3RYTC

The plexin a1 intracellular region in complex with rac1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
175
structure length
174
Chain Sequence
QAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Plexins Are GTPase-Activating Proteins for Rap and Are Activated by Induced Dimerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Plexin-A1
total genus 38
structure length 174
sequence length 175
ec nomenclature
pdb deposition date 2011-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rytC00
3Q7PA 3LVRE 1NL3A 5EXXA 3TLXA 3E1SA 4NYIR 4HLUC 2VL7A 1Q1EA 4ZCLA 1Z6AA 3UK6A 5E95A 4DJTA 5JS7A 2F1RA 1SVMA 3M6AA 2HYIC 4CEJB 2DCUA 3ZQJA 1I4TD 2VP9A 2Q6TA 1DS6A 3S1AA 2PBRA 4JBWA 3OZXA 4KITB 4D4KA 1KSJA 1SKQA 3CR8A 4FD2A 4LC0A 2VRWA 1F48A 2CDNA 3DZDA 2NIPA 5IK2D 2GHIA 2QT1A 2OHFA 4P31A 1F2UB 4MH0R 3KTAA 3G82C 1EFHA 3IPXA 4W5WA 1O87A 2VHCA 1A2KC 1J2JA 4MYCA 5FTLA 4UKDA 1T3SA 4UXIA 3KDSE 1E9AA 4K8OA 3ICEA 2A78A 2QN6A 2WSSA 5DO9A 4WXPA 1Q44A 3OIYA 4OJKA 2GAAA 1W0KA 2WWIA 1G5RA 3KTAB 3PENA 4OI4A 3UG6A 2RGDA 4CEHA 3FFAA 4AY2A 1CJMA 4ABYA 1II0A 2UKDA 4QNMA 3RABA 2JLXA 2G0TA 2OXCA 2BMJA 1S96A 4BQSA 3SBEA 3VR4A 5HCIA 3K09C 2AKYA 2F55A 4HYYA 4Q7LA 3CZPA 1DELA 1HEIA 2ZS7A 4DLWA 4XVUA 2GXAA 4JJKA 1T3LA 2JAQA 2XZOA 3QF4A 3U3KA 1WE2A 2G1KA 2DYKA 1G4UR 5EUQB 3A4LA 1RYHA 4PHTA 3QXJA 4OK6A 1G3QA 3O8RA 3B78A 2V6IA 1EFTA 2V8OA 3PCRB 2XX3A 2CHQA 1U81A 3LVQE 2RGNA 1IXZA 1DADA 2C96A 4BFXA 1G7SA 3EA0A 3RS0A 4MRNA 2ZYUX 3B8HA 3AF1A 5B30A 1NN3A 1ZUIA 3ONWA 4P4SA 5CJ2A 3W8NA 3WNDA 2BJWA 1NBMD 3D7MA 4K81B 3ZVLA 1VHTA 3Q72A 1W5SA 4KBFA 1HT2E 3AKCA 2V1XA 1A1VA 5JRJA 4PC2A 1Q22A 1TF7A 4DXAA 2QZ4A 3HR8A 4LGMA 4B76A 4LV5B 1B0UA 1B23P 2AR7A 3TRFA 1JJ7A 2V9PA 4DSNA 2BCJQ 2C78A 4B35A 4JVMA 2NTYC 1GL6A 2NO0A 3PEVA 4KHZA 1OH7A 4G01B 2EWVA 4PX9A 4TQAA 2ANCA 4LK2A 2ZUDA 1E2IA 1OIWA 1TQDA 4YONB 821PA 4HLUA 2FN4A 1TADA 1UPTA 3R9WA 1R0ZA 4D0LB 2ZYWX 4LPSA 4ACAA 1HE8B 3U44B 1XJ0A 1N6OA 2OFWA 1HT1E 4LZZA 2J5XA 3TVDA 2GCOB 4QGFA 2JJ2A 3GJ6A 1N6IA 1BO6A 1ZINA 3TUZC 4C0QC 2J0UB 3L82B 4ZV4A 1G3UA 1KAGA 2QQ0A 5KSYA 2GJ9A 3SZRA 3MSXA 1T3HA 3UATA 1U2RA 2XXAA 1OIVA 4TL7A 1G7TA 3NC1C 3H86A 4Q4AB 4NMMA 5DYGA 3K0AA 5EUMA 1Q20A 3AKEA 5IDVA 1VCMA 2HCJB 2OCAA 2BBWA 1X1SA 2XNSA 4F4JA 2KWIA 2BMFA 4LBWA 2ZR0A 2FWRA 3M4YA 2XAUA 3FHTA 1KJYA 4B33A 3CPHA 4TYQA 2P67A 2IC5A 4B71A 3W6NA 2GEVA 1P2SA 1ZCBA 1XEWY 1UBCA 2BIFA 4V0LA 3A58B 1XCMA 5EXSA 3B9PA 1OYWA 1YQTA 3WHLA 2C95A 1H8HD 3FYHA 2W00A 2H57A 2OEPA 1COWA 3PR1A 4HLCA 4B3FX 4OBEA 4QOSA 4BRWA 2Z4SA 4GOXA 2QMOA 2RHMA 1H8ED 1CXZA 1RJ9A 4EPTA 4LV8B 4QBFA 5C4MA 1GL7A 1YZUA 5M04A 3WP1B 1M2OB 1MH1A 3A1UA 4XTCS 4Q21A 3DZ8A 3VNUA 1DO2A 2IA5A 5FBQB 3HYTA 2B8WA 3AGPA 1TMKA 4PTLA 4Q03A 4E03A 3EAQA 1CJVC 1LB1B 4TYWA 2QNRA 1CU1A 2ZVPX 1VYTA 4HB2A 4HB4A 5C2JB 2FFQA 4ESHA 4KFSA 1NN1A 2JDID 1TNDA 1PLJA 2AK3A 1AS3A 4AI6A 2OV2A 3B85A 3LLUA 1NP6A 3IEUA 3VNVA 5TY0A 4LJ7A 2YWEA 3GEIA 1JR3A 2EW1A 1N6RA 3EASA 2DFTA 4R9UC 4NONA 1E9EA 3EZ7A 5TVKA 3UANA 2IYZA 1XU4A 4LYFA 3SYLA 2AWNA 4JBXA 5AWFC 1IXSB 4AD8A 1RRCA 4B43A 1XZPA 4KBGA 1KK0A 5L3RA 4CEJA 2ZSFA 4IOLA 2ZI7A 5KPJA 4TSFD 2EFCB 3W6PA 3IDQA 1EX7A 4FMDB 1WP9A 4RSGA 3AVQA 1BKDR 4HAUA 1XNJA 3MGCA 2HJVA 1X8JA 1KGDA 4KVGA 3FDIA 2UZ3A 5G41A 1ZVQA 2WWHA 2AD5A 1XD2B 4F4CA 1ZU4A 3DVLA 1XPOA 5E7IA 4LHXA 3VTKA 2IS2A 2HUPA 4KCGA 4AKIA 3X2SA 1QF9A 2A5GA 2XSZD 4GOKA 2XTZA 3HPQA 1O3YA 1NI3A 1XTKA 1VCNA 4WVFA 3OEHA 1YHNA 2ZQ5A 2BMEA 1QHNA 2CCJA 4ARZB 5IHPA 5GADl 2PZFA 1KI2A 2CEAA 2PZEA 1G5TA 3Q85A 2BCGY 3IIJA 4LUCA 1VCIA 2QAGC 4E07A 1Q0UA 3CNLA 1T5IA 2N1BA 1XBTA 3O8DA 3ZVRA 4UNRA 1FZQA 1VDZA 1GITA 4IOKA 5A5GA 2PJRA 1J70A 3AF4A 5FPSA 4D6PA 1ZM3A 3SJCA 3SHFA 1NMYA 1P5ZB 2W2TA 4FW9A 4YQFA 3U3RA 4M0LA 5LBIA 4QGGA 4FI3C 3ZD6A 4L5BA 4I81A 4F7WA 4V0MA 3AVYA 3O47A 4EAQA 5JI3E 3SFZA 2IWRA 1VIAA 1TTTA 3T35A 3AUYA 1XB2A 1KK3A 3QQ5A 1KMHB 4W9MC 4Q4JB 3Q3JB 1P2VA 3CM0A 2VO1A 1W36C 1DE0A 4JT2A 4PO8A 3ZGXA 4KJZA 3QKSB 2ZETA 4C30A 3H4MA 2PX3A 1D5CA 1E2QA 2C99A 1YRAA 2J7PD 4A0HA 2ODBA 2XOKA 2ZJOA 4JLKA 3RS5A 2DR3A 1MABA 5AUQA 4EPVA 4BZPA 3A1VA 3UMRA 2XNDD 1K5GA 1S4QA 2JEOA 2OBNA 3ZJYA 4FMCB 3QVVA 1CEEA 3C7KA 4PO9A 2VHUA 3I32A 4TT3A 1ZBDA 2GVDC 4YC7A 2IYQA 3B5JA 4QGAA 4AYXA 1GRQA 3PFIA 2NPIA 4DUGA 5L3QA 1XTSA 2IS1A 3RANA 1EWQA 1N6PA 5LD2B 5CIQA 1LS1A 1C4OA 1SXJD 4RVCA 5KNDA 5KUTA 1S9DA 2D3WA 4BFSA 1E69A 2IF2A 3QBVA 1YE8A 1XMVA 1XPUA 2J87A 3KKMA 3OIWA 5FBRB 1F6BA 4FIDA 1MO4A 3EIQA 2NG1A 1AM4D 2R6GA 3REGA 2N46A 4DCUA 3QPVA 4EUNA 1KI9A 2ZSBA 1VYUA 3L43A 1SXJA 1HTWA 2ZAOA 4L9WA 2O8FB 2QG6A 5TMPA 3RRZA 1E79D 1P9NA 3SEAA 2PJZA 3CWQA 3L0OA 1U8YA 4E5UA 1EFCA 4QG7A 4V0NA 3L8ZA 3FMFA 4NL4H 5DIFA 1AQYA 3BIFA 1ELOA 1OXUA 1OF1A 2A9KA 1XMIA 3N2IA 4IDHA 1IJFA 2B8TA 2CL0X 2ZSAA 2FH5B 4PHGA 2EYQA 2QAGA 3LO5A 1NMXA 4Q1EA 2FMXA 1W46A 3A1WA 5AJWA 1RIFA 3AV0B 1MO5A 1Z6XA 4KFTA 3UWKA 3DMDA 2QP3A 5DGXA 5L3VA 2G6BA 3CWZA 2ZJBA 1FX0A 4Q02A 2VF7A 2AKAB 4XSHA 3V4RA 1WBDA 3SHWA 4B2PA 3I8XA 2XEXA 4URUR 2V54A 2JATA 4XOIA 1YU9A 2OLKA 1HURA 4I99A 4I1UA 2PCJA 4LJ8A 2CVHA 3KKNA 2A2ZA 4IOJA 2XNDA 1R6BX 4CW7A 1E9CA 1M1YE 1RC8A 4Q1AA 4LBVA 1WXQA 3ZLJA 2AWOA 1R8SA 3NBYC 1A5TA 4G0NA 1SQ5A 1U8ZA 1KO7A 3A1TA 2QPOA 4Q7MB 2XZPA 2AD1A 4HDOB 4HB0A 4CT4B 3KJIA 2PMDA 2RGAA 2QM7A 3A37A 5FUVA 4DCVA 3KUCA 2H7VA 2HEIA 2ZYTX 1T9HA 3BGWA 2IWHA 5EP2A 3GLGB 2FEOA 3F0TA 2FPMA 521PA 3W6OA 721PA 1XJQA 4HAWA 2DWQA 3KJGA 2OCPA 1R5BA 4WZAE 3RS3A 2IYXA 1QHXA 3VAAA 3U7HB 2CE7A 4TMXA 2YINC 2DWPA 3ZH9B 1NKTA 1XDBA 5KHOC 1KO8A 4LHYA 5KSPA 1OHHA 3NKVA 4DCSA 2XSZA 5JHHB 2P5TB 3KFXA 1L4YA 2D06A 5JSZA 3T15A 5KSOA 1CBUA 2GXQA 2VSFA 1KJZA 4DLRA 1D6JA 1YZQA 3P27A 4N1AA 1DAEA 1E96A 5EP4A 3TUIC 5JHGB 2O8CB 5CM9C 3RWMB 4B48A 3IUYA 3RLFA 3RRNA 3ZS9A 4KODA 3EZ2A 3GLGA 4X8OA 1R0YA 1P73A 2CLSA 3CX7A 3C5HA 1JQLB 1SXJC 4CT5A 4PZYA 3U6KA 1OSNA 4MQBA 4TZ6A 4BFVA 4A8JB 2DFLA 2HF9A 5CJPA 5J47A 3EWSA 4S35A 1RRPA 4C7OA 1LS6A 3KB2A 4WIAA 4P33A 4G5RA 3ADKA 4PZZA 3KQLA 5D3MA 3SYKA 3IIMA 4YMVA 4TYNA 3QEJA 5FUXA 2Q9AA 1OE0A 3WBJA 4OHYA 4KVAA 3AKYA 4M8NE 3CO5A 4O3MA 5FFMA 2B92A 4HAXA 1Z6YA 1UEIA 1G20E 2YKGA 1W1WA 2QPTA 4WOPA 3HPRA 1K6MA 4DSUA 4Q7KA 2WBLC 5CYOA 3RSOA 4LJ4A 4DC9A 1G3MA 1N0WA 4BWYA 5JCZA 4RD1A 1D2MA 5EXTA 1WBBA 3ZYCA 1G21E 4RFSA 3DKPA 2OE2A 3UPUA 4Q4AA 2J1LA 4OYHA 3QJYA 3OAAA 2K5UA 4QBGB 1SZPA 3WYFA 3JVVA 1CF4A 1GZSA 2NZJA 2I1VB 1ZNZA 2ORIA 3LXRA 2FPLA 1KK2A 5C1BA 4IXMA 2YHSA 2FSIA 3WNCA 1KO5A 1FP7A 2ZVQX 4CEHB 1W36B 4L8GA 3MWLA 4V03A 2ANBA 1ZU5A 3TAUA 3LW8A 1J99A 1HA3A 2FSHA 2R62A 1XCGB 1PUJA 1CP2A 3DDCA 1EFUA 2Z6VA 4PHHA 5GVRA 5CITA 3OFND 4HZUB 4Q1CA 1E0JA 5KNCA 2HLDA 2QE7A 1TU3A 2QROA 2MMGA 4PAOA 1G18A 5FOWA 5F9FA 4NTZA 3CRW1 4JVSB 3I72A 2EQBA 2OSBA 3KKOA 1XRJA 5B2ZA 2O8BA 2Z83A 5DN6D 2GNOA 3CX8A 3ZS8A 2WJGA 1RYFA 1IY2A 3RAPR 3LBIA 1Z0DA 2WWXA 3LAWA 1E2PA 2QUZA 4PXAA 1R2QA 3U7GA 2OFOA 5L3SB 2IEYA 2R6CA 3G5UA 2IUTA 1NVWQ 1SKYB 1TU4A 3Q7QA 4OJQA 3RRYA 5IRCD 5AJZA 1YR7A 3KKPA 4JLAA 1RFLA 1E2MA 3AVTA 2C04A 1TUIA 2FU5C 1RW4A 4MITA 1CIPA 5JLJA 3H2YA 4JLJA 4M1OA 4QC2A 4F91B 1C9KA 3KKQA 1HUQA 4UXHA 1XF9A 5BYJA 3WY9A 2ZUCA 3IGFA 4R98A 4HB3A 2R44A 2CLDX 2XJ9A 2AX4A 3VHXA 1XZQA 4GOJA 4B3XA 2NO1A 4C0LA 2R6FA 5B57C 2ZITA 1ZW6A 2G0NA 1IN8A 1ZP6A 3OIVA 2JJ2D 1AN0A 2QP9X 2VQSA 2ZRPA 2ZJ2A 1T8UA 2EFGA 4H1UA 3BOSA 3HU3A 4DHEA 1FW6A 3OE7D 1DVRA 4BFWA 4HI0E 4ZDIA 2IHBA 4US0R 2WAYA 1M34E 2JLQA 2IX3A 3NDPA 2ZREA 2FF7A 1G7CA 2QORA 3OESA 3VX4A 3CRRA 3EARA 3EC1A 1OH5A 2Q3HA 2W83A 5F9HA 1YZLA 2O8CA 4DSOA 4FMCF 1P3JA 3B82A 5HCNA 5AK0A 3Q5DA 2AK2A 1MKYA 2E87A 1SKYE 2XTNA 1MOZA 4S2EA 3TK1A 1LF5A 3QKRA 1N5LA 2ZRGA 3UXMA 1IN6A 5H1YA 2Z43A 2ZR9A 2ZE8A 3ZDQA 2YWHA 2O8DB 3LX8A 2OXRA 2WJIA 2IW3A 2V3CC 2WZQA 4Z8YA 5L3QB 3SJBA 1W4BA 2CJWA 2FGKA 2C8VA 5LPNA 3U60B 4FCWA 2WVJA 4N0DA 4A15A 1E79A 3PUZA 1Z6TA 1JBKA 3WRXC 1W0KD 4JT4A 2GJ8A 4IOMA 2OFXA 4AC9A 3WYAA 4DCNA 2XJ4A 3V4FA 3J81k 4MRPA 3U4QA 2YJTD 1FQKA 4DCTA 5FTMA 1KI6B 1ZC4A 5H8WA 1Q1QA 2OCBA 3RS4A 4OQLA 2FDCA 2QBYB 3NIBA 1Z2AA 2G3YA 4Q4HB 4DEYA 1JAHA 3EIEA 2P5SA 3VKGA 1E0SA 2JCSA 3IBYA 2IHYA 3E2IA 4QM7A 5H70A 1OFHA 2B7CA 4Y0AA 3T1OA 1GNPA 4F92B 2QA5A 4D26A 4DUGD 2ODNA 4DLYA 4QHYA 3AP3A 3UKDA 2WKPA 1ZD9A 4NYJQ 2UZIR 2WKRA 3ETLA 3SDZA 4EKDA 2J0SA 3AVXA 3MRSA 3I3SR 1JPNA 1NVXQ 1UKEA 4L15A 1IBRA 3JVUA 3BRWD 2QL6A 3C8UA 5BN4A 4WA7A 2FFHA 4PO1A 3I62A 2J45A 2W0MA 3PUXA 5EE9A 2IUUA 4E09A 3ND8A 1T91A 1G16A 2Z5FA 1FQJA 4AKGA 3KJEA 3QIAA 2D74A 2BM1A 4GRAA 3CH5A 3A36A 1S0UA 2WPDD 1MV5A 3GLHB 1DAIA 1OB2A 4OHZA 1A82A 3WBKA 2GBLC 1G19A 1AZTA 1RJ9B 1FMLA 3AVVA 2N42A 1L2TA 2GZAA 4POAA 2CK3A 5IF9A 2JLUA 2W6ID 3BFVA 2KBFA 1OFUX 2O8EB 1ZIPA 2IYTA 2ZRNA 4ZIRB 4UNNA 2JASA 4RD4A 1GKIA 1BOFA 2OBLA 4ERNA 1F2UA 1YZKA 3I1FA 5A4JA 1IHUA 4TTQA 2YOFA 3DHWC 3AVUA 5AJXA 2ASEA 1N5KA 3JZMA 5EP1A 4ZO4A 2P0EA 2BC9A 3LLMA 1UJ2A 5KYKA 1NBME 2ZE7A 1U0HC 3CRVA 3CZQA 1S3SA 2VBCA 3GLHA 3N5CA 2GZDA 4HSEA 4OI1A 3UMSA 4IFBA 3PEWA 1WB9A 1FX0B 2GTPA 2VHJA 1KKMA 1Z08A 3A4NA 3NH6A 2RB4A 1UF9A 1Z0AA 2F43B 3GJ5A 4OK5A 2IF0A 4Q47A 1S1CA 4PSAA 1BIFA 2QRZA 3D3QA 1VG9B 5GVSA 1GP2A 2ZRFA 3PUVA 1VECA 4LJYA 1NLFA 4ZPXA 4JVNA 4WZBE 4X8LA 4F4IA 1A4RA 5DNYB 1KNXA 2RGNC 2ZI6A 3QSYA 1JALA 1SVSA 1DAKA 2VHTA 4JLPA 4Q1FA 1GSIA 1DO0A 3LD9A 4PC7A 4IVRA 2WMOB 3QBTA 5EJEA 3S1AB 4EFLA 3GEHA 1VMAA 2QEQA 1Z5ZA 2B7BA 2CMKA 2GBLA 3KX2A 5AJYA 5BYKA 1ZMXA 4BE7B 2AXPA 1KMHA 2ZRKA 3GLFA 4C0HA 1R10A 2FSFA 1NG9A 3L8YA 3M0EA 2UVQA 1HV8A 1JJVA 2BEJA 3W5JA 1M74A 3TQCA 3AVPA 3NXSA 4OHXA 2DB3A 1NMZA 3IO5A 2C03A 3NC0C 5K8TA 3O8CA 1GNRA 3RDPA 5AUOB 1WDTA 1X3SA 2JLYA 3K0AB 4KYIB 3CH4B 4M22A 3SR0A 1BYIA 3U7FB 2PEYA 1GM5A 1BS1A 1K8RA 2WM9B 3LA6A 5J4HA 4V02A 2F1JA 2NGRA 4CDGA 1OXTA 2PT7A 3RC8A 4I1SA 2Q0HA 4JSTA 2W6JD 1XX6A 2GK6A 1ETUA 4ZDWA 1KOFA 1P4SA 2Q9CA 1SHKA 1V5WA 3EPLA 3C14C 4O2LA 3CF6R 3VHLB 1E98A 4ARZA 4MDEA 1EWRA 1S1MA 2KB0A 4IDPA 2E9SA 3CRQA 2ERXA 3BFXA 4M1SA 3VFDA 4RFVA 4HZUA 2PMKA 4G5QA 3F8TA 4AK9A 4ASUD 3SU8A 2ZE5A 3AVOA 1Z3IX 3GPLA 3L2OB 2VP6A 3LQQA 2G1JA 5EE3A 5EZ6B 3WRYC 3U61B 1QDEA 3OHMA 2GK7A 3AGQA 2R6DA 4B3CA 2BBSA 5KU1A 1XEXA 2BJVA 2QY9A 4I1OA 4QJ3A 4CIDA 3WXMA 2KI5A 4TZ0A 3FTQA 3VR3A 4RY2A 2ZTSA 4URVR 5H68A 2HXSA 1D8TA 3P20A 1ZJ6A 5G53C 2V1UA 1NN0A 1M7HA 1F2TB 5FPYA 2GEDA 1T0HB 3QOFA 4B32A 4MGKR 4IHQA 2J7PA 3VR2A 1E3MA 2IYVA 5KPDA 2QGZA 4LYHA 1G9XA 2W58A 4EJSA 3F3YA 3D31A 1Q3TA 3FKSD 4JJZA 3RVBA 4R2HA 1DAHA 3KQKA 5BN3A 4Z8XA 2WWYA 2PH1A 5DI3A 3GJ8A 2X1VA 5FR1A 6Q21A 2GESA 3QEOA 3KQNA 1ZC3A 5BW8A 1W44A 3LQRA 1Q57A 4IDQA 4DLXA 2A5YB 3AP1A 4ZKDA 2XGJA 1U0JA 3FMOB 2BVNA 4UNQA 3TR5A 3ZZ0A 3M1IA 2ODEA 3GQBA 1SHZA 2W6IA 2FG5A 3LDAA 4KV9A 2I1QA 4C2TA 1A2BA 2CK3D 4PAQA 2ATXA 5CB8A 1US8B 2O0JA 1E9FA 2BBOA 3Q8XB 4BLPA 2QTHA 3K8YA 1QHHB 2NO9A 3O8BA 4Q01A 4C0BA 1MO3A 4P4TA 2GJAA 1N5JA 3IQWA 4RZ3A 2F3RA 1Z22A 3B1YA 1JPJA 1GRRA 2ZSDA 5FPTA 4DIEA 3BERA 5K8IA 2EFHB 1ZNYA 2ZAMA 4GBMA 4LJAA 3BE4A 1M8PA 3MMPA 4UJ5A 2Z0MA 4OQXA 2ZROA 2OLJA 3T1TA 3RS7A 2XITA 3AQ4A 4HAYA 3X1DA 2ZJAA 2NMVA 2BWJA 1EGAA 5ANRB 2ZJ8A 2ZSEA 2ZE6A 4QGHA 5KTYA 3IEVA 3EPHA 2ZJZA 3D6TB 2ORWA 3OIUA 5KOYA 5JFGA 4K46A 2RKOA 4TSFA 5JJKA 1BMFA 2G9NA 3QNUA 1VIYA 3QE0A 1G8GA 5TDHA 4NZYA 1G6HA 5BWMA 4IEEA 4C2UA 1FTSA 4ACBA 3BD9A 4MKFA 2OBMA 1MRNA 1N2CE 1R8QA 2A5DA 2FFAA 2D7DA 3VKHA 3TKLA 1ZM9A 2PLRA 4AYTA 5DLQC 1XD8A 3CF0A 3EG5A 2J3EA 3K0FA 1W0JA 1VTKA 4XWOA 1II8B 5CDFE 2AHOA 2QT0A 5JWOA 3WHKA 3BFKA 2GF0A 1E2KA 1W0JD 5JS8A 1GG2A 2C2HA 1NG1A 1P62B 1XCPA 4I1VA 1OXVA 1UBGA 5FOTA 1N0UA 4DSTA 4M9SA 3TVTA 1OV4A 3BWDD 2IXEA 3CLVA 3FMIA 5J5CA 4OKSA 5K8LA 1E2GA 1SVLA 1T5LA 1YR9A 1OKKD 2CNWD 3BBPA 5A0FA 3C16C 4C0JA 1SXJE 1Z0IA 3EXAA 4TMVA 4GFDA 2KJQA 3EX7C 2WIAA 2QAJA 1VCOA 1DPFA 1QRAA 3THWA 2GXSA 2HXYA 2SHKA 2NPFA 4A1FA 4YDSA 4ZCMA 1XD9A 2ZI3A 4QHTA 3DMNA 3X1XA 1IY0A 4IDNA 1IJEA 3MWYW 5HE8A 1OXXK 3NEYA 1OH8A 2GCOA 3U3JA 3H1TA 4O0MA 2QSZA 1D2EA 1II8A 2G88A 2WJYA 5JI2E 4PPNA 2WV9A 1ZUHA 121PA 5D3MB 1I4LD 1P2UA 1F2TA 2JGNA 3RRMA 1KY2A 1RZ3A 4GP7A 4M2LA 2XOKD 3G0HA 2ZRDA 3I61A 1XD2A 3OE7A 4M1YA 4Y0VA 3WNBA 4TLEA 2WAXA 4Q1DA 3JZAA 5DE3A 4EPWA 1G8PA 4DT1A 3DO6A 4BLQA 4W7SA 4Q9IA 5F3WB 3LWNA 1M6NA 4X8HA 4TWZA 4BZXA 2Q9BA 3KZ1E 4EFMA 2ZYVX 3LY5A 1E1RD 2FA9A 4NYIQ 4MDFA 2FPKA 3CF2A 4NCIA 1W4AA 2ZJYA 5FL7A 2HT6A 4MKIA 2GDJA 4DLTA 2C98A 3MJRA 2JLWA 2XXAB 2LKDA 3P4XA 1S2MA 5P21A 4MKGA 2AN9A 4RD3A 1JECA 1JEDA 4TLCA 4MGIR 3MWKA 1E2LA 1AGPA 1L8QA 2WSMA 3F5FA 4BLTA 1FPMA 2FX3A 1AGRA 2CCKA 4LBYA 3THWB 1N6NA 2REOA 2VP2A 3B6EA 2DWOA 2NO6A 4R7ZA 5GJCA 4D2IA 3CPEA 3QG5A 3BC1A 4IDOA 3GLIB 2X2FA 4B3DA 3NBZC 1QHHA 1J7KA 4MYHA 4MYUA 4TL6A 3KQHA 2BEKA 1ZUNB 3P1JA 4H9GA 4NCNA 2FEMA 3TH5A 1HY3A 3SQXA 4B3BA 1J8YF 2KBEA 2PCLA 1KHTA 4JS0A 3FKQA 2QENA 1X8LA 4IXNA 3AF2A 3R7WB 2D62A 1E9BA 4JLMA 3TR0A 3KL4A 3FOZA 1KK1A 3THYB 2ZRIA 2E1RA 1Z83A 4DVGA 1DG3A 2REXB 3R8CA 1TUEA 1Z06A 1UBFA 1YKSA 3MJHA 4BFUA 3ZD7A 3ZVMA 2CJWB 3T1QA 3X1ZA 3ICQB 2W6JA 2A3RA 2O5VA 1DAGA 1WCV1 3SC3A 4DLSA 4MA4A 2DFNA 1CJKC 4DIDA 5KDOA 3P4YA 1UDXA 1J8MF 1U8AA 4FMBB 4UXJA 2WWFA 4BASA 2ZUBA 1KDOA 2F9LA 3UMFA 4IKEA 4RKEA 4HUQA 2C5LA 2F6RA 3N2EA 3PUWA 5FPKA 1NJFA 3KXKA 1JNYA 2A5FA 5FUYA 1N25A 1W4CA 1JQJC 3W9YA 1BMFD 1MR3F 2JJ1D 2NQ2C 2EFEB 2YNMA 3AKDA 4DLZA 3CW2A 3T12A 1Q12A 1Y63A 1G5PA 4EQ6A 5HZKA 1Z8FA 2BM0A 1IY1A 1W47A 2LCFA 2J0UA 2WOOA 1ZNXA 4ESVA 3A6PC 4TT3D 3VR1A 2WTUA 3HDTA 4M4SA 4GPTA 4WW0A 2O8FA 1M7BA 4YLGA 2W2VA 4DKXA 4FCTA 5E3HA 4Q9JA 2GKSA 1R4AA 4Z51A 1UEJA 4QRHA 4LDJA 4TYYA 3PXGA 5KSZA 1XMJA 4A6PA 3H84A 1ZCAA 3IHWA 2J7KA 4IEIA 3U5ZB 3FWYA 2D2EA 4A0RA 1P72A 1AS0A 3WP0A 1GNQA 2CXXA 3AP2A 4DZZA 4Z54A 2GWHA 3GD7A 2CHVA 3NHBA 2ERYA 1Z6GA 4AG5A 5EQTA 1UADA 2JA1A 3L0PA 4LOAA 4JLNA 4V0OA 3X1YA 3I73A 3MG9A 4L9SA 2IL1A 2GAOA 5L3SA 3MCAA 3WMGA 4JYBA 2QSYA 4M9XA 1Z0JA 5L8VA 4HEJA 3SBDA 1G1MA 3THYA 1CJTC 3THXB 4OL0A 4NBSA 1ZYUA 2L0XA 4PQRA 4CEIB 1AS2A 1AK2A 3ZIAD 1E2HA 1N0VC 4JLBA 1IOZA 2OM2A 4OHVA 4NYMQ 3DM5A 3SN6A 2GVZC 2O52A 4GSYA 5G3ZA 1ZNWA 1ODFA 2DFKB 5J4KA 2H8KA 5FTNA 3MUFA 1L7VC 2WICA 3TMKA 1P2TA 2V7QD 3EC2A 2VSXA 4LJ5A 1YZGA 3ZIAA 1VKJA 3SFVA 2HCBA 4PC1A 4YMUA 4LX0A 1T6NA 3LFUA 5KNBA 4DDWA 4DDVA 1E32A 2OG2A 2W2XA 3EW9A 2QQEA 3MD0A 1GRNA 1JI0A 3NEJA 2X19A 1KTVA 3QKRB 3T5DA 1KI4A 1NBMA 5EZ5A 1T4GA 3TQFA 2FOLA 2IT1A 2VP0A 2ZANA 3IIKA 1JAIA 4EQ6B 3EA5A 1OXSC 3B13B 4P0TA 4NPHA 2LKCA 1ZM2A 4Q19A 1NVVR 1FL9A 3FFBA 3QI2A 4BLSA 1WA5A 2F43A 4DWJA 1OFIA 1OYYA 1L4UA 2MSCB 2ZRAA 4XIGS 5FBWB 4LWZA 2EYUA 5FOSA 1F60A 2HV8A 1E9DA 1EXMA 4NDZA 2ECKA 4C9BA 5J40A 2F1HA 1W4RA 3ZQ6A 2XZLA 1QBKC 1X1RA 1II9A 2YOHA 1UKVY 5DI9A 5JECA 3HR7A 4NYMR 3CR7A 4C4PA 1WMSA 4D4LA 3U3MA 4TLAA 2HDNB 3GJ4A 5AUPB 5LD2C 1JR3D 1UKYA 3BB1A 4LJ9A 4JBYA 1GIAA 3PITA 3GFOA 4PANA 3BJIC 5DISB 3KQUA 4TL8A 5LB4A 1E9SA 1G3RA 1YRBA 4TMKA 4IJMA 1HYQA 2RGEA 2JDIA 2RHDA 2RCNA 1KKLA 1XJCA 3FHCB 1SULA 2D2FA 3BAFA 5C4GB 5HKKA 1NJGA 5CM8B 5FOUA 1U90A 621PA 2PZGA 2VA8A 1GFIA 3TBKA 1EG7A 2ZR7A 4BLOA 1DTSA 1W5TA 2FV8A 4RJLA 4BFZA 4Q00A 3FPAA 4KO8A 1KSGA 2OZEA 1KSFX 1ESMA 4XWAA 3D8BA 4XD7A 2ZJ5A 4LJ6A 4B6FA 1Q21A 4JIMA 3AF3A 5FI1B 5B58C 1G17A 2F3TA 2Z4RA 4ZKEA 2C9YA 4A92A 3T5GA 3NDBB 1TF5A 1G291 1KDPA 2CL7X 1N6LA 2ZS9A 4GZLA 4FN5A 2A5JA 3NTUA 4IVQA 5EE1A 4CVNA 1TL7C 1QG2A 4IVPA 4OQMA 3I8SA 3DM9B 2ZXUA 3BXZA 2R65A 2OESA 1XXHE 3HU1A 2O8EA 1EFRD 5JWHA 3KFVA 3E70C 4Q9LA 1IN4A 1G8YA 4JSYA 4PFSA 1HQCA 4TMTA 4TN1A 4XVQA 4P3YA 2P6NA 1SVIA 2WJHA 1US8A 2G83A 4HDCA 4M9QA 4R2IA 3AH8A 3B1WA 1MO6A 1XP8A 4UNPA 3U4QB 1IXRC 2IYUA 1NIJA 2JLSA 4RCZA 3TUJC 1YR8A 4JMPA 4LV6A 3OEEA 1CLUA 1LNZA 4L16A 1IM2A 1KIMA 3VQTA 4BGDA 2C77A 3IO3A 4BFYA 3ZZUA 3WYGA 4ZIRA 5KDDA 3GP8A 1KO4A 1K5DA 4JVLA 3NBXX 1CR4A 1OIXA 2GZHA 3U7EB 2AXNA 2OUKA 4HUTA 2V6JA 5EE5B 1CS4C 3I4LA 5JBQA 4DB4A 4ZCIA 3I5XA 3R20A 3QXSA 4G3XA 2B21A 2HF8A 1CKEA 1GL9B 1OJLA 4UNSA 1GWNA 2WWWA 1N5IA 2WOJA 3U6BA 1TQ6A 3KXLA 4EJSB 3K0EA 1ZM7A 3SYNA 4QBIA 3L0IB 1WQ1R 3W8RA 5C18A 3DEFA 1U98A 3TAHA 1X8KA 1YZNA 4R71A 4YXWD 5JEDA 2IYLD 3IQXA 4MGZR 3IHLA 5B64A 1XTQA 3QKUA 4M53A 2HLDD 4ZI2A 2QBYA 5HTKA 5FBVB 1JXMA 1XTJA 4KAXA 2IYYA 1GTVA 3GLIE 3CNOA 3HWSA 1XEXB 4PZLA 2F1IA 5FPHA 3VKWA 3TE6A 1Z28A 3ADDA 4LHVA 4Q18A 2H18A 2XB4A 2ZRHA 4C0SA 1E0KA 4BPBA 1G7RA 1SXJB 3BH0A 1FNMA 2IUSA 3ND9A 4GZMA 5D3QA 3KJHA 2ZU0C 1D2NA 1W36D 4EPYA 2FGJA 4D81A 3VU9B 1NSFA 1KI3A 1PLLA 1HH4A 1QHIA 4Q4LA 1KI8A 4NCJA 4BRUA 2GXUA 1XTIA 1IONA 3QVUA 1OH6A 4AYWA 5TXGA 1BYUA 1LW7A 3K09A 2BKUA 3UG7A 2WMNB 4BECA 1P75A 2ZU6A 2XB2A 1M7GA 1XFAA 4MUAA 4PSKA 4YMTA 1IN5A 3GEEA 4GNKA 2F9MA 3N70A 1Y3AA 5FOXA 4TMZA 3SNHA 1KYIA 3DOEA 5ELXA 1XXHA 4LHZA 2P6RA 4XD7D 3CX6A 3BB4A 5CB6A 1IQPA 1SVWA 2FZLA 2JJ1A 3GJ3A 4JLDA 4QHSA 4F38A 3K70D 1QHSA 2O8DA 1HQYE 4EJSC 4GT1A 4MRRA 2IS6A 2JJ8A 4KLZA 1GUAA 3QY0A 2QTVB 2VTKA 3K0CC 4UJ3A 5HKKD 2OT3B 3QF4B 2GCNA 3GLFB 5AUNB 2HJGA 1GAJA 3BK7A 4CGZA 1NKSA 1NLZA 4ILEA 4BLRA 3QXCA 4M9ZA 5EXPA 4D4JA 1PV4A 1KI1A 3CB4A 4LY6A 1P61B 4URZR 4QM6A 1UDWA 3T1VA 1AKYA 2YV5A 3VR5A 1H8HA 1XEWX 3QPWA 1GKUB 2LWIA 2VEDA 4PAMA 2RGXA 4LPKA 3B1ZA 3EPJA 1Z0KA 4BFTA 5C46F 4XWKA 1F5NA 3B2EA 1S3GA 2R6AA 2H17A 3W3AA 1OHHD 2YC4C 1TQ2A 3A8TA 4KSCA 2ZRBA 3ADBA 2JIZD 4HUQB 4B2IA 2VP4A 1ZIOA 2IYRA 3HYRA 3K9LA 2GF9A 3EZ6A 2OCYC 1LVGA 3B9QA 4YXWA 3LW7A 5FOVA 2JLZA 1NSTA 2O0KA 3QF7A 3FGNA 5JCPA 3CUEF 3FMPB 221PA 1S8FA 4WXRA 4D4MA 1KNQA 4E22A 5JWRA 4WAUA 1TAGA 4RZUA 3CPJB 1Z47A 4RD2A 1U9IA 2QAGB 3MLEA 4J0QA 4RCYA 5DHFA 4Q4HA 2PLFA 1LY1A 5FI0B 2ONJA 4NYJR 3KXIA 1E2JA 1J90A 1W7AA 4Q5IA 1E2EA 3CNNA 1DOAA 2IK8A 4GMDA 3QKTA 5SZHB 4ON9A 1FTNA 4U5XA 4EPXA 5DN6A 3CBQA 2CLCX 1R0XA 5GJWC 5SZKB 1PUIA 4A0GA 4FWTA 4YMSA 2QRNA 2GETA 3T61A 2RGGA 2FE4A 2ZRJA 2EFDB 4LCBA 3CRMA 4B6EA 2IYSA 4PPGA 1OB5A 3OFNA 4LYJA 1N6KA 5JSZB 1JXOA 1W48A 2FFBA 5G40A 1Z29A 3K53A 4DT1B 2GEUA 3SS8A 3QXHA 4PC6A 1AQUA 1C1YA 1FMJA 1DEKA 2VHQA 2XTMA 3T06B 2Q3MA 4A4DA 2OO7A 3K0CA 1SGWA 1E1QA 5KDLA 3IBGA 2BBTA 1I4DD 2NO7A 3U2QA 1X6VA 2YYZA 4C0KA 2PX0A 1X86B 3GJ7A 4Q1BA 5E7MA 1E4VA 1W2HA 4Q7JB 3GMTA 4RZXA 1GILA 4W5HA 2D7CA 1AZSC 1TEXA 2DPXA 3R8FA 3AM1A 5E4FA 5DHAA 1Q1ZA 3U44A 1GOTA 1EK0A 4Q48A 3K9HA 4A6XA 4RD6A 2QMHA 1BH2A 4OI2A 2QPAA 4QXAA 3PEYA 3Q9LA 3H0KA 4BEJA 4XSGA 1E99A 4M1TA 5LB2A 2REBA 3PIRA 1RKBA 4RZ2A 2WSSD 1EX6A 2WKQA 4O25A 3K9GA 4D25A 4DLUA 4JL8A 4V0KA 4O2RA 2VYFA 5CK5A 4F93B 3HP1A 1DAFA 1CULC 1IAQA 3DKVA 4A8JA 2ZI4A 3HU2A 3EIHA 3K0SA 1RPZA 1CR2A 1WRBA 2J9RA 5J4YA 4MYTA 2IEZA 5JEEA 4A2WA 1V43A 2JLVA 1OPXA 4B75A 3SI7A 1I2MA 1U99A 1TF2A 3TSOA 3C5CA 2OAQ1 4C0AC 3SE0A 4FXPA 2IS4A 1VG0B 1U9IC 3L0SA 5HR5A 3PG5A 4CF7A 1JB1A 5AR1A 4NU0A 4AKHA 4EDHA 3PV0A 4GMXA 1AJEA 1P9RA 2AFIE 3TSZA 4D0NA 3I5YA 1QHGA 3LH5A 2PT5A 4LBZA 4FMDF 2MMCA 1FP6A 3U3OA 3A1SA 1KI7A 4G5SA 4KXFB 4FCVA 1MRSA 1FNNA 4PPQA 4A9AA 3K0FB 2J0QA 4NCHA 3REFA 3T34A 4BZQA 1AIPA 1E4YA 1KZGB 5J4VA 3K9NA 4Z1MA 2VSOA 1YR6A 1NN5A 2EVWX 1JR6A 3QENA 1D9ZA 4DEXA 2FZ4A 1DAMA 3MFYA 4G5OA 2GCPA 4GDFA 5CIWA 1XPRA 3OF5A 2C9OA 2YWFA 2MSEB 2NZ8A 4IRUB 5HZHA 1P7CA 2ONKA 1XEFA 3HJNA 4HAZA 4CRWB 1ANKA 3FE2A 4PQYA 5FTJA 5GJVC 3GLFE 2WJJA 5CLQA 2IYWA 4Q9KA 2BHRA 2Q3FA 4HDQB 1R0WA 1AA9A 2YVUA 1PZNA 3BS4A 2ZEJA 2DHRA 1LFDB 4M21A 4AWXA 4GL2A 2O8BB 1GVNB 1R5OA 2NOAA 4M1WA 2B6HA 4URWR 1ZRHA 1KZ7B 4JL5A 5FL3A 2ZS8A 2P65A 4LSGA 1ZD8A 4KI0A 4BUJA 1NRJB 3B60A 4B47A 4RKFA 1PVOA 1TQ4A 2CE2X 3X1WA 2KE5A 3OEED 1NNEA 1WF3A 4TYPA 1R7RA 1ZAKA 3GLIA 5TB5A 4GI7A 3TNFA 4B74A 2IBMA 4NCKA 4EPRA 1Z63A 4HZIA 4Q4JA 1GDDA 4FWIB 5FTKA 4BEBA 4A2PA 4N0EA 4A82A 3K70C 1W2GA 4EIWA 4OQNA 2JIZA 3RC3A 1QVAA 4CYMA 3V00A 2A30A 3NBFA 1T8TA 3QG1A 1I2DA 1VG8A 5DH9A 3W34A 1Z07A 2V4ZA 1EFRA 1G6OA 2ZI9A 2I3BA 1OKKA 2CNWA 2PEZA 4A8JC 5CLLA 2J46A 1XTRA 4ZDJA 5TV2A 1RVDA 1SVOA 2VF8A 4C3ZA 1XXHB 2VP5A 1Z2CA 2BOVA 3R9XA 1LF0A 5BXQC 4ZDKA 2PL3A 4AKEA 2RAPA 3NVAA 2RH5A 5DI3B 3P32A 1T0JB 1QZXA 3NH9A 2ZRLA 4JZKA 2WWGA 5JJLA 2G77B 1FUKA 3IKJA 1TEVA 2H92A 1FOEB 3AEZA 2P3SA 3WMEA 2QTFA 1P6XA 1OFTA 2V55B 1YJ5A 3B7GA 3BH7A 4H1VA 1Q3HA 4NHOA 4US1R 4DBLC 4PHFA 3ASZA 2VLIA 1W49A 2FNAA 3THOA 3ECCA 2CCGA 3GFTA 4CZ2A 5GJBA 4NKRA 5KO2A 3ZZTA 2X8AA 4QJ4A 1TPZA 4YDHB 1KDTA 1CTQA 4G1UC 1E2NA 3AUXA 1H8EA 1XMSA 3LXXA 4LC1A 1KMQA 4DDUA 4PR0A 1KY3A 4U02A 4PQFA 1KO1A 1NF3A 1E1QD 3UIEA 2C9CA 3E5HA 1G3IA 4G5GA 5CDFA 3VX3A 4AIIA 4N3NA 4M1MA 4Q66C 5BQ5A 4KLNA 1Z0FA 4P4UA 3TW4A 2QP4A 3FB4A 3NWJA 2H1LA 1E6CA 5CK4A 3ADCA 1G64A 2BV3A 3DOFA 4DDTA 4TLBA 4M1KA 2F7SA 2P2LA 1IN7A 2EWWA 3NHAA 3BB3A 1KDRA 3DL0A 1UKZA 4UQOA 4TMWA 4ITRC 4XTRA 1KJWA 2CL6X 3RSLA 1SVKA 2ZRCA 1RRGA 4B44A 4HLDA 1E2FA 2P6UA 4TLDA 1OW3B 1RE0A 1VHLA 4JL6A 3RYTC 4OHWA 5LDDC 2MSDB 4W5JA 2HT1A 2OAP1 2QM8A 4PPFA 5FUWA 1XWIA 5DSZA 4FINA 4P4SB 1NVUQ 3LV8A 3GCGA 1G4AE 1KI6A 2GJKA 3R7WA 5FBLB 3IILA 2QMUA 3KUDA 1F3OA 1N6HA 4AG6A 5FL7D 3FVQA 2V7QA 3LX5A 4II7A 4WZ6A 4DB2A 2ZI5A 1PLKA 1KAOA 5F2EA 2YZ2A 4NE2A 4HAVA 1E1RA 2RMKA 4JLOA 3EZ9A 1S9HA 4QKQA 5JMTA 1CRQA 5HE9A 2X77A 2BKEA 2GJSA 4KFRA 3W3ZB 4JKYA 1FFHA 3BORA 3MAAC 4WBSA 3R9IA 1VG1A 1NIPA 2QI9C 3GLGE 2D4HA 2QU8A 2FJUA 1UFQA 4A0FA 4Z1MD 4RD0A 4LHWA 3SJZA 3DPUA 1MT0A 3UWOA 4TL9A 4JKIA 2J41A 4LYAA 5DYIA 3RHFA 2GILA 3TJZA 1P9WA 1R5NA 5EE0A 5J4LA 4OI0A 5E7JA 3PUYA 4MRSA 4OK3A 3QXXA 2X2EA 4NH0A 2H5EA 5FH9A 3VR6A 4QBHA 4MRVA 4NP6A 1VYVA 4DLVA 2WPDA 1NY5A 4HLQB 4EFNA 4RFSB 1N3BA 2J59A 2QE7D 3QPUA 4QFMA 5UKDA 2Q21A 1DG1G 1Q1BA 2CVFA 1G41A 2ORVA 1MABB 3AVWA 5FR2A 2H16A 5TARA 3K1JA 3VU9A 1NVVQ 5JJIA 4Q9HA 3QKSA 3BH6A 2GA8A 2GRJA 3LBHA 1RRFA 4KFUA 4MKHA 4JLVA 3GJXC 4AURA 3B1XA 2CHGA 4URYR 4QNRA 1E2DA 1ZD1A 3EWAA 4XJXA 3TIFA 2BDTA 4KSBA 4OQFA 2CBZA 2ATVA 5EP3A 1LV7A 2O0HA 1LTQA 3A4MA 2YC2C 3OAAD 1E0AA 4D80A 2VH5R 5SZIA 3AF0A 4ASUA 5F98A 1G8FA 4TQUS 3IPYA 1ONBA 4HATA 4DRZA 3SOPA 1H65A 3SQWA 4CEIA 1HE1C 2AFHE 3B1VA 4PC3A 4U00A 1EESA 4PSVA 1ZM4A 2VIIA 4GP6A 1DBSA 2VPPA 3EPKA 1DARA 1QVRA 2J0VA 2WIBA 4KYUA 3TW8B 3LBNA 4X8MA 3I92A 2ZM5A 2QMEA 4URXR 3ASYA 4L4UA 3SJAA 4A2QA 4B3GA 1KSHA 4LRWA 1G8HA 2BMDA 1JEEA 4V0ME 5AJVB 1COWD 2A7QA 4TTRA 2FSGA 5JRZA 3W5IA 3AB3A 5G3YA 3EZFA 1JR3E 3CONA 1TX4B 5K8UA 3NG1A 5HPYB 1OT3A 3GLHE 4ZI3A 4I4LA 5BN5A 1D9XA 1UM8A 3K70B 2JLRA 4A36A 5IK2A 1YVDA 1YZTA 3W90A 3C4JA 3LNCA 3ZVNA 3GJ0A 1E9RA 4JYCA 3VMFA 3C41J 3FHOA 2R2AA 4C7OB 2OILA 2WHXA 1FUUA 1U0LA 3P26A 4B73A 2TMKA 2W0SA 2KSQA 4D0GA 1CR1A 2RGCA 3CKLA 3LRPA 1NY6A 1A7JA 5CYPA 3TGPA 4XVRA 4XH9B 5IT5A 1CRPA 3THXA 3V9PA 1VPLA 4MUBA 2AL7A 5JZVA 4D82A 3C15C 2IXGA 1P60A 2ZIAA 2YOGA 2WJVA 1NLYA 2I4IA 4IFEA 4LI0A 3WMFA 4QL3A 1ESNA 1OLOA 2R8RA 3RS2A 2R9VA 3MWJA 4U7DA 2Y8EA 3RWOA 1UAAA 3PQCA 1E94E 2ODWA 4KU4A 1PJRA 2QGNA 3TSWA 4B34A 1GKYA 2ZPTX 1CJUC 2EU8A 2ZRMA 5SZJA 2HYDA 4IW3B 8OHMA 4QJ5A 2DBYA 4US2R 2DY1A 2YWGA 3PVSA 4TTPA 4B2LA 3FKSA 421PA 2RGBA 4TQ9A 1CR0A 3PEUA 1U94A 1AKEA 1QHYA 3RNLA 3KB1A 3PJRA 3OEHD 3CIOA 4YMWA 1QG4A 3QUSA 2IXFA 1UBEA 3Q5EA 3GFPA 4P32A 4MGYR
chains in the Genus database with same CATH superfamily
3Q7PA 1QH1A 3LVRE 4B3SB 1VLLA 4P4NA 2HQSA 2BP7A 1X7DA 4AO7A 2PMFA 2PKWA 1T13A 1NNI1 3OPNA 5JAOA 5ES3A 1Y82A 2VL7A 1HT3A 1Z6AA 1R74A 2GKOA 4JOQA 1I3LA 4U2CA 5JS7A 1VZ3A 2FMUA 2F1RA 4AZVA 5J2UF 1DMSA 1G42A 5AM4A 1B0AA 3S8MA 4EG8A 2DCUA 4PEVA 1UMKA 2W5UA 2ZT7A 3UJNA 3ZDAA 3AWDA 4JD5A 1DS6A 3UH0A 3LCRA 4K2HA 4ZQFA 1WU7A 1XRNA 5CA1B 1RD4A 2MSWA 2E4XA 3R40A 2FX2A 4MW1A 4L9AA 2L18A 4JFRA 2VRWA 1F48A 1SIUA 3DZDA 1KQOA 4WL0A 1QFYA 3BULA 1F2UB 1UXKA 1P7PA 1XDSA 3KTAA 4I55A 4PINA 5C8YB 2Z2ZA 2VNAA 2I2AA 3IPXA 1Z4LA 3FYDA 4KK4A 1U5BB 3G89A 4KO4S 1U11A 3K31A 1J2JA 1YB7A 3V7YA 7ABPA 1RYBA 5FTLA 4UXIA 2DTDA 3ZDCA 3HDHA 1R6DA 3ICEA 1CPYA 5FYQA 4WXPA 5ADWA 4OJKA 3HCOA 1A50B 2GAAA 3KTAB 2HM7A 4Y6LA 4CEHA 2CJPA 1I01A 3DQZA 3MBKA 5K7SA 1B74A 4QNMA 3VYUB 1RHRA 2G06A 2OXCA 2ABWA 4CMHA 3HEMA 2BMJA 3UWDA 4F97A 5JDIA 1PD1A 4B4WA 1C30B 1SHUX 3E9ZA 1DELA 3BRCA 4GPIB 4I5FA 2R8BA 1REQA 1SOMA 1T3LA 1V11A 1E7WA 2JAQA 5AO9A 5IM4A 3H97A 3E3NA 5JANA 5JNUA 1FMTA 3QF4A 3U3KA 2G1KA 1HDCA 4I9UA 1DC3A 3A4LA 5EIFA 3HCEA 2CW5A 2ZTLA 4YMIA 3NTRA 1NR5A 4I36A 2PR7A 4KWCA 4XASA 2O2YA 3VOBA 4ZEWA 4ZYUA 5DK4A 5HZGA 3PCRB 2QNBA 3GHYA 4IX1A 3K30A 2CHQA 4AJJA 5AD1A 1GQ2A 4X62B 4FIZA 1QDUA 1INLA 2W8BB 2B99A 2C96A 3UXEA 1N33B 4K1XA 4MRNA 4WXHA 3B8HA 5HKLA 4DNQA 1NN3A 1SBCA 1ZUIA 4XR9A 2B9EA 3P9YA 4RYDA 3SMQA 4X94A 1H2ZA 3D7MA 3ZHBA 1E1DA 4XWTA 3LZCA 3Q72A 3Q98A 5B2EA 2HDWA 4E14A 3M1YA 3DD1A 1QIKA 1L4BA 4RGVA 1PEDA 1YGPA 2V1XA 4LOJA 2X7JA 5JRJA 2UYYA 3IDOA 4K9PA 4R2JA 3UA3A 4EG5A 4LGMA 2WIGA 3IVRA 1ODLA 1WXEA 3G1TA 3QE3A 5AXBA 2AR7A 2PKYX 4FS3A 3OETA 4DTIA 2I6XA 5MF6A 2BCJQ 4H3SA 4J0IA 4C07A 5IM5A 4M89A 4JVMA 2NTYC 3CTMA 2NO0A 4OQEA 1A7KA 4WCFC 5IDYA 1Y89A 3FRHA 1V4NA 4PX9A 8AT1A 1CHDA 1E2IA 3G1WA 2FN4A 2OC9A 4KQHA 4C20A 1HE4A 1R0ZA 1VE3A 3K9FC 3R9WA 2ZYWX 3ZU6A 3V7NA 4JC4A 4UZFA 4Q3AA 3GDGA 4UBOA 3WLIA 1DEAA 1N57A 1UP7A 1TJ4A 2BFOA 3PC4A 1QANA 2IZ6A 2UYCA 1JHMA 3S8EA 3U44B 1UXGA 3PRHA 3C6YA 2AEFA 3MIZA 5KYWB 3QU9A 2RARA 1GNSA 4WV3A 2BEVB 5K3OA 1BN6A 2W11A 2P11A 1L8OA 1R8YA 2Q5CA 3F6BX 5ALGA 3DS8A 3KVOA 1UBHS 3FZGA 3EXEB 4O2AA 1MJHA 3L82B 3S1LA 3FWPA 4B6SA 2XGSA 1OWOA 2QYHA 2YS7A 3EOZA 3TLAA 3P9RA 4F2DA 3LHSA 2N47A 3RFFA 3AR4A 1KJ9A 1MB9A 2Q4OA 3SZRA 2M6LA 3MSXA 4YRZA 1T3HA 1WIWA 5ES4B 3NRCA 2CLKB 3P2YA 2JFFA 1U4NA 2X9VA 4TL7A 4G0WA 3A6LA 5LSAA 2B69A 2WINI 3IQFA 4PNPA 3L0BA 4U63A 3Q8LA 2HMUA 4CG3A 5A3JA 1F4VA 1U7DA 2XNSA 3IHKA 4AJIA 1YFLA 2KWIA 1ZSVA 4LBWA 2I66A 1Z4NA 2GVNA 2HHHB 2H5JA 2QJWA 1YUNA 3HFJA 3F8SA 4I6JA 5CCBA 2VDMB 2QD5A 4ARAA 2AH5A 2PH5A 4UTOA 2GEVA 3NPMA 5I9NA 1ZCBA 3OIGA 2YQ5A 1JE1A 4HLNA 4MGEA 2AZTA 5FWDA 3V8EA 2QL5A 3B9PA 3STWA 5J2UA 1XDWA 1SPXA 1ACLA 1GZHB 3MT7A 4YAUA 3SSOA 2GARA 4L6CA 3PGLA 4BO0A 4CM8B 1UM9A 4B3FX 1IU9A 4Y2SA 2Z4SA 4PX5A 4C0BA 1BDJA 1YQEA 4DSAA 1DXHA 1QGED 1RJ9A 4LV8B 4MZDA 1TJPB 4AMVA 2X8WA 2OHXA 2X8JA 3HUDA 1GL7A 4NFYA 2J67A 1NW6A 5HMMA 5C4MA 2Z9CA 4YLEA 4RSMA 1O4WA 4C6HA 4BMPB 1SNYA 4Q21A 3FYCA 1D04A 4OHBA 3HYTA 2B8WA 3B6ZA 4PTLA 3UT0A 1V1JA 4TYWA 1RBYA 2ZVPX 1V25A 4G5XA 1K7XB 1GQSA 4PAWA 5HS4A 2PKXA 4MIYA 2FFQA 2BFBB 4TKVA 5JV5A 5K0TA 4TKLA 3DWEX 4BTEA 2F8LA 4GVXA 2AK3A 2OLEA 1NATA 4D96A 2PU5A 3G5LA 4F6RA 3CGWA 1SY7A 5FWNA 2HA7A 3EG9B 5TY0A 3TFWA 1B26A 1XHLA 2VBFA 1IHOA 4WUTA 1U7UA 4KUGA 1N6RA 1F8UA 3EASA 3O84A 4NOJA 4YPVA 2E1PA 1GPUA 1C81A 3E84A 5EG5A 5EYPB 4MS3A 3FB1A 5TQ2A 5TVKA 2WRZA 3LUGA 2YFYA 4V1CB 1O95C 2DRIA 5AWFC 2PGAA 1XA3A 1IXSB 3DDNA 3OA0A 1XIVA 5KAMA 5DYYA 4YFYA 4B43A 3DP9A 1X77A 3T4UA 3YASA 2CDBA 5L3RA 2XBLA 2Q6OA 1U3GA 5EQDA 2ZI7A 5KPJA 2W6CX 4TSFD 5DLYA 5EINA 5IAAA 4MO2A 4FMDB 4GR5A 3AVQA 3T3HA 1XZLA 3HTXA 4WT7A 2I2BA 3CTPA 4HAUA 1Q1NA 2QQGA 5IUKC 1MRZA 1R00A 2VUUA 1HF3A 3RIGA 1WETA 3DT8A 3TQHA 1U7OA 4YUVA 5HA5A 2RHRA 3HH8A 1A9PA 2WWHA 1BWRA 3A4YA 5B4UA 1XD2B 3SXUB 4B87A 3WLJA 4DIKA 1NLMA 4F4CA 5J3JA 3DVLA 5E7IA 2E48A 1A9XB 2A5GA 2XSZD 1JEQA 5E2AA 4ENWA 1F7UA 4WESB 4YB8A 1Z2PX 5JCJA 3DZHA 4DV4B 3O1HB 1QHNA 4FGUA 4RHTA 2BY4A 4XGRA 1ICEA 3V6MA 3WXBA 1SC4A 3N2ZB 4Y6SA 2PS1A 3L7JA 2BZ1A 1X7XB 3L79A 3Q85A 5FNZA 1LPOA 3RVOA 4CU2A 3ESCA 3OTHA 1VCIA 2QAGC 3PKJA 4U2BA 2FJ0A 4IIGA 3ZLUA 3O8DA 5KMGA 2QTAA 1VDZA 1GITA 2AYZA 3LY7A 4EW6A 2PUHA 1ARZA 1N92A 2QSUA 4KXLA 2PJRA 4ZODA 5GZ1A 3SHFA 4A6EA 3O4GA 1NMYA 2EGUA 4OM7A 5AOVA 1J2YA 3IUPA 3KVNA 4BNJA 1E3SA 5IASA 2W2TA 3ANXA 3QWBA 4YQFA 3DNMA 1JA9A 2WWRA 5LN1A 2AKEA 4M0LA 3ZHXA 2ZWIA 3TPFA 2IEGA 5DSTA 2HSJA 3ONNA 3ZD6A 1XLWA 4F7WA 3AVYA 2Z6UA 3HA7A 1TTTA 5JI3E 5I4CA 2ZK7A 1VIAA 2IWRA 2NLOA 3I9JA 3AUYA 1ZOOA 1XAJA 2IY9A 3MINB 1E3IA 5IFKA 3Q3JB 3IURA 3U48A 3G0DA 3NHUA 2H59A 4FEYA 2VO1A 4TWRA 3TQOA 4YQZA 2FWIA 4UVEA 1DE0A 5AW2A 3LX6A 4PO8A 3TB4A 3V8NA 2QMYA 1BXZA 3F74A 1R27A 2ZETA 3HI4A 3EXHA 1BJRE 3QKSB 4FFBA 1E6KA 5T4EA 3VNAA 4WJLA 5HP4A 2C99A 3K96A 4A0HA 2I1WA 3F2IA 4MUMA 3UF0A 4E2YA 4HQ0A 3AJEA 5KQPA 3IL2A 2E89A 3G8YA 3PFCA 4A10A 1G0OA 4WHMA 4AJ1A 1ENZA 3A1VA 4DDMA 4EPVA 5HX7A 1CY6A 5I8WA 2J4CA 3QVSA 1EDDA 3WQQA 3QVVA 3ZJYA 4DANA 1CEEA 1KMMA 3TD2A 2H31A 2VHUA 2VEOA 3I32A 4IWNA 4TT3A 3DMYA 4KNVA 4S1PA 3RK1A 1WVIA 1GGEA 2IYQA 5AW9A 1GZDA 3E61A 4AYXA 3DO5A 1SCJA 1PR3A 4J9VA 5E6RB 4WCFB 3S3TA 1PIWA 1EWQA 4N12A 2C2OA 4MTCA 4RVCA 1SXJD 3WISA 4TKMA 1JFTA 1V5IA 1UBTS 3QBVA 3D3JA 1OA1A 1RXEA 2C61A 4I0WB 5FUMA 2J87A 1NJSA 2PPLA 3FG9A 4ISBA 4MOWA 3OIWA 4JUIA 5FBRB 4HPWA 4B8YA 1B42A 2H06A 2JGRA 5CA1A 3EIQA 2NG1A 1EJBA 2JVKA 4XLLA 3PXXA 2FP4B 1R4NA 2RH8A 1ETHA 1KI9A 2KHZA 3RAJA 4CDMA 1ABBA 2AR9A 4JH0A 4BV2A 4YRKA 1VYUA 1F8GA 2AZXA 3OBBA 4GM4A 1JE0A 3GXBA 1EXNA 2FPWA 4EA7A 2X40A 4I8XA 3GNQA 4U2KA 4YQYA 1SC9A 4XYEA 1YK0A 5TMPA 2IUFA 3SEAA 1E79D 1VI6A 2AOTA 4CLOA 1N9GA 1FVXA 2BYTA 3NRBA 3V5NA 4E5UA 3B1FA 1Q6ZA 3FPKA 4UEKA 4V0NA 4WLNA 3GI1A 4F5EA 4LGVA 2W2KB 4NL4H 3B48A 4XQ0A 5CHEA 1ELOA 1OXUA 2FN8A 3C3CA 1XMIA 4X92A 4EYOA 1YRHA 5U9CA 4JJ4A 1IJFA 2I78A 3UMBA 1C50A 4P92A 3SYMA 2ZSAA 3UJDA 1MB3A 3PFWO 2X1LA 1A72A 2F62A 3LYUA 3V2IA 4WCDA 3OEYA 1NMXA 3HCBA 4HXFB 4DFDA 1IK4A 5I3CA 3AV0B 1JQBA 4HNAB 4IDAA 1C8KA 4KZPA 3UWKA 4AT1A 2VAPA 2QP3A 2WNHA 4EO9A 1MXHA 3G0CA 4KIUA 1K7FB 1Y7HA 4Q6WA 1S02A 4Q02A 2AKAB 4RCVA 3AESB 4MV6A 3GVHA 4G0PA 1NZFA 1M5UA 1W1IA 2XEXA 5AP9A 2V5UA 2Q0QA 2QVZX 3OPYB 1PZXA 5TPZD 4CKCA 1YU9A 1R0LA 2OLKA 3JARA 4DWOA 5EIOA 1CX9B 3WKCA 1T9AA 4HQRA 1JDZA 4C2BA 4LJ8A 1LC0A 3KKNA 3NTVA 1J5PA 3L0YA 4IOJA 2XNDA 3H9BA 2QR2A 4N3AA 2PJUA 2DERA 3BGOS 4Q1AA 1EHCA 1FP4A 3A3PA 1JLRA 1V16B 4R0NA 4PYLA 2AWOA 4PVDA 5CUQA 3SZGA 1QBGA 2XYHA 4BO9A 2CL5A 1GQQA 2P7IA 5A3SA 3NHYA 1ULSA 4BGUA 3FSGA 2W42A 3A1TA 5H5JA 2OR3A 2QPOA 3ND5A 3ZVKA 1AXEA 5GONB 2AD1A 3QXGA 4W82A 1L7XA 2NVUA 4KQ9A 3N76A 3N58A 3SZMA 4JUCA 1FMCA 3W6UA 4BKQA 3HK2A 3F3SA 4F1WA 1ZL0A 3Q6IA 4IRXA 3D0QA 4DCPA 4MLCA 4P7JA 3IBCA 5EP2A 2GYWA 3KLPX 3F0TA 3PJGA 2FPMA 2Y1LA 521PA 4BXOB 3W6OA 721PA 1XJQA 3IMKA 2DWQA 5ESRA 1BG6A 1O8CA 2OCPA 2O7SA 2IYXA 1QHXA 3AW8A 1XZIA 3C98A 3PD7A 4GPZA 2VJLA 4HGQA 1Y7LA 2O14A 4QTXA 3TTSA 1XZMA 4NCAA 3NAMA 3FPEA 1ECLA 1XDBA 2TMYA 1AQLA 3ELWA 4PZ9A 5JQGF 4LHYA 2EDCA 4OKIA 4RVSA 2PV0A 3HCPA 3I6IA 1AE1A 4GOOD 2FPPB 5JZSA 5L40A 1YL7A 1WXDA 3OQBA 3T15A 1CBUA 1JDUA 1HBJA 1EUCA 5KSOA 5D86A 3R24A 3WL5A 1XU7A 3GLQA 1MAWA 1M9NA 4BBJA 4DLRA 1CZNA 2UUBB 1SK8A 3FWNA 2IXTA 3P27A 1KKUA 1J6UA 3TUIC 1BVRA 4G65A 2QJOA 4EJFA 3QMPA 3K6KA 2HFJA 4RHXA 4V38A 3UAOA 3ZS9A 4KQXA 2FW9A 4X8OA 1HTBA 1R0YA 5EHIA 4D26A 1H69A 2CLSA 1W19A 3CX7A 1JQLB 3WJ7A 3U6KA 4UAUA 5CAEB 4EHBA 1N4AA 3FTPA 5TF0A 4TZ6A 3H1PA 3G6WA 2ECFA 2Z9DA 1ZXXA 2ODAA 4LDZA 5AIAA 4A8JB 4PWYA 2HF9A 3JS5A 3MTDA 4H6WA 5K1ZA 5MN6A 5DX0A 1EK5A 4MJXA 2J5BA 1DCKA 2XADA 3NGLA 5IMBA 4E2XA 2A67A 1GRCA 4LRTB 2CKMA 1H5NA 4J7XA 4OV6B 1VA4A 3EJ6A 1D8AA 4IIVA 1XAGA 4NEGA 4OHYA 1AKVA 4XR4A 1RXUA 3FLBA 1CYDA 2C1ZA 3DCNA 3VO2A 2G9ZA 2B92A 4JBGA 1Z6YA 1UEIA 4JC0A 1M1ZA 2D54A 3I39X 3ZX5A 4NESA 1HZZC 1FBTA 3CX3A 4MR8A 4Q7KA 2GKGA 2AUNA 1XZCA 3I1IA 2FR0A 3RSOA 1V1RA 1Z4PX 3QQPA 1G3MA 4ZHQB 5MDHA 4FFVA 3CHYA 2OBFA 5TJ9A 1NI4B 2OGTA 3HV2A 3GGGA 3STYA 4UM8B 1HORA 4OMFG 3ZYCA 2FW0A 4MW4A 2Q2NA 1J4AA 3IRUA 3U7JA 5ICFA 1A0OA 4BDTA 2HGSA 2K5UA 4LY3A 1SZPA 2VUHB 4MICA 2RHOA 3EODA 3N8GA 9GPBA 3FPJA 2W2LA 1I3MA 3C0KA 1ZNZA 2FPLA 4L5CA 3BGSA 4LMBA 5F33A 5K05A 4LCEA 3DE7X 2N9UA 1KK2A 4IXMA 4MKRA 1YTLA 3WNCA 3AUSA 3DUFA 4N41A 2P1DA 1AUPA 2NU8A 2O6LA 2P3LA 3HYSA 4L8GA 4ZT6A 3MWLA 3BSYA 1SOAA 1BDMA 3LW8A 3C3MA 1CY1A 3NGXA 4GXRA 4J03A 1CUAA 1WVMA 3X1JA 3RRJA 1PUJA 4FPXA 2FOXA 3J7TA 4FB5A 2G7MC 3IJPA 5F9MA 3OFND 3V33A 2Q1UA 4HZUB 3QLUC 4Q1CA 1W5EA 3P96A 2C1EA 4MUYA 4W8OA 3Q11A 2DPYA 3ICWA 4JHLA 3ZLVA 5JH7B 4IDFA 4NTZA 2O1WA 4B6OA 3HB0A 1E3LA 2NSHA 5CU7A 4BQEA 3FFWA 1E6UA 2O2CA 4UASA 2OK7A 4GUDA 4WKGA 2EQBA 3KKOA 2JBHA 1XRJA 4JUDX 4HN2A 4PONA 2Z83A 4EAAA 4JX9A 2NT3A 1OTXA 1RM4A 4L7QA 2V3VA 1H23A 1KFKB 5REQB 1KH2A 1RYFA 1IY2A 3RAPR 3TZCA 1EBBA 1X8XA 3EEQA 1Z0DA 1CD5A 4Q7QA 2QUZA 1HSOA 1YWGO 5FPQA 3FIUA 3WGHA 2NPOA 3G5UA 2IUTA 3FCEA 1P4AA 3Q7QA 3EFBA 1IRIA 3IR5A 4CIWA 4YJ2F 2Q5QA 1RFLA 1WBJB 2BDEA 5EI5A 1O5IA 3GNTA 2C04A 2FU5C 3GNLA 1WMEA 3O1LA 2E4UA 3WSVA 1GAWA 1NYLA 1PAUA 3U7RA 1HUQA 1T5SA 4QARA 2QN3A 4UXHA 3RCBA 2YCBA 1I7QB 3VHXA 1XZQA 4GOJA 1OZ0A 3MT8A 3QRWA 5IMSA 2NO1A 4C0LA 4YV7A 2R6FA 3PX3A 5A6SA 3JQ7A 1ZW6A 2H65A 2WTAA 3QFRA 1ZP6A 2AI1A 2QP9X 2ZRPA 1T3TA 4XGKA 1FX1A 4B31A 2JZCA 2P2NA 3HU3A 2Z56A 2J85A 2P4QA 3LHDA 3NAQA 3OE7D 1R37A 4RMIA 3EEYA 4ZDIA 3DZKA 1KH1A 4DIUA 4HH3C 4QG3A 4LRXA 2P9JA 3T0FA 2JLQA 1KH3A 3VRHA 3T7CA 3E82A 4TMYA 4CIAA 3EVZA 1AO0A 3OZGA 2FF7A 1G7CA 3RSCA 4YBZA 1RM5A 3ETJA 3GBPA 3VX4A 3OU6A 1QSGA 3FH0A 1R8XA 1YI8A 4LF6B 1DDOA 4X71A 3R4VA 4WK4B 2W83A 1TOAA 3O74A 1PFQA 5AKKA 1WSWA 3KXDA 4KWTA 1PJQA 2AK2A 5HCNA 3NHKA 3WYDA 3ZEIA 4YUAA 4FQ7A 2IHZA 1X7XA 4CV2A 2ZCVA 4D4GA 2NZVG 2XTNA 2ZJ6A 3O90A 1MOZA 2Z1NA 2ARKA 4QASA 2VYQA 1XALA 1GTRA 3QKRA 1N5LA 3ITDA 5DN9A 3KOZA 4BMCA 1IN6A 1ORDA 1QYIA 4ZVKA 2ZR9A 1BRMA 4O2BA 2D6FA 2YWHA 1MB4A 5EMJA 2O8DB 4YRCA 2NXCA 4AN4A 2WJIA 3IUSA 1LVHA 2V3CC 3ZYZA 1W5FA 4YLYA 4EOGA 3QNWA 1W4BA 2FGKA 1NXPA 1YB2A 1KRWA 4FCWA 1DL5A 4N0DA 5BQPA 1QNFA 2XRYA 6LDHA 4CF5A 1XTPA 4E5PA 3KM0A 3NUZA 5DTJA 1JBKA 3WRXC 1W0KD 4AXXA 2GJ8A 3H0CA 3OD1A 4IOMA 4CNBA 3TJRA 2YBEA 5D6NA 2GN1A 2JA2A 5T6MA 1UODA 1DBIA 2XJ4A 3ZDRA 4ME6A 3EXEA 4DCTA 1XJWA 3LGXA 5FTMA 2HOQA 1KI6B 2ZW9A 8MHTA 1ZC4A 3R74A 1Q1QA 1UANA 1XP5A 4OQLA 3RF7A 3RS4A 3UUWA 5LNK6 1P77A 2I6SA 2VTBB 3V46A 4JDPA 4Q4HB 4P53A 5EKUA 3T7RA 3EIEA 2P5SA 3NP9A 3LG2A 2AFIA 3AI1A 1J8FA 1WXWA 4LE1A 4RMNA 3RKSA 5MN4A 5C8DA 4OYLA 3VKGA 2B9VA 4EI2A 4CKEA 5H16A 1OFHA 4Y0AA 3T1OA 5JTTA 4HFRA 1GNPA 2I29A 2QMQA 2QA5A 3FTDA 1AUOA 3QNMA 1LJLA 1PZMA 2EJWA 4GGPA 5E9QA 4DUGD 3I34X 3T52A 1SBYA 2PX2A 3FNFA 2GN8A 2H08A 3VC7A 1ZD9A 1NONA 3ETLA 2OM6A 2WKRA 5FA5A 1TCBA 5ALEA 4W5RA 2HK9A 1YQQA 2ZJ3A 3DW1X 1CE8A 2HRCA 1VMEA 1YHZA 4L15A 5BN4A 1MGPA 5FWAA 4FGLA 2AQKA 3PDJA 5KOJA 4WA7A 4PO1A 3M6UA 1CUJA 2PU7A 1MNAA 2G07A 4IJVA 6YASA 3KZKA 2ATCA 1U0TA 5JVDF 3W79A 4O1IA 2BGUA 1C4XA 1LPPA 3KJEA 4OFZA 2A35A 1FZTA 1M2WA 2BM1A 3GJTA 1USWA 1BCSA 2HTEA 2I6QA 2UVDA 3KELA 2E5WA 4FKMA 1OBHA 4E11A 2VBGA 4RBNA 2CMDA 4CBVA 5JYEA 1OB2A 4OHZA 4LF5B 3WBKA 4O2AB 4RH1A 1XVUA 3FMVA 3ZIUA 4EMSA 2UZ4A 3D54D 1FMLA 3M3HA 1EFLA 5HIMA 4KR9A 1A9SA 3BL6A 1L2TA 1UWLA 1RWMA 4I50F 1SCIA 4G8DA 4JJIA 2W6ID 5AK0A 1OFUX 2VJDA 2O8EB 1ZIPA 4B4DA 2ZRNA 1BOOA 4UNNA 5BUSA 1GKIA 1BOFA 1M6YA 1GPAA 4YQEA 2WYWA 3N7AA 4BVLA 3NDJA 1DKLA 1Y7PA 2YOFA 1QM5A 3AVUA 2JCGA 1PG5A 2V7XA 4BO4A 1IB6A 4YX9A 5DGIA 2V6MA 1IPEA 1HFWA 3AL0C 1P2FA 3L8DA 4JC8A 3ORQA 3CRVA 3CZQA 3QEKA 4PX2A 5CPFA 2CVZA 3JRWA 4GG1A 3UMSA 4IFBA 2K87A 3A9UA 2GTPA 2FUG6 2VHJA 3NH6A 3S6JA 2WA1A 2QLTA 1UF9A 2OQIA 3GJ5A 4Q47A 3DBHA 2IF0A 4CKXA 4PSAA 1BIFA 5GVSA 1AZWA 4S1WA 3I28A 1ZCFA 1GA1A 3H99A 4EUKA 2AMYA 3I76A 2AQ8A 4X8LA 1M0WA 2PWZA 3DEAA 1VLZA 3SZUA 5DNYB 3FTFA 2RGNC 4HGPA 1JALA 1SVSA 2V96A 1DAKA 3I04A 2VHTA 4EGSA 3OMWA 3EVGA 4KGXA 5F51A 4H3HB 5L7YA 1E8NA 3GJSA 4BBZA 1ZHHA 1KZ6A 4CQMA 2PZJA 2HRZA 1Q3KA 4C4SA 5CB4B 5F4ZA 1GPJA 4V24A 4EFLA 1Q7TA 2QEQA 4PE5B 1Z5ZA 3RJMA 2EZ4A 4Z1OA 1YGYA 2GBLA 2A3NA 2JFXA 1JR4A 1JAYA 2B5OA 2PLAA 3EGWA 3P7MA 4FYPA 4DMGA 4ENSA 4BE7B 5BYKA 1KMHA 1TU0A 3A2LA 4MWCA 2ZRKA 5A9RA 5BV1A 5CA0B 2FSFA 2FPUA 4NATA 3M0EA 1DBRA 1HV8A 1X94A 2FWMX 1H6DA 2CGEA 3A2NA 2GN9A 1SXPA 5DU2A 3BF7A 3NANA 4DZRA 2C3MA 3EDCA 2BGWA 3NXSA 4OHXA 1NNUA 3FNGA 5DBEX 5BSHA 4H4EA 3IO5A 4LJSA 4G4IA 1DQPA 2C03A 2WILA 3K7EA 3NC0C 1YDWA 5COAA 4RL6A 5LBUA 2P27A 3DE3X 4Z7OB 3LCMA 4PM4A 1VHDA 5BV8A 4D9JA 2JHAA 2ZSHA 3K0AB 4KYIB 2CV2A 3ODPA 2WTMA 4RIIA 4DBZA 3U7FB 2PEYA 1FTYA 3FLMA 2YN0A 4IJKA 4K86A 1K8RA 4ZV7A 4YRAA 5DLDA 1VPTA 2RAUA 4ZVOA 4CDGA 1KOLA 1TLTA 2ZATA 5CX1B 5DW3A 4CFSA 5B3KA 3GZ4A 3KUXA 2FVXA 3DMTA 1NOIA 1I13A 5KC9A 1KOFA 4DA0A 1P4SA 3DOJA 3H04A 3CE9A 3I42A 5A3QA 1V5WA 3EAGA 4HNGA 3E4DA 4O2LA 3CF6R 4RZHA 1QQTA 1U9YA 4I50B 2OVFA 4MS1A 3LQYA 4GKKB 1AG9A 1TZMA 1Q7CA 2LVBA 3NW9A 3CJTA 3ITEA 2XCRB 5JARA 3HDVA 2N3ZA 3GRCA 2GAFA 1BEEA 1JB9A 3F8TA 2PAAA 1PK9A 4AK9A 3CT6A 3SU8A 1UAYA 1QE3A 2YXBA 4JR0A 3EGVA 1C7JA 2Q49A 2G1JA 1OWPA 3HB1A 2I99A 1UT5A 3AGQA 4YH1A 3GH3A 5CEFA 3HC7A 2VH1A 1P1RA 3HADA 1V8DA 5KQSA 2W71A 1P17A 2BBSA 5KU1A 5ALLA 1ZSYA 2VHEA 5DW0A 1FU7A 2BZSA 5HK9A 2ZTSA 2R8EA 3DDHA 4I5DA 2QDKA 4J43A 5H68A 3RQSA 5A1TA 3OP4A 2DQ4A 2Y9MB 1X70A 1J24A 1ZJ6A 2JPDA 3E9MA 3NOQA 5T8KC 3ZHYA 5EZSA 4CR7A 1F2TB 2VG8A 2WZBA 5TLSA 2OHHA 4UUPA 3T7TA 3RU9A 2KLBA 3VR2A 3R3HA 1BD4A 3UB2A 1D2GA 4L74A 3NVMB 3VKVA 2ZIXB 3HVIA 1WU8A 2W58A 3NBAA 2OXFA 4UAGA 2AI2A 1NXSA 3CVYA 3NT4A 2IYEA 3IALA 2B4QA 3AR8A 4P22A 1DAHA 5JCXA 3OM1A 2MCFA 3E0QA 3QUBA 2G0AA 1JQ5A 2UZ0A 3IKLA 4FX2A 3NC4A 1OLSA 1H9BA 1JFVA 3DE5X 3NV7A 3OJEA 2X1VA 6Q21A 2QTMA 4RF3A 3LIPA 4YP5A 3O75A 1SWVA 3LQRA 1HZZA 5CEEA 1APBA 1O6GA 1ZOLA 3L0CA 1B0ZA 2X1HA 3L7OA 1N8KA 3CUKA 3TR5A 3ROZA 4ZAYA 5CVDA 3DYIA 3E05A 1YDEA 2ODEA 4FNMA 4YV0A 1P0PA 2WHRA 3AEUB 3KO8A 2DFPA 4TTIA 1A2BA 3HFGA 3K5IA 2ATXA 4MQEA 3GN2A 4G1EB 3CFYA 4AJKA 1G21B 2BBOA 3PHCA 4RIHA 3GEDA 3PYMA 1BKYA 4BLPA 3UGJA 1QHHB 3OMXA 3P2MA 1Q7EA 4DLKA 3IQWA 1RADA 2W4QA 1MQ9A 1XMOB 3NI2A 4GGOA 3B1YA 4QYIB 2JIDA 4YMHA 4COOA 3R2JA 3P9SA 1GRRA 2NXNA 5IUJC 1TAHA 1AO3A 2EJBA 1Z33A 3VO1A 3AI3A 3U49A 2ENWA 3BE4A 1RPNA 1NURA 2XE6A 2Z0MA 3QUCA 1Q1GA 3GYBA 2ZROA 5HMLA 2XDQB 4DXDA 3U26A 3HO8A 1H05A 4QOEA 2NTJA 3DZCA 1M33A 3C3DA 2DR2A 2XITA 3N0XA 3SXJA 4YRQA 4MI1A 1KYVA 5LU9A 3OZBA 1MTOA 1XCJA 2ZJAA 3EDQA 4XCXA 1QCZA 5CVTA 1Q2XA 1G60A 1U0NA 2ZSEA 2ZE6A 2ZJ8A 3UENA 1RLTA 2H1RA 3O9MA 5LP6A 1OJ7A 1MNQA 3F7MA 3NIDB 3OIUA 4QPZA 1OAOA 5AI4A 3SIPA 4TSFA 5JFGA 4QU9A 2HPVA 2PAFA 1IHDA 3AR2A 4IILA 3QFCA 5TX7A 3WAKA 1G8GA 2DGDA 5G1OA 5TDHA 5K0SA 3AF6A 3ESRA 1G6HA 5BWMA 13PKA 1RLMA 3DL7A 4R51A 2A59A 4B80A 2Q1WA 2YXNA 1R8QA 2FFAA 2HJHA 3GVPA 3IJ5A 4CV3A 3CNQS 3Q1LA 2PLRA 2R8XA 3CF0A 4QPCA 1BQ3A 2J3EA 1KU0A 1W0JA 4YMGA 4R71A 3UNXA 4ZK6A 1GG9A 5CDFE 2SKDA 3H75A 2R87A 1IJBA 4JVOA 1G6KA 2UZAA 5H9WA 3U19A 1D6NA 1VP9A 1NUAA 2LCQA 4N7MA 1GG2A 1XI2A 3KEMA 1UBGA 2NN3C 2R7MA 4DSTA 2BI8A 2M6RA 4RAQA 3TVTA 1OV4A 5AIBA 2AN3A 2P77A 4Y6OA 2JAOA 4PN7A 3CLVA 3S99A 4B3JA 5AVWA 1FW6A 4L72A 1E2GA 3WNQA 2F3SA 2QD4A 3TLYA 1OXBB 1YB6A 4BZZA 1FBNA 2FSUA 4EQZA 3EXAA 1PR0A 2FLKA 1PBNA 4XD2A 4INZA 2CUTA 4F06A 2GASA 1FSFA 4OUDB 4OMCA 1ZJ4A 1DPFA 2VCEA 2YXEA 5EMKA 3DLCA 3EH1A 4JP3A 5C5DA 2NPFA 4A1FA 4DUYB 1N7IA 1PJLA 1QRRA 2LGJA 3DMNA 1NRIA 1J00A 4IDNA 5KTPA 3EGEA 3MWYW 1J06A 4ID3A 5DTQA 2GCOA 5G4KB 3U3JA 2ORED 3H1TA 2QSZA 4YVFA 3HRHA 3R6DA 5JI2E 5A7GA 2I1LA 5BW5A 3A05A 2WV9A 2UUAB 121PA 1F2TA 4Q82A 3IB3A 2B35A 1WUKS 2PSFA 4F2HA 4BXOA 3DF7A 4M2LA 3RYFA 1KR5A 2PUBA 3LOUA 2FUCA 2BGTA 3DFFA 2WAXA 4TLEA 4U7WA 4IUDS 5AHWA 3MOIA 5DE3A 2ZUEA 1G8PA 4Z9FA 3DO6A 4I2NA 1ORWA 4N18A 4AS2A 4W7SA 3EFOB 3MPOA 4KXVA 5F3WB 3WZ2A 2PIAA 1J09A 4J0JA 5KWJA 1N2ZA 3CZAA 4DNXA 4H0FA 4H31A 1H2FA 2X6RA 5A0TA 1I6MA 2FA9A 1KYXA 2XT0A 3FNIA 3UQZA 1U3WA 2FPKA 2BTOA 4R31A 3ZLBA 4AROA 1EFVB 3JAKA 5BUZA 1CUBA 2ZJYA 1GCGA 1CLEA 2NZYA 4I4NA 1TMYA 2GDJA 2C4WA 1E62A 3P4XA 1NX6A 3O0DA 1A4XA 1RM0A 1KWGA 1D2RA 2QR5A 1S2MA 4R3NA 4UVIA 1SB8A 1H4TA 1VGQA 2AN9A 3CNEA 4ETNA 1S01A 1WD7A 4ZC1A 3AMVA 5G4KA 3MWKA 3QLTA 4UPEA 1E2LA 1NXQA 4MW0A 1ULUA 5CDTA 5HG0A 3S55A 5DBOA 3THWB 1QQAA 4EYSA 3D3EA 4NFLA 3UAWA 3DW3X 1B16A 2FDRA 5KJCA 4C87A 2F48A 4OP3A 4RF4A 4IDOA 1PX0A 4R3WA 3A31A 3OQVA 4RNCA 4EHHA 1R8JA 4MYHA 4MYUA 3P1JA 2I7CA 3TH5A 4KQCA 3V4SA 3FF1A 1L7NA 1G8JA 1Z8DA 4JS0A 3KK0A 3WTBA 5FV4A 1Q19A 1X8LA 1YRYE 3PDCA 4J0KA 3BJEA 1QUEA 1AHPA 4M0MA 4G4JA 3TR0A 4DL9A 4D8UA 4YAGA 1E7MA 1IL0A 1KK1A 2WQ7A 1O94A 3LMKA 4IV5A 2HQ1A 3A28A 3JQQA 4S0ZA 3LRTA 4JR2A 1Z83A 4IWYA 1VA5A 1DG3A 2JVIA 3A9RA 2X9GA 1Z06A 3R8CA 3MJHA 2FFRA 3HDQA 3ZD7A 4L0CA 2P41A 5LQCA 4ILKA 2AFHB 2E37A 3T7IA 3X1ZA 4P7KA 3ICQB 1SCUB 3UHOA 3VZQA 2O2DA 1DAGA 1JIVA 3SQLA 3T3GA 3CLTC 3KWMA 3JQAB 3IBSA 1RJEA 2WT9A 3M9XA 4JLSA 1UDXA 3GCWA 2OMKA 1V3UA 3D7NA 1U8AA 4DIBA 4UXJA 2WWFA 4FDMA 1KDOA 3H2HA 4UU8A 3GN1A 5JD6A 1DLJA 2F6RA 5CTJA 3PQ4A 5FYDA 4Q0MA 3DZBA 1YVUA 3RFXA 3HN7A 4KH1A 1JJIA 2HI0A 3KBBA 3Q40A 5AW6A 1W4CA 1N7HA 4FFPA 3RUHA 2JJ1D 2W2MA 4AZWA 3WQHA 4Q7EA 3ZN2A 3AKDA 3ZNOA 3CW2A 3V9AA 1XXLA 3ZE2B 3K94A 5HZKA 4IHJA 4MWDA 2VHXA 1XKXA 1B93A 4QRDA 4X61A 1IY1A 3BF8A 4L5AA 3FSEA 3TTYA 1KAQA 4H7HA 4UREA 4XQEA 3PR3A 4CG2A 4ESVA 1KORA 4X7BA 4WW0A 1DJOA 1LU9A 2K4MA 3OQ1A 4FCTA 5JQGA 5CVEA 1G0NA 2W43A 3RFUA 1SQ6A 4IDEA 4AX4A 1L9XA 3NASA 1I6KA 3Q8WA 2H4FA 4H4CA 4QRHA 5IKOA 3U40A 3GR6A 4DE5A 4TYYA 3RTGA 1JBQA 3LT1A 4WACA 1ECGA 3BCHA 4LHSA 3H84A 5DRTA 1ZCAA 4LXQA 5A6SB 4IEIA 4M60A 1P9LA 4WLVA 3I2KA 4KQ6A 1LH0A 1WV1A 3HJRA 5CH5A 3STVA 4A0RA 1OT5A 5JCOA 5AM3A 4Q3BA 3T7JA 1W4ZA 3AQIA 3KDAA 2R1UA 3AP2A 4NAVA 3HS3A 2H2GA 3KOMA 4N5HX 2LR0A 1SG0A 3KKLA 1XQVA 1QYXA 3N75A