P9MA 5F6IB 4G9DB 4LAQH 2R2HB 3CIQA 5T1KA 4ZUUA 4M7ZC 4Z7OF 3O11A 1M42A 4FQ1L 2CBQA 2MPAL 1ICTA 3W0WA 7TAAA 3RAJH 2IWEA 4N24A 4TM9A 3TH4T 3GUTB 3MAWA 5EBMB 1E90A 1S9VB 1FJ1A 3QDHA 4OV5A 1NANH 1J7VR 4K23L 1NDMB 2KL6A 3TJHC 1RP9A 1OTUC 4D3CH 25C8L 4ZAKB 5B39B 2ZXEB 1P1VA 2DIEA 3O0RH 2JJSC 2RBLA 4WW1A 1QUNA 4JY4B 4KROB 4NKMB 4TTGA 1U3ZA 3SDXE 1MHPH 1KCUH 3NRPA 4YXKH 5FUCC 3PWPA 1UT9A 1S4IA 5DSCA 5IOPA 1JN6B 2P24A 4HS8H 3SZKC 1H3XA 3SOBL 1GSMA 3T0VA 4KV5F 4ENZA 2MNWA 5T1JA 5CILH 3EH3B 3R19A 1FZKA 1U30A 3QUKA 2BSSB 2AQTA 4LSVL 4XP1L 1BQLL 3F7VB 4I1RA 2OYMA 3VRJB 3UDWA 3ATEA 1LK2A 1LILA 5GZND 2NY3B 3ARYA 2H4EA 3HE7A 5TJWK 5GGTH 5BZWB 1OP4A 1QRND 3D33A 3CSBA 4F2FA 2XKSA 1QVOB 3GXNA 4UZGA 5DTFA 4PBWD 2B59A 4I0PD 4NN7B 4YBLB 1M53A 4WCYH 3H6AA 2BK8A 1VGEL 7PAZA 2R1WB 3FQWA 2JJWA 2GITA 4F7KA 4JGMA 2CLRA 1UH2A 5D1XB 4ZRGA 4X6DA 4ZFFA 1KIPB 1INDH 1OSZA 2OSLA 1LO3L 2DTML 3OJVC 1S78D 1OCZB 1FC1A 2ICEB 1KJ3L 3H3BC 4JQIH 1JK8B 4QAMB 1G7MB 1C8PA 2YRPA 3L3JA 1QI4A 4LDEB 1WIPA 2A9ML 5C70A 5JOPE 5DEGA 1ZK5A 2IMNA 2WXMA 1FZMA 4W4OA 5K1JA 5D4QA 2J88H 3MNWB 3UTSE 3FUDA 1HYRC 5LO7A 4GSRA 3Q05A 1U0QA 4MHHI 3E3QC 1UVQA 3SYAA 5H37A 2BHZA 4B9IA 1F3DH 1D5XA 2BNRA 1NFAA 4LSPL 4I3SH 2XQYG 2J8UB 1HT6A 1M7DA 4L4VE 3CK0H 4Z7WA 2K6WA 5C08A 1LDSA 2ZXQA 1TPXC 4JRYE 1EXUB 4JFSA 4E9VA 4QRSB 1RQ5A 4C56A 1UYWL 4J3OD 3DUSB 2C9UA 3PY9A 4LK4A 3MRMB 4JJ5A 4JHBA 4LLWB 2LAGB 3QEHB 2P47B 4IBSA 4JN2B 4FLRA 4HCRH 4OIBA 1AKPA 3UMNA 2A3TA 3X1NA 1S9XA 5GIRA 1WZAA 4WNQB 5E1AA 5CD3A 1XIWA 1K4DB 1X7TA 1B0GB 1CL7H 1TQCB 1PF3A 4TULH 3PGDA 3UAEA 3N55A 3JTSB 1N8ZA 2ATKA 3RY6A 3T0XA 1A4BA 1E2VA 5FYKL 3PAUA 2VLKE 3VXUA 3BHBB 4UNTA 2XG4A 5H4YA 1ZS2A 3MRHA 2EC8A 3LRHA 4G6AD 4GQ9L 2BVYA 2KMWA 4ZNEA 1I8IB 4S1SH 5I16A 5L2KA 1QFWL 2R83A 1MRCL 1Z32X 3DHUA 3WNJA 2WZ6A 2X09A 3HLKA 3T5WA 2ADYA 1KLUB 2Y1VA 5DD6B 4RMSA 3D3VB 3DVNB 5BVJA 3HUJE 4WUKH 2H7WA 2EJ1A 5F9OL 3T2NH 1SJHA 4MSWA 3VFGL 5CEZH 1A7PL 4FXKB 5DUPH 4QR7A 4I48B 3MRPB 1EVUA 2ORBL 4L1LA 3KPTA 3HB3B 1JVLA 4QHNA 4WUUA 5DJCA 1YNKH 1KWKA 1EK3A 2WVVA 3G6JE 3LKSA 3LEYH 2EEFA 1G6VK 2FX8H 4KKQA 1X44A 4L5FE 2WBJD 3OZ9H 5GS2D 1EHLH 1MCQA 3HS0C 1YEIH 3D39A 7PCYA 2JIXB 3FCUB 4BFIB 2O5NA 4QT5A 1T89C 4YHKL 1I1RA 1JGEA 2OS7A 5DJ2A 4ONFL 1E4HA 2PXYC 3LRMA 5L2KE 4QRPB 4IIQA 3SQOL 5ESQA 2A77H 4IU2A 5EDSA 1R3KA 4GJTB 5CM1A 2NNAB 4IOSD 5MEND 2ZXCA 3WAJA 4D9QD 5DI8B 2AV7B 2X4UB 4OZFA 1HKLL 3AABA 1YNLL 3QG7H 5CP7B 1JZ4A 2ZNXA 3U7YH 1C5BL 2X0WA 1KTLB 5CIPA 1NAMB 1XGTA 1QA9A 4GQ9H 3KPOB 2DQEL 2IADA 5HJGA 2X38A 2VDLL 4RMQA 4Q74A 1FYHB 1GOFA 1TT6A 3GHBH 3L95B 4HS8L 3VYOA 4U6YB 1RK1A 2DZEA 4PP2A 2QMJA 4KNSA 5TDPA 3RVVC 3PU7A 2D2OA 4FQXD 5DMGD 1A6ZB 3HI5H 1J9QA 4XMUA 4JRYA 2FWOA 3LS5L 4WUKL 4LSTH 3T4YB 1YYCA 1E27A 1KJ2B 3MJ8B 2ZYIA 1ASPA 5CUSH 3LS4L 5EMYA 2H2PC 2ICWA 4WK0B 3TONA 1NGYA 2KH2B 4OCYH 3T1FB 4AEFA 3BCDA 1FV1B 4BZYA 1OCOB 3D30A 2J2ZA 4WW2B 2OK0L 3IDYB 3CU7A 5E8EA 4L2LA 1FZJA 2X1XR 5D6DC 1AXTL 3RP1A 5DURB 3FSVA 2Y7LA 5HI4C 3QC6X 4PU2A 3FQNB 4Z6AT 1D5ZB 3TWYA 1FNGB 1BD2A 1KELL 2X10A 4BIKA 3HR5B 3KLKA 4N2DA 5DMJB 3EG9B 1PY0A 3IWUA 1N0XL 3MOBH 4Y8DC 1TVHA 1WS8A 2M2DA 4MNHA 3JVFC 3LRKA 4LGSB 5E6IB 3I9IA 5GGUB 4FG6D 5F9WC 1BFOB 3CXHJ 1TDQA 5IP4A 4ZS6D 1T21B 5E8DL 4U1KB 4NERA 4ZK8A 3RL1B 5LWYH 3H7LA 3FSWA 35C8H 4KK8D 1S9YB 3P4NA 3TBYB 1J0ZA 1FWXA 4XHJC 4FC3E 1SOSA 1G7LA 2IGFH 5CR1A 3SKOB 3GBML 2RACA 1UKTA 2YEVB 5TE4L 1SF3A 4HH8A 4DT2A 5FKAA 3GUFA 2C9SA 3IETB 1XR8A 1TEYA 5CLXA 3WE6B 5I1DA 1N70A 1ZS8B 3JTTB 1DQTA 3MGOB 3CSTA 2AQ3A 4M6MH 2H3NA 3ZYOA 1ZLVH 2Z8RA 1OE2A 4HZ1A 1YMHA 3GTNA 2XNAA 4FYRA 2XX0A 2PTTB 2CUAA 3ZDXF 3LEXB 4AEHH 2ZF8A 4PSPA 2UZIH 2A83B 5IR1B 3K1DA 2XKUA 2H0FA 2VLKD 4HK3J 2EIJB 1M7DB 4PJXE 5JO5B 4RLDA 5J8OA 4TRPH 1KBGL 2OMYA 3TTSA 3FFCE 3P9MA 4E9TA 1BQLH 3HMWH 3TN0C 4CDGC 5BRZE 2H3XC 2P5PA 1P4LB 3KXFA 4GAGL 4OM0H 2X89A 4OLXH 4CRPA 3AT0A 4ONHB 3MLXL 1QNIA 3CC5B 5KTEL 1H3UA 1IE4A 3SPIA 3MNVA 2JI3A 2E56A 1L0QA 2WAQA 4FFWD 3STLA 5T1DH 4L2YA 2W0LA 1TG8A 1Y1UA 3MV7A 1HHJB 2WO4A 3G6AB 1E6OL 4UB0L 1D5BB 1PSKL 2APBA 2F5AH 4TNFA 4X99A 1G7JB 2CO2A 4HV8B 5KVEL 3OMNB 2P8MB 3KLAA 3CFDA 4BSVA 4PH8A 4G9FE 3THML 4PRAB 2W9LA 3NJGA 1CTMA 4U1GB 1ADWA 1DQLH 5D71H 4BRVA 1JI1A 1SUHA 5SX5K 4JY5H 1ZHNB 3N44B 1IBGH 3U2IA 3PL6C 4U7MA 1N5AB 3B6SB 3DDGA 1HCVA 1KTDB 4WI5A 5AUMA 1PQZB 2L04A 2DQGL 3GBNL 1K2DA 4LF3B 5LNGA 4CILA 2CJSA 4Y9GA 4KUCD 4NQEA 4YDIH 3OBAA 4DKAA 4O2CB 2ZXDA 4K15A 4JRYB 4N0UE 3FSZA 3Q6FA 4X7SL 2XDHA 3EFDH 3K4AA 4G6JH 3QYMA 4AJYV 2EO9A 2YZ8A 4Z5RA 1FI8C 3ZRCC 3L6FA 2BMKA 3E3QE 4PRIB 3HN3A 1S2EA 1GGIH 1VCAA 2JH2A 3U4AA 3DO7A 5HYQA 4W9ZA 4HJSA 4YOKA 3T1FA 2LLGA 1SYVA 3RTQC 2CNYA 4TSCL 3DTXA 1MLCA 5FYJL 1KTBA 3V5DB 2FEEL 3C8DA 2Z31D 4WWID 3PYCA 4OZGF 1OCCB 4AMWA 2ZUXA 3N42B 5J7CC 3IJ8A 4P5TD 1RJZA 1YY9D 1TPXB 3EJYC 4LCVA 4CJ0A 3H55A 3AWEA 3O3EA 1IZJA 4F37K 4HC1A 5FDWB 3B9EA 3MYJB 3RGVD 3GKWH 5BS0B 5DS8A 1S7RA 4FNTA 3KYNB 4N0CC 4FQIH 4RZCA 5F1IB 5H8DA 3V4PH 1G1CA 2VMJA 3LQMA 3KPOA 1D3CA 1DN0B 5IESH 1NGXB 1FRGH 3UBXG 1U8OB 3I02B 1FNFA 2YC1A 3IPFA 1ZXQA 5A7BA 1ITCA 4XP5L 3FFOA 3BQUB 4DCQB 4KMLB 1MI5D 1MWAB 3EO0A 3KVDD 3DRTB 4AWJC 2HZHA 1KJVB 4KI5F 2DQGH 3GBNH 4K3DH 4YQXL 3VVWA 3IDYC 4M93C 4WUUB 1OE1A 2FEDC 3PHQA 2L0DA 1CL7I 1I8LC 2ADGB 1BD2D 2JTYA 2HTKD 4UDTB 2XY1A 2BOCA 2OM5A 4GOSA 4F57H 3V7AG 1BXAA 1G6RH 3O2DL 3R0MA 5AW0B 3FHEA 2YLHA 1JERA 1ZHNA 5IB4B 1WD8A 2B1AH 4WDIA 4A63A 1G94A 1OT2A 3UTPD 3FQ1A 2H6PB 3ZYIA 5BJTA 1PJ9A 2CHDA 2ADFL 3VACA 3GDCA 4FQCL 4PJXA 5IB5A 4FFZA 1WBYB 4EN3C 3DPBB 4XCCL 3KWUA 5D9SA 3LB6D 1CCZA 3Q1SL 4R90H 5F71A 3RJOA 3DMMA 4NBXB 4ZNEE 1IAKB 3KPSD 4HWEH 3O8XA 1TFPA 4X0KB 1JV2A 2WXNA 2ISDA 1NL0H 1KIRA 1KFAL 1T5XA 2E27L 4AIZB 5E70A 1HYSC 3MRFA 2W07B 3VFUA 4XVTH 2VIRB 3WFHB 3D39D 5DJXA 4AITA 2MHAA 3BGMA 2Y2TA 4F15C 1E6OH 1NKGA 4FQXB 4GFTB 5CZVH 4ZX3A 2Q7YB 4F7TB 1JPFB 2J1XA 1IGIH 2ZOUA 4XNBA 1BIIB 3RWDB 4XPAL 5ABAA 5A16A 4FL4C 5EO0B 1OAXL 2HCZX 2DPKA 4KI5D 4Y5VA 4J3TA 5HYSA 4B27A 2ALWA 3VAEA 2I85A 1HJCA 1U8PA 4ORZC 3S7GA 4PGCA 3L4XA 3KL0A 4EZKA 1I4FA 3FQ2A 1HCYA 5GRUH 2PTTA 4UQAA 3BKJH 5E4OA 5HPOA 2FLMA 1G9NC 5G55A 4HUCA 2OL3A 5J13B 1FJ1B 4N8CH 1J0IA 4AQEB 3AMKA 4N2NA 5DLML 1CXFA 4YBQD 4X7FC 3UG3A 32C2A 4QKTA 3MACL 3D69B 3BT2L 3IKKA 3FFCB 2ZUTA 4N0FB 3GSXB 5FYJE 4BQ6A 4HJ0C 3PGFL 3N85L 2RTTA 4F2EA 1YG9A 4NN7C 3KBPA 1MFDL 5E00B 3FT3A 3KCPA 4W9CC 3JQOB 2WLHA 4IOIB 4PHXA 2G3XA 5DC9B 1JGUH 1F4YL 2X70A 2VL4A 4JFZH 4RGND 4OAWB 3TL5A 5T5FA 3MBXH 5LDUA 4AKPA 3W38A 1RJYA 2R0KL 2AHIA 3VWKB 4XWOD 1E7UA 1QW8A 3ZE0E 3MYJA 1JOIA 3WY3A 3ZPDA 4JKKA 3S5YA 2FJSA 1KYDA 3BEVB 3APMA 5LWYL 3HZKA 5I6XB 3A67H 4YMPA 1TO4A 1B9ZA 1JGVL 1HAWA 3KWWB 3DGCR 5E6IC 3NSDA 1JS4A 2X9YA 3KE0A 3UABA 4Q4IA 2ALAA 1F6FB 3BQVA 4PP1C 3P3TA 5E9DD 1ZEAL 4LB8A 2DBLL 4RRPG 2VDOL 5F93C 3KDMB 3WFEL 5I5IA 4EN3A 1D6EB 1J9RA 1RZ8B 2PWFA 3ECVA 1J5CA 3U7AA 1S7UB 1LP9F 1JL8A 2WXFA 4PJGE 2YQ3A 2AV1B 1VEPA 1DLFH 1OLLA 4AYMC 4PN6A 2OL3L 4UTBL 2LU4A 1LM8V 3RDJA 4J28A 1I1AC 1AANA 1LK3L 3GSVB 5C7XL 4QCIB 1UGKA 2BVUA 3D39E 3KLHD 3ECQA 5D7JD 4CVXB 1TYRA 3SKMA 3W0WB 3EZJB 3PJLA 2NDFA 2N59A 3V6ZA 2P5ED 2NY4B 1TXKA 3KEHA 1WS7A 4HC1H 4AQ8A 5BZDA 2X3BA 4DZ8B 3IK2A 3KWXA 4QYAA 4MQ7A 2O93L 5K9KA 4ZD3H 4Q56A 4WO4B 1JZJA 4YO0A 3L5WB 2YUXA 5ECJE 5ABZA 4PUBH 4V1DE 4QNPF 4P4RA 1IFHH 4JPWH 1S5HB 3HG1E 1RUQL 4KXBA 5CJXA 1A3ZA 2DYRB 2J6EH 2VH5L 3LXBA 4HWZA 3LEYL 2JKNA 2W65A 4Y7OC 1A3QA 4NHCH 3N06B 3IS1X 2ORBH 4PYHA 3UEZA 3UROR 4F8LA 3MRKB 3P73A 1U58A 3NDZE 4B97A 5EU7E 3GT6A 3A24A 1NWOA 1H8SA 1XGPA 1ZPUA 2OCFD 4DKEH 1TZHB 2FSEA 2F68X 5FM5O 3MLRL 3UYPB 3ARED 1U8PB 2BFGA 2P5EA 4N85A 2Y36L 1LEIB 4J3SA 3CDYA 1LO4H 3ZL2A 3MPCA 1U8NA 1U33A 5ENWB 2V2XA 2XWRA 3DVNA 2V9RA 2Y07H 3NCBB 4FFZH 1TSRA 3G5ZA 2ADJB 4TUKH 5T1LD 5BOZG 1ORQA 3AQZA 3QEGH 4MJHA 3P2TA 4MZ2A 3SDAD 3WLWD 1FO0B 3EUDA 4JZNB 1JHTB 3GEFA 1PFOA 1MCFA 3ZLQC 1O6SB 1A4JA 3VXME 5DO8A 4R97B 4Z7QE 2JB6A 3O8XB 4OM1H 3PAZA 5EO0A 4P3CL 4YGAB 5KS9B 1YJDH 4IGBD 1XF3B 4YNYA 5HHNB 2R0KH 3CV5A 3ZDZE 5D7SL 2EE9A 3MMEB 4MA7L 4WI9A 2Z4QB 3OXRA 5DFAA 4PJHE 2YSSA 3K5SA 3BGMB 5C0CA 5BJTB 4ANXA 4XC3L 4NP4H 4PJGA 1KLFA 2GIMA 4PAZA 5E03A 2VDRB 5AVRB 1UM6H 4PVMA 4W6XB 2KZBA 5FGCE 5C6PB 4JLRB 3FJTA 4OIIL 3A23A 3VSVA 3BVUA 1I7RB 1AY1L 1WE5A 4TQEH 1E43A 2RGSA 2B8OT 2MOQA 5HDQH 2EDHA 2BP8A 3H4FA 5TDOA 1JNNH 1T7VA 4F7PA 1X7QA 4OW6A 4S0SD 5TQ0H 5E9DA 2WQ8A 1U58B 2NMSA 4HIJB 1GW6A 1UADC 2BY3A 5D4HA 4OZHB 4UOQA 2YD5A 4IBVA 3W5NA 2EIBA 2Y22A 2MH4A 1WFOA 2GIXA 3VD1A 5DEZA 1TO5A 4HLJA 1IC5H 4MMZB 4N20A 3X3FL 3ARZA 3BWUC 1NCUA 4U1LB 3ZDZF 4BUGA 2CRYA 4KK5C 1PDKA 2ENSA 5F8RC 4NLHA 3NCJL 2WQXA 4L3ED 4Y4KA 3FTUA 3ULVC 4Z3FA 4FLSA 5AYTA 4WQOA 5IMKA 4K5MA 5BXFA 1OSZB 1M3IA 1XGTB 2CPUA 2JE8A 3IJ9A 4V2CB 5FYLE 2HT4C 5C0AA 3MLYL 2E27H 3OKDB 3QDGB 4F58L 4C57C 5JW5B 2IANA 1PG7X 1TLMA 1ZA6A 2I24N 4XPBH 4GS7B 3B7YA 1WO2A 4B53A 4HOXA 1CICA 5T3ZE 15C8L 1QSFB 2YD2A 5HYQB 1V3JA 1B4LA 3HJEA 4KVPA 2XWDA 5I9QB 3DIFB 2IG2L 4CDHA 2OJZL 3IFOA 3UJJL 5KYUB 4PRNA 1HTYA 5B39G 3TO4C 3OKMA 1WT5A 5CBEA 1IGCL 4BFFA 4DP7X 3RVUC 4UT6H 3OJ2C 4QT5B 4Z8FH 3VXTB 1ZLWH 2DQUL 3F12B 4TPRH 2AK4B 3B5GA 5CXPA 1ZANL 1D6EA 1BXXA 2V17L 3JWNC 4MB1A 4EPSA 1DZ0A 3PG2A 1FYTD 4HJUA 2LGNA 1GHFL 2C8NA 3NEEA 4V1DD 1MCKA 1PGRB 4JFXA 5AOZA 4KROC 2EKSA 3QARA 4FL4B 4D0BA 3GMLA 3SQBA 5F1IA 4MCYA 1QNZL 2R69L 3GPEA 3K2MC 4U3SB 5F1NA 1T1YB 3UTZA 3GSRA 3V2AR 4TVPL 2FX9L 3HRZC 4XMTA 5F7NC 5AD0B 4QHUB 4JO4H 1SBSL 3D2UA 3ML9A 1L9QA 2ESV