3RZOJ

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3rzoJ00
1BW6A 2O7OA 1WI3A 3W6VA 5EYRA 1TWHJ 4X6AJ 2M2EA 1BL0A 3A02A 4XICA 3PM1A 2JA8J 3FK6A 3LOCA 3UKGA 3OIOA 4A3BJ 2E19A 4FE4A 3BTLA 2FQ4A 3K2AA 1ZGWA 2JN6A 5M5YJ 4FE7A 1LE8A 1Q1VA 3HOZJ 3BR3A 2HOAA 1R9TJ 1MH3A 5JLWA 3HOXJ 2K9NA 1RKWA 2DA6A 5M5XJ 1ETVA 3A03A 3BR2A 2MW8A 2LK2A 2FJ1A 3K7AJ 3RZOJ 3FIWA 5M3MJ 3Q3SA 3D1NI 5M3FJ 3WHCA 2LFBA 2X48A 2H8RA 2AHQA 1GDTA 1MSEC 1F36A 2HOTA 2JMWA 2DA7A 2MSYA 4FTHA 1JKPC 1IUFA 3LNQA 2L9RA 3BG3A 1IV6A 5E3MA 1JTYA 2LLKA 4M3GA 4I6ZA 4A3FJ 1P7JA 5HODA 3GTMJ 4X1EA 2QF7A 3IH4A 4CYCA 3C2BA 2CUEA 1QVTA 2O9LA 2JJ7A 2HDDA 3S2DJ 1ENHA 3G1MA 2E1OA 3B6CA 2LKXA 3S1NJ 1MBKA 5EEAA 1AU7A 1MBFA 2ECBA 2RAEA 3IH2A 5GP9A 5EGOB 2R92J 2K9SA 1NK3P 2ECCA 3BR6A 3CCYA 3S17J 2XPVA 1G2HA 5IOYA 1VFCA 2XGCA 2TCTA 3CQZJ 2DA1A 2VUMJ 4DYRA 4BKXA 2FD5A 1B72A 1JTXA 3BTCA 5F0CA 2DTZA 3Q0VA 5FLMJ 1IC8A 4ABZA 2L0KA 3MVPA 2CRGA 5F0HA 2FX0A 1IGNA 2IEKA 3IV5A 1GV2A 2ZB9A 1IDYA 2ELKA 3GTOJ 1H89C 3RQIA 1BW5A 2Y0SN 3SFIA 4BY7J 4M6VA 3FISA 3JRIA 3GTGJ 3Q0WA 3BTJA 2O8KA 4MIMA 1B8IA 5M5WJ 2M9HA 3HDDA 2W48A 3BG5A 1WH7A 3S1QJ 2L7FP 1A5JA 2YUSA 2JK3A 1JJ8C 4I76A 3OOUA 1OFCX 4M3BA 3H0GJ 1WPKA 3HB9A 2R0QC 4A3MJ 2HOSA 1ETXA 4QSHA 3WHBA 5BNGA 5K7FA 4C3HJ 1YRNA 2DA5A 4M3FA 4XRMA 1IG7A 1RKTA 2ID6A 1ZR4A 1AKHA 2AO9A 1SANA 1JKOC 2CQXA 3HKZN 3MN2A 4BBSJ 2WAQN 2K9QA 1VNDA 2HXIA 2K40A 4M3EA 2NVQJ 3H3VK 3HOWJ 2PMZN 3HOVJ 2JA5J 5FKOA 3I4NJ 1ZK8A 3GBGA 4B3AA 2ME0A 3ZQIA 3L1PA 2X6OA 2E2IJ 1MBEA 3S14J 5J3LA 4CYCB 3OSFA 2XPUA 2E2HJ 3A01A 2IBDA 1JJ6C 4A69C 2N8GA 4D5FA 1OCPA 5EG0A 5FKMA 2P81A 3JRFA 1MBJA 3JRBA 4QTRA 5F08A 2HQ5A 1E3OC 3VPRA 3ZOBA 5K7ZA 3JRHA 4UUSA 2LVSA 3HEFA 3ZQFA 2CUFA 5J1UA 5IP7J 2DMQA 1OJLA 1VF9A 5F1JA 1PUFB 3M4OJ 2XRLA 2NVXJ 1X2MA 4Y52J 3O8GA 1JT0A 2E2JJ 2EQRA 1FIAA 3IH3A 2DA3A 2EH3A 3QPLA 5IP9J 1NTCA 3GTJJ 5DTDA 2CJJA 4RBOA 2LD5A 3PO2J 4MO7A 1UHSA 2DMUA 1MH4A 1WCMJ 4V2FA 2Y30A 2R5YB 1IJWC 1ETWA 1BA5A 1ETKA 1WH5A 2DA2A 2JWTA 2LP0A 1WGXA 2R93J 3JR9A 4B4CA 1Z77A 1FTZA 1FTTA 1QRYA 2R5ZB 5J1RA 1XC5A 4AYBN 2HI3A 1ETQA 2MGQA 1BJZA 2XGEA 3PO3J 2L7MP 4GFBA 1FJLA 1P7IA 1TWGJ 1MSFC 2NVTJ 3HM5A 3RKQA 2COBA 2EZLA 3GTKJ 1DU6A 3SDGA 4EEFG 1TWCJ 1EF4A 1U9NA 1HCRA 1XS9A 2LR8A 5EDNA 1U8BA 4FISA 1GUUA 5C3EJ 1QVUA 2QCOA 3OSGA 3LSJA 2GLOA 3S16J 5IP6A 4V2GA 1JT6A 2KT0A 2DMPA 3HBLA 5E3LA 4W1UA 3ZQLA 5K7HA 3BQZA 1I3QJ 1Y1VJ 3G1LA 3JRGA 3FKIJ 3TW7A 1LE8B 4W97A 1HLVA 2EZHA 2WV1A 1I50J 4IHYA 4IHVA 1ZTRA 1Y1WJ 1K83J 2M0CA 2XSDC 1XG1A 4DW6A 2NVYJ 2R7ZJ 3S1RJ 1HDDC 1A6IA 4C2MJ 1VI0A 5EGOA 1D5YA 5E3NA 3GTQJ 4IEJA 2B63J 4DYCA 5EG0B 3JREA 5FKKA 2DN0A 1TC3C 2I10A 2HXOA 2Y9YA 3JRAA 3NAUA 4AUXA 4FCYA 1TWAJ 3BR5A 1ITYA 4UUSB 1F43A 3Q0UA 2VI6A 2DJNA 4A3CJ 3BQYA 1OCTC 3B6AA 2YU9J 1HOMA 2XB0X 4G12A 4XRSA 2Y9ZA 3BTIA 3JRDA 4JP0A 2IAIA 1H8AC 5F04A 1MBGA 2JA6J 2NOGA 2GBYA 4D7NA 5GPCA 2M8GX 4LOCA 3GTLJ 3M3YJ 4B1RA 2XPWA 3BT9A 1ETOA 1ORKA 1LFUP 5J1YA 2NS7A 1IRZA 1JUSA 3CMYA 9ANTA 5FLVA 5F0FA 4JX5A 1UMQA 1HF0A 3S15J 3GTPJ 5IPAA 5FKLA 4RDUA 3LSPA 1U78A 1ZQ3P 5FKNA 1CQTA 4UUTA 3ZQHA 3E7LA 4XIDA 2ME6A 4A3KJ 1O4XA 5FJ8J 1B72B 1AHDP 4DZPA 2VPRA 5IYBJ 1SFOJ 3DCFA 4MFDA 3JRCA 4IHWA 4DZJA 3NARA 2EZIA 4D5CA 3FK7A 2GM4A 1RESA 5C4JJ 4A3EJ 1W0UA 1NK2P 1T56A 4DYQA 3I4MJ 3TP3A 3BR1A 1U9OA 3HOYJ 5IYDJ 3LSGA 1RETA 1Z0XA 2OPTA 2M34A 4BXXJ 4QIWN 5E3OA 4A3IJ 1JKRC 1X58A 3SJMA 1RPWA 2OF7A 1B8IB 4C3IJ 4BY1J 5JLXA 3ZQGA 1JKQC 3BG9A 4XRSG 2YS9A 3MKLA 2CQQA 2NS8A 5GPAA 3TEDA 1DU0A 1APLC 1RR7A 1HDPA 4AC0A 2JA7J 2ID3A 3QQAA 5C44J 2L7ZA 1YRNB 5EF6A 3HOUJ 2EBIA 4IHXA 4L5EA 5DS9A 1AKHB 1PUFA 1S7EA 1FEXA 4NDLA 4XK4A 1LFBA 3HGYA 3S2HJ 1GV5A 1MNMC 3DEWA 3S1MJ 4A93J 4HNVA 2LY9A 1K61A 2DA4A 4MLOA 1JUPA 1W0TA 2VKVA 3QPSA 4M3DA 5IYCJ 2R5YA 1GVDA 1X2NA 2D5VA 1I6HJ 1T33A 2LTPA 3F0CA 1UG2A 1IDZA 4BBRJ 3CDLA 3A01B 4JX4A 2MG4A 2CU7A 2G0EA 1POGA 1QPIA 4JYKA 1ETYA 2XB5A 4D7MA 3TW6A 4A3DJ 2R5ZA 4C3JJ 2WB1N 2HYJA 4JX6A 3BR0A 3ZQCA 3LSRA 1TWFJ 3RZDJ 2DMNA 3G1OA 5EZHA 5F27A 3TP0A 2Y2ZA 1JGGA 5IOZA 1GT0C 2VKEA 2H1KA 1JUMA 3O8HA 2X9DA 2EZKA 4J19A 2Y31A 5C4XJ 2TRTA 1FIPA 1MBHA 4A3GJ 4MFEA 1ZR2A 1ZKGA 1H88C 4S0HB 2KDZA 4A3JJ 4Y7NJ 2XGDA 4A3LJ 2DMTA 3HGGA 5EZGA
chains in the Genus database with same CATH superfamily
1BW6A 3KP7A 2O7OA 3VYUB 1X3WB 4BDYA 2R7RA 1TWHJ 2Y48A 3ZMTA 2HEOA 3C7JA 4N0BA 5AIQA 4XICA 4MTEA 1WRJA 4FE4A 3BTLA 4IXAA 3KZZA 2ISZA 2A5YB 1TQIA 2XGXA 2HU9A 2CGPA 2HOAA 2L9NA 4N9IA 4ZDPA 2M7BA 1R9TJ 4L9VA 4RGXA 5KK1A 1UELB 3RI4A 3BR2A 4ZZDA 4L18B 2M7AA 3NRVA 2FJ1A 3TDUC 3CCJI 2LOOA 3WG7H 4BHBA 3DF8A 5GAHJ 5M3MJ 3Q3SA 3KX2A 2X48A 4B09A 1S9HA 1T08B 5KAFC 2NYXA 3WTWC 3U9GA 2HOTA 4XOTA 3OYEA 3ABUA 3KP6A 1JKPC 3I4PA 1A35A 2L9RA 1K4TA 2VOOA 4UVBA 3OYLA 1EV7A 5E3MA 4WWCA 1BR4A 5F64A 4M3GA 2V6CA 1G8XA 3IKVA 3DBRB 5HODA 3GTMJ 4X1EA 2QF7A 3C18A 2BYVE 5F1RA 4DGWB 5A2QK 3L2VA 4OIQF 4E4HA 1S3JA 3AL0B 4EJWA 4HOBA 3VODA 1MBKA 1R1UA 1I39A 3IRQA 1AU7A 3IH2A 2F5EA 2WB1A 2R92J 4UNOA 1KYZA 2F4OB 3BR6A 3FMRA 2XPVA 5LEKA 1G2HA 2V1XA 1SAUA 4PDKA 1UZCA 2HS5A 1XMKA 3OYKA 4RB1A 4J01A 3CQZJ 2X6XA 4M9ZA 4GDFA 1QQIA 4Q48A 1F9NA 1LEAA 3Q9SA 4DYRA 4BKXA 2Z1DA 4RLQA 1QGPA 2M5WA 3BTCA 2K02A 5ILSA 4IQ4A 3ISPA 1IC8A 1J2XA 4G7HF 2V1DA 4ABZA 2L0KA 3MVPA 4XBFA 3R6SA 1ODDA 1IGNA 2STTA 2XAFA 2IEKA 1GV2A 3HKZA 5LFAA 2WAQA 5FO5A 2K5CA 3EUAA 1YITI 1BM9A 1RUOA 1H89C 2BE5F 3OYIA 2PMZA 2CQ7A 2IS4A 2VN2A 3OIPA 1BW5A 1BIBA 3FDYA 1HW1A 3FISA 3G6EI 2DW4A 4HF2A 2EIJH 4PGGA 3CO6C 1B8IA 3HDDA 4RB2C 1UB9A 5JVGF 2KJBA 1WH7A 4BE1A 3TKYA 5H20A 3W2AA 2YUSA 4EJTA 4I76A 2LY2A 2GXGA 3BCAA 3DPUA 1OFCX 1D1BA 4M3BA 4Z6YA 3V8LA 4A3MJ 4QSHA 3RCOA 5K7FA 5IT9Z 2DA5A 4XRMA 2R3SA 1RKTA 5B66C 2DBBA 2WADA 2KIMA 4LGWA 5FD6A 4BBSJ 3HKZN 4HNUA 2CQNA 2WAQN 3UR3C 2K40A 2HXIA 3QOPA 2NVQJ 1WJ5A 4G7ZF 2PMZN 3HOVJ 1MDMB 3GF2A 5HS8A 2JA5J 1LFPA 4A6EA 4C9YA 4L0ZB 3CCVI 4YIFA 1XDUA 3GBGA 3GFLA 3DV8A 2HR3A 2VKDA 4EJVA 2K9LA 2A5WA 3L1PA 2HQNA 2XASA 4UV9A 2Q2EA 2X6OA 3QU6A 2FQ3A 3O6BB 1D1CA 4U7DA 3ERED 3FKJA 2HFHA 2XF5A 3MWMA 2IBDA 1JJ6C 3LFUA 2QWWA 5LHIA 4XRFA 1S7OA 4D5FA 1OCPA 5EG0A 3IUOA 5FKMA 5J40A 2KLOA 1MBJA 5F08A 4BXUA 1E3OC 3ESWB 3GLXA 3W6KB 3L2CA 2F4IA 3ZQFA 2CUFA 5IP7J 4YFNF 1SFXA 3DPTA 1PUFB 4P5OA 4GXOA 5CPRB 2DODA 2OTLI 4LIUA 4BU2A 4HV6A 2EQRA 3IH3A 1K78A 4CCOA 4NNJA 1XTAA 2ZMEA 3R61A 2P7CB 5DTDA 4RBOA 3LSHA 1OCRH 3BPVA 3KLOA 4IPAA 5K1YA 2MYSA 3BZ6A 4OAZA 1KU3A 3F8BA 1WCMJ 3RYPA 2KDOA 2P5VA 2Y30A 3ZQQA 2JZYA 1ZAOA 2DOEA 2HTJA 4L9JA 1VQ8I 1IXSB 2KZVA 4I0BA 3QP6A 1A31A 3MMYB 1D0ZA 1ETKA 1WH5A 3H0DA 2J5OA 3KE2A 3JAMK 1HW2A 2LP0A 1KU2A 2R93J 3JR9A 1V4RA 2HKXA 4I01A 2F5FA 1Z77A 1FTZA 3BJOA 3CC7I 1FTTA 5J1RA 1XC5A 2HI3A 4RLFA 3RKYA 4CSWA 1E2XA 1V5FA 2GIZA 2KJCA 3VEPA 1FMWA 2P0WA 2X6WA 4M72A 1P2FA 4P9FA 2VC0A 1R22A 2NVTJ 4KNYA 4LJZF 1R00A 1SD5A 4B8XA 2EZLA 4BUPA 2Z33A 4EEFG 2ACJA 1Y0NA 5D5VB 1U9NA 3WTSC 1F5TA 2WY7Q 4ESBA 2LR8A 4HQMA 4PFOA 1U8BA 4FISA 1GUUA 5C3EJ 1QVUA 3OSGA 3LSJA 3S16J 5IP6A 2ELHA 2HDCA 1WHUA 2DMPA 2YR2A 1NHAA 4FX0A 5CVVA 2Z5UA 2DDAA 2LH9A 3OMYA 2BEOA 5GAEJ 4A5NA 1YTYA 4AWXB 1R1TA 1LE8B 4UVAA 4W97A 3DTKA 4N4OB 2P6TA 3WODF 4OIPF 4IHVA 1K83J 1VQLI 1B6AA 2DOAA 1XCVA 2R7FA 3LAJA 2NVYJ 3VYRB 5TISC 4YELA 2MC4A 3S1RJ 3FBNB 1A6IA 4ZYEA 4C2MJ 1LVAA 3GFJA 2R4GA 4QPQA 4CCKA 5E3NA 2GXBA 4NB5A 2AQFA 2B63J 1UAAA 4Y3OA 5EG0B 2A68F 2O3FA 2Q0OA 5BS6A 3R0AA 1UFMA 1G3TA 1ZHFA 1TWAJ 3BR5A 1E0EA 1F43A 3P9CA 1N77A 2VI6A 2DJNA 4A3CJ 2EFWA 2YU9J 5CLSA 3BG7A 2M45A 3AG1H 1QZEA 1V3FA 2XV4S 5E79C 3TO6A 4IVNA 2JA6J 3RPUD 2BXYA 3GTLJ 4AM3A 1XN7A 4HSTA 3GCMA 3M3YJ 3OOPA 3H5NA 2XAHA 2XPWA 4B44A 1TL8A 5H2FC 1MMAA 5LGTA 3SQNA 1MKMA 5D5XB 3G73A 1U8RA 9ANTA 3K1MA 1G3YA 1J09A 2CSOA 1BI3A 4NC7A 3HUGB 2KQRA 3SZGA 1WKMA 5K5RA 3J7AO 3FXQA 5FKLA 3CP8A 2UXNA 3K6GA 4IX7A 1ZQ3P 1CQTA 2X51A 5B5EC 4A3KJ 1O4XA 3HHGA 5FJ8J 5LGUA 4BHPA 4DZPA 1R49A 1YW8A 4MFDA 3JRCA 2XAQA 3CDHA 2BW3A 2MBFA 3FK7A 2M3AA 1L3LA 1YHQI 1T95A 2OV7A 3GZ5A 1J75A 1BR2A 1YW7A 1NK2P 1I3AA 4BACA 2VONA 3BR1A 4BE0A 3LSGA 2BY2A 2P6SA 1Z0XA 5D6FA 1V55H 1A04A 2FU4A 2NNYA 2A6TA 4KIBA 4QIWN 2VPLA 5J47A 3SJMA 4ZDOA 1X1BA 1AA7A 2XIGA 4BEHB 1JI8A 4LK0F 2V7FA 2F6CA 1Z7LA 1J59A 1R5HA 2VODA 1W7PB 4KIGA 3ZQGA 3MAJA 4KT6A 4XKWA 2DDBA 4XRSG 1DUXC 2LSOA 2VB6A 2CQQA 2NS8A 4CO8A 1V5EA 3KEOA 4E7ZA 1FYLA 3K0LA 3M1EA 3SXYA 3IAM2 4AC0A 3BJAA 1HSJA 1RZ4A 3I9V2 3RKWA 4GO1A 4BDZA 2VXZA 5C44J 5EF6A 4RGSA 1EJ9A 1AKHB 2OZUA 3JTGA 1NH3A 4D0PA 1B1BA 1FEXA 4F93B 3V7CA 1LVKA 1W5TA 2UWMA 3NEUA 3GO5A 2IVMA 5DDGA 2VBYA 3J7ZI 5DUKA 4DBQA 3P9IA 5J6XA 1ON1A 3AG2H 2G7HA 3M7GA 4MLOA 2D45A 2RQPA 1E3HA 2E1CA 1DPUA 2H6CA 1WSUA 1QHHD 1ZELA 2OTJI 1UG0A 4N4NB 1SVMA 5ILVA 3F0CA 1IDZA 1G59A 2Q1ZB 4E70A 1BI0A 4BBRJ 1XSDA 3LWFA 4JX4A 4KMUX 2G0EA 5HDNA 3WGHA 1QPIA 4D7MA 2KKOA 3LMMA 4FETA 2R5ZA 3ZQCA 1YLFA 4E6KG 3QPTA 2GXAA 2A05A 2H94A 2DFIA 3G1OA 5F27A 1VZ0A 3K70C 3CUQA 4R1HA 1Z3YA 2H1KA 2ZJ2A 2VKEA 1MMSA 3EUKL 1RR8C 3O8HA 2MH2A 2X9DA 3OR1C 2M30A 4GRIA 4J19A 2Y31A 2GWRA 3I3LA 1T38A 4PJJA 1MMDA 4HBLA 1MBHA 1ZH5A 4A3GJ 3CLQA 2KDZA 2QQ9A 1RIOH 2XGDA 4AVPA 3H92A 3HGGA 1FC3A 2WTEA 4WXDA 1WI3A 1VQKI 3W6VA 4HAMA 1HKQA 3QYFA 2GZWA 2LF7A 1DPRA 1KU7A 1X19A 3A02A 4OAYA 3TDZC 1T6SA 3FK6A 5ILUA 2F5DA 3OIOA 2JA8J 4A3BJ 3T5XA 3KETA 4A12A 1ZG3A 4FE7A 1Q1VA 2K3PA 3BROA 3FWEA 3HOZJ 3CZ6A 1XB4A 3QODA 1O3RA 2CWEA 3BZKA 3H1CA 3R60A 4ZDLA 5JLWA 1OCCH 1RKWA 1ERDA 4OINF 1ETVA 2E1MB 1IRGA 4O3MA 2IS6A 1BR1A 1EH8A 3VB2A 5JFRA 2LBFB 2MW8A 5E8IA 3S3NA 2LDUA 3AG4H 2R7TA 1EA3A 1CF7B 4GCVA 3K7AJ 1J5YA 2CW0F 5L3FA 1YX3A 3FIWA 1IXRC 2HVRA 1PP8F 2FBKA 2YX7A 2LFBA 2H8RA 2DFEA 4PJLA 2AHQA 1GDTA 1MSEC 1Z9CA 4Q5SF 1ACIA 3CCQI 1I27A 4FTHA 1IUFA 1KQ9A 1Y8QB 2FUG2 2W1OA 1JTYA 2O8XA 4RS8A 3LSTA 1TQPA 5J4VA 4K2EA 3DLLF 3FXOA 1WJEA 1CGPA 1G3WA 3K1NA 1B9NA 2HKOA 3OYFA 3WTVC 2RN7A 2JJ7A 3S2DJ 3G1MA 2E1OA 1VQNI 1MIJA 2GAUA 2M8EA 3S2WA 2CS3A 3E0JB 4ZYDA 2L7KA 1YOVB 2ECBA 2QKLB 2PFBA 4EV0A 1SD7A 4NQWB 2HYFA 2VQGA 5EGOB 2VKHA 1NK3P 2ECCA 2FNAA 3F8NA 2L4AA 2CYYA 4CZZA 2DFFA 4M9XA 3ONQA 2K85A 2KIFA 2IRFG 5TJJA 2V9PA 1B72A 3S3MA 2EFPA 1JTXA 3BOQA 5BPDA 1FOYA 1FT9A 5FLMJ 4Q47A 5F6FA 3JCUC 3ZMSA 5K5OA 3KYDB 2V26A 2HGCA 4KN7X 1RUNA 5JHFA 1IDYA 3HRUA 3S93A 3ZMDA 3HIFA 3RKXA 3FMSA 2NAZA 3RQIA 2PJRB 2Y0SN 1N75A 1FOWA 4M6VA 1BJAA 4L9TA 4BY7J 1OKRA 5J8FA 2ZFWA 2PN6A 3ZXSA 1MW7A 2V1NA 1WWXA 4ASNA 3KZYA 1P4WA 3IP4B 5CJ9A 4R8HA 3ML6A 3I56I 5M5WJ 1MNEA 2M9HA 2AS5F 4F55A 5L3BA 3F9KA 2A6EF 1I6XA 3QP5A 1P4XA 3ZPLA 3DKYA 4EMSA 4OMYA 5IT3A 2H27A 1JJ8C 2OBPA 1SEUA 3H0GJ 4LMYA 3RJPA 3ZCOA 4BNCA 1HSTA 1UHMA 2KZGA 3HB9A 1YW9A 2DI3A 2R0QC 2HOSA 3BZCA 1Z05A 3D0SA 1X3UA 3KZIC 2P5LC 4G6TB 5CKTA 2VASA 1IG7A 2E7XA 1ZLJA 2HWVA 2W4SA 5DCMA 2EFNA 2ZBKA 1SANA 4I98B 4WXHA 5EEHA 1TQMA 4QWQA 1S5LC 1TBXA 4M3EA 4HNTA 3HOWJ 2KL4A 4XNFA 2I8DA 3L2WA 2G7UA 1F4KA 3H3VK 4HQEA 2LMDA 1O7FA 1W1WE 3I4NJ 5DM7F 2AQEA 1U5TC 2G9WA 5FD5A 2ME0A 4B3AA 1Z6TA 3AG3H 3OYJA 5DUIA 2R7XA 1FYMA 4G94A 1LDDA 4ZYHA 2QEXI 1X4OA 2X0LA 2F2EA 2E2IJ 3KCCA 1X4PA 2R7DA 5J3LA 2XPUA 3HRTA 1IAWA 2IS1A 1STZA 2NOJB 2VL8A 4P9UA 3A01A 3IL2A 5LEJA 2R7VA 1OMIA 4D9JA 2CO5A 5H6QA 2IP2A 2MC3A 2P81A 5JHUA 1TT5B 3JRBA 2XAUA 3QU3A 3OYAA 2HQ5A 1YS6A 3KYCB 5K7ZA 4Z2YA 2PQ8A 3PIOF 5FLXZ 3OY9A 1WJFA 3WE3A 5J1UA 2DMQA 5FFXA 4L9NA 4A2UA 1VF9A 2YSRA 1H9GA 1Z91A 5ICGA 4IKFA 3WG9A 4FT8A 1FBUA 3W3CA 4BQAA 2GQQA 3OL3A 2E2JJ 3IC7A 4E7LA 2DA3A 3KP3A 3WTZA 1VQ5I 2CJJA 2L2OA 4DQ2A 5DM6F 1UHSA 1MH4A 1PUEE 1A6QA 3ZMZA 4G7OF 4V2FA 1LNWA 3EDPA 3J81K 2R5YB 1FSEA 1IJWC 4CCMA 3OYBA 2DYRH 1ETWA 4A6DA 1EKEA 1XCBA 3GYHX 2CV1A 4NC8A 2V6EA 3ROUA 2FEZA 1MMNA 3GZNB 2FRHA 1QHGA 2KIQA 4BH9A 1G4DA 1BJZA 3RPUA 3W2WA 4EM1A 2XGEA 3OYHA 2MLKA 1P7IA 1VQPI 3A0HC 3F8MA 3SZTA 3CD6I 1HA8A 2W85A 2DXIA 1BBYA 2DPUA 5HS7A 3RKQA 1ZREA 2KHMA 1Z1DA 3FM3A 5H6RA 3WTYC 4BGDA 3OV8A 2DCEA 2K7LA 4II2A 3SDGA 5LRSA 1TWCJ 2O6GE 3B02A 1T0FC 3BPXA 2DFHA 4I09A 2Z9OA 2O03A 5EDNA 2XROA 4XLEA 2QCOA 3VSLA 3CUQC 2J5PA 4XM3A 2HQRA 3CUOA 3HRMA 3EYYA 2HVQA 2GLOA 1R7JA 2FBHA 2L54A 3DU6A 3F8CA 1JXSA 4V2GA 4UV8A 5HS9A 4LB5A 4W1UA 3ZQLA 1DQUA 1A36A 3ASNH 4LITA 2LKSA 2M1BA 2JRTA 3CCUI 1I3QJ 3ZGKA 3G1LA 4XKBA 3FKIJ 3TW7A 3NQOA 2HTSA 3CJRB 1YIOA 2WV1A 3HSEA 1I50J 3LA7A 3M8FA 5KHDA 2L5QA 4HA8A 3G3ZA 5ICCA 1SFUA 4Y15A 2COMA 2XSDC 2F4MB 1XG1A 4DW6A 3CMAI 2R7ZJ 4HLXA 3K4LA 4KN4X 1VI0A 3F72A 1LDKB 2D2WA 3GTQJ 3KEQA 2W24A 4IEJA 3I54A 2FXAA 1QNTA 3K69A 5FKKA 1LUJB 3JREA 2RVCA 2PMUA 4YIRX 2HXOA 2M87A 2P5KA 1SVLA 1IW7F 2QLZA 3FBIB 3EPZA 3NAUA 4U0VA 4XLCA 4FCYA 1SAXA 4JQFA 2DQRA 2QBYA 2DOFA 3MD2A 3V8JA 2DYSH 5CVRA 1GXPA 3BQYA 1OCTC 3B6AA 4NBQA 3OS0A 1Y56A 2ZSHB 3FX3A 2X1CA 3BTIA 2BHYA 2XSJC 3JRDA 2IAIA 2ZC2A 3ELKA 3M8EA 3PNTA 5F04A 3PQKA 2WAEA 4BQQA 2GBYA 2JPBA 3GZ6A 1XSXA 3U21A 3BT9A 4I99C 1DGWY 4C2UA 1R1VA 4KT5C 4CDGA 1LFUP 1LEBA 4XLAA 5J1YA 1Q1HA 2NS7A 1TNSA 2ZXJA 4IRHA 4ON0A 2VOPA 1UMQA 3T8RA 4EQQA 2QGUA 3EUHC 1HF0A 3S15J 5L3EA 2H8WA 3J80Z 3TGNA 1FBQA 5D5UB 3DXJF 3LSPA 4OIOF 2B9SA 2EV5A 1R5GA 1V54H 3MKWB 5KCMA 3ZQHA 3CP2A 4OOIA 4HF1A 4XIDA 4QLCU 4GYGA 4A0YA 1AHDP 3L2UA 2B0LA 5LD2C 4P96A 1Z6RA 4BS9A 5HOOA 4PGHA 4DBRA 4DZJA 4IHWA 2M0MA 4KIFA 2PJPA 3T1BA 1RESA 1Y0UA 3A1YA 3JSPA 2GM4A 3LAPA 4ZTFA 2EINH 2IGMA 2KRCA 4D1QA 4AIKA 1BI1A 1W0UA 3FM5A 3MKZA 3G4SI 1ZG1A 4MGRA 1JHHA 3I4MJ 2OZ6A 1SMTA 2P8TA 3E1SA 2R7OA 1RETA 5CYVA 2M34A 1PDNC 4BXXJ 3OR2C 3R0JA 2W00A 1MJ9A 2JVHA 3WGIA 2IS2A 3L9FA 1JKRC 1RPWA 4KYWA 2NNNA 2OF7A 2HQAA 1B8IB 2Z2SB 4BY1J 3KPHA 4IHSA 3D5SC 2EPFA 5E1ZB 5JLXA 2PI0A 3L2QA 4ETSA 4XLNF 4G6QA 4ZYGA 2YS9A 3MKLA 5GPAA 3TEDA 3FXJA 1W5SA 3I0TA 2AXLA 4RA2A 2WWYA 1DU0A 4AIHA 2EK5A 4PUSA 1APLC 4PJMA 1J0RA 1FWZA 1HDPA 1HKSA 3QQAA 4WF2A 4U88A 2L7ZA 1WI9A 2EBIA 2FOKA 3JTHA 5BQTA 4ZJZA 1D5VA 4A0XA 1S7EA 1LFBA 3HGYA 3S2HJ 1GV5A 3CCLI 1ON2A 2ZJQF 5AIPA 4ZC3A 3J7YJ 3DEWA 4YIIA 2EWNA 3F3XA 2Y0MA 3GEZA 2E5NA 2E60A 2LY9A 4S04A 2DA4A 1K61A 4CICA 1JUPA 2VKVA 2A07F 3ERMA 3QPSA 1OCZH 3K4JA 3LQQA 4M3DA 2Q2EB 2OQGA 3KIOA 3PSIA 2ETHA 2DT5A 5D6EA 1IXCA 2EFQA 6PAXA 3GX4X 1RC9A 3K4NA 1ETYA 3TW6A 4A3DJ 2OC6A 1L0OC 1R23A 4HF0A 2ZJPF 3CCEI 4IZZA 1VQOI 2KRFA 4EM0B 5EZHA 3H9JA 2Y2ZA 2L4MA 3L00A 2ESHA 5IOZA 1JUMA 3A2KA 2TRTA 1V5GA 1FIPA 5GTHC 4XLHA 1SFKA 5LHHA 2OUMA 3ABLH 1OCOH 1H88C 3OYDA 4Y7NJ 1K78B 4A3LJ 1R5ID 2ZMEB 3ECOA 2QQ8A 5EYRA 4X6AJ 3D5LA 4WK8F 2M2EA 1BL0A 4UB6C 3PM1A 2DT7B 3E6BA 4LD5A 3LOCA 4I02A 1D1AA 3EYIA 1ZGJA 1IF1A 2FQ4A 5JVTA 5GTIC 1ZGWA 2JN6A 4DNCA 1YJWI 1B4AA 1XMXA 3V4GA 5L3DA 5FROA 4BHCA 3QRFF 1MH3A 2H6BA 3L7WA 3QAHA 4NHJA 1KQ8A 2DA6A 3GLLA 5M5XJ 2JT1A 4MQ9F 1U5TA 3KP5A 5DD4A 2BBYA 3OWTA 3WTUC 2FMLA 5E1WA 3A03A 4E7SA 3TQNA 3WTXC 2GA2A 2LK2A 1JE8A 3C3WA 2VQCA 3RZOJ 2Q8KA 2FMYA 1QU3A 3E5XA 3D1NI 5LHGA 5M3FJ 2IXSA 3CLOA 3WHCA 1I1GA 3CCMI 3IWFA 2L02A 4R79A 4XSZF 3OYGA 2NVUB 1LDJA 2JTVA 4CXFA 3LNQA 4EJUA 1IV6A 3QPHA 4FQGA 1AWCA 4AVZA 3O3KA 4LLGF 4I6ZA 4A3FJ 1P7JA 2X6YA 4MHGA 1D3YA 2ZXIA 2IPQX 3HYIA 4KISA 4CYCA 3WTTC 4CA0A 3GUDA 1WJBA 1QVTA 5ED4A 3CC2I 3HPGA 1ENHA 4J00A 3GW2A 1IO2A 3PNVA 4XORA 4MTDA 2LKXA 3TBIA 3K70D 1GHCA 1MD0A 3HOTA 3IAS2 1ZARA 2RAEA 2VQLA 3E6DA 3HTUA 5GP9A 2K9SA 2X85A 3CCYA 2EA2A 3S17J 3F8FA 4OU0A 2BZTA 5IOYA 1VFCA 2LNBA 1ZRDA 4PFPA 2JQ7A 2TCTA 2XF6A 2VUMJ 1W4MA 5LLQA 1YI2I 2C6YA 1OYIA 5F0CA 3Q0VA 5D5WB 2QM3A 4F3QA 5F0HA 3A0BC 1OYYA 2KPMA 3HL2A 2XDVA 2FX0A 4BQOA 2E5ZA 3GTOJ 4CZCA 1SD6A 4XN0A 2JPCA 2V79A 4N9HA 1D8JA 1YIJI 3I59A 2CFXA 3SFIA 4UVCA 2OA4A 2RQQA 3MZ8A 3GTGJ 4IRIA 3COAC 3CO7C 3Q0WA 1T0FA 2O8KA 4MIMA 4RAGA 1QZYA 2W48A 4BL0B 3BG5A 2F48A 3TOAA 4B3XA 5HNFA 2EV0A 4AD9A 4CGZA 3S1QJ 1HW5A 2OU2A 2UUZA 2L7FP 1WVRA 3M1CA 3DTEA 2JK3A 3I5UA 4EGZA 3OOUA 4LG0A 5FLXK 3TMOA 1WPKA 3CESA 2VC1A 4KICA 2EILH 3H9QA 4U0WA 2BY0A 1YRNA 4M3FA 2PX9A 1OLTA 4RGUA 3M07A 4XLFA 1HC8A 1O3TA 2AO9A 5HDKA 5HLTA 2BW3B 2CQXA 2VJJA 1IRXA 3IKTA 4LG3A 1KA8A 2K4JA 5FKOA 3N97A 4MEYF 2OD5A 2DLLA 1O57A 1K79A 2EJRA 1YX5A 3ZQIA 2JSPA 1SFEA 1PYVA 5LGNA 1VQ7I 1ZLKA 1BIAA 5CVIA 4WCGA 2W7NA 3HTSB 2NRAC 4CCNA 1MBEA 3GMEA 3S14J 4CYCB 3TL4X 3OSFA 3LSIA 4M6XA 2E2HJ 3PJRA 2MFZA 4RB0A 4HRIA 4A69C 1FOKA 4BJ6C 4S05A 3DP7A 4QPOA 3DEEA 4NUBA 4CHUA 2CW8A 2XKPA 3VPRA 4AYBA 3U1DA 3ZOBA 3DFGA 1TP4A 2HDWA 3OS1A 2LVSA 3HEFA 3IRRA 1OQYA 1AOYA 2QYOA 2XHKA 2EIKH 3LA3A 5HLIA 1IN8A 4I0AA 5E18F 2QSHX 2K3FA 4HX7A 3HJEA 2E7WA 1X2MA 1D0XA 3O8GA 5KVRA 1JT0A 3JW4A 2JUGA 1W7PD 3EUHA 3REOA 4UB8C 5IP9J 2XAJA 5LBQA 4CCLA 3GTJJ 2QSGX 2LD5A 4MO7A 4HDVA 4YEJA 2DMUA 2VQHA 1ULYA 2MD0A 3ZRGA 4YRVA 1NG7A 2Y0SA 4EVIA 3CF2A 5DD8A 2RC4A 3C2HA 1BA5A 3HHHA 1VQMI 4IOAF 3I59B 2DPDA 2DA2A 1Z7UA 1WGXA 1P9QC 3H35A 4B4CA 2R5ZB 3TOBA 2LG4A 4AYBN 1QPMA 5ERIA 2P7VB 2ISYA 2LYCA 3LSKA 3BJ6A 5IT9K 1W5CC 2MGQA 2CUJA 3HSRA 3B73A 3LQRA 4HG2A 4CCJA 4RAZA 3CUQB 3HZJA 2MLGA 3PO3J 3MKYB 3IHUA 4GFBA 1FJLA 3OS2A 1KU9A 1REPC 1BC7C 3DBHB 5CVUA 2VT2A 3HM5A 4LG0B 1FNNA 2COBA 3S32A 1LPQA 1DU6A 4P1WA 1FBSA 3AFHA 3E6MA 2ZXWH 3HC7A 4LIVA 4PZJA 1BI2A 1EH6A 2ZFUA 3DPLC 2XUBA 1IN6A 3EQLF 1HCRA 1EF4A 3I58A 1E3PA 4E7JA 5HDGA 3U1KA 5BMZA 1XGMA 2QA4I 2R7QA 3MZHA 2D1VA 4G9YA 2MABA 2KT0A 3HBLA 5KAIC 5E3LA 5IY5H 3BLYA 4PJNA 4OIRF 1PP7U 5K7HA 3A4CA 3BQZA 4MEXF 2HNHA 1Y1VJ 3PQJA 3LA2A 1HXDA 1F1ZA 2EZHA 2PG4A 3TO7A 4IHYA 1ZTRA 4JK1X 3MEXA 1Y1WJ 1XSVA 1RRJA 2VE8A 5DEQA 3K1PA 2X1EA 3AKZA 3V42A 3PL8A 4RGRA 2CH0A 1W36D 1HDDC 3DBLB 2ESNA 1VTNC 3UNGC 5LRRA 1IV8A 3OYNA 2PLYA 5D4RA 1IRFA 3MFKA 1YQAA 2DN0A 2I10A 1VQ6I 1H9TA 3JRAA 2E34A 2CW7A 4BQNA 3SDBA 5E20A 3DWLE 1ITYA 3X2QH 2PEXA 4AIJA 3Q0UA 4B47A 2JSCA 2RGVA 2TDXA 1WZ2A 2DQLA 1HOMA 2K27A 2XB0X 1GVJA 5FB2A 2EA4A 4I7HA 3W6JB 4ESFA 4ENKA 2DO7A 4F7ZA 3ASOH 5TRDA 3FZVA 5GPCA 2M8GX 4LOCA 1YO5C 1HBXG 1ZGAA 3CMEI 1P4AA 4L0YB 1ETOA 4HLYA 1ORKA 2V9VA 2IJLA 2X4HA 3JSOA 3CCRI 3BC8A 4M74A 5FLVA 1Z67A 2XC7A 4KMFA 1O7LA 2VJ5A 2QENA 1PVEA 2R7UA 3W2VA 4G8XA 1W36C 1SMYF 1P92A 2VT3A 2UV1A 1FYKA 5FKNA 2GIVA 5ICFA 3D5RC 3E7LA 3F6VA 4YG2F 3LFKA 1QBJA 2ME6A 1B72B 1FPQA 2XVCA 2RV8A 3J7AY 5IYBJ 2LRDA 2M4GA 2EZIA 3SFZA 3N05A 1K6YA 1XGOA 3CTAA 4ITVA 2ZKZA 3KP2A 5E1XA 5C4JJ 4A3EJ 3V8KA 1H0MA 4DJAA 3QYBA 3FHZA 3ZP5A 1MDMA 2E1MC 1S29A 1T56A 4B43A 5FRMA 2KP6A 3ECHA 3HOYJ 5IYDJ 3OYCA 2OPTA 1TW3A 3DKWA 4LLLA 5E3OA 1MJAA 1RNLA 1X58A 4YFKF 3KLNA 1ZN2A 4L5IA 4LB6B 4C3IJ 3PIPF 2VE9A 3ZR8X 4U0YA 2OAZA 1JKQC 3DTIA 1KQ0A 4RB3C 1D8KA 2HPIA 4Y33A 3KEYA 2FNPA 2QSFX 2QUFA 1OR7C 2FBIA 1USTA 1RR7A 3FXKA 2JA7J 3K2ZA 2ID3A 3VFZA 1FY7A 4UHTA 3CJTB 2H09A 2Z3YA 4B48A 2HYGD 3DKXA 3N4MA 2FA5A 5GADJ 4IHXA 5DS9A 4CUGA 5DCMB 1PUFA 2CV0A 3HSFA 1OPCA 2UXXA 4KITB 4KA4A 2WV0A 4XK4A 2DK8A 3LL7A 2NS0A 5ICEA 3VDXA 2H1LA 3BCBA 3ABMH 3AAFA 3CCSI 1FOXA 3S1MJ 4A93J 2IA0A 4HNVA 4EJOA 4KJZA 3RDIA 1T2KA 4OWRB 4DIQA 3CDIA 4XLPF 5IYCJ 5CQEA 1GVDA 4CH7A 2D5VA 2WA0A 4HX8A 4E7HA 1UG2A 3WU0A 5B1BH 2JVGA 4BJ5C 3C2GA 4XL9A 2CFOA 2ZSIB 3CDLA 2BVLA 3A01B 4C30A 4P55A 4JYKA 2XB5A 2ICWG 4ANJA 4HW0A 2BVMA 2WB1N 2IA1A 5E8GA 4XN3A 1QO0D 1S7AA 3BG6A 1KZHA 3SYTA 4X0GA 1WFXA 2DMNA 3RZDJ 2OJED 3RYRA 3P5JA 3FHNA 3ZQ7A 2IW5A 1R36A 1G6NA 1XGNA 2EZKA 4PCQA 3QWLA 5C4XJ 2FF4A 4I2OA 2MA3A 2L01A 3HPHA 1ZR2A 2LY1A 2I5UA 4S0HB 3H3ZA 2Y75A 2DMTA 3FXMA 2OCEA 3H3UA 1O3SA 1R58A 5EZGA 1U6GA 1K4SA 3ZMUA 2YPRA 1ZYRF 1TNTA 1MGTA 1IN7A 2IT0A 1Z3XA 5B1AH 4OMZA 1WQ2A 3UKGA 3G71I 2E19A 2CMPA 4M9SA 3K2AA 5M5YJ 5EEGA 3ABKH 1LE8A 5D4SA 1KYWA 2V4JC 3S3OA 2E71A 1OISA 2DTRA 4GGGA 4II3A 1YFHA 3BR3A 2KMUA 1FZPB 3QYEA 2W84A 1SD4A 2W82A 3HOXJ 2K9NA 4FASD 1P6RA 2BHZA 2A3SA 2BV6A 5DYMA 2F5VA 2CUZA 4M71A 5DCFA 2HPMA 2LKPA 1DGRM 2CQKA 2DK5A 1DDNA 4E7IA 2DJIA 4LLNA 2IGKA 5HNHA 1F36A 4FHTA 3CF5F 2JMWA 2DA7A 2MSYA 2O5RA 3BG3A 3P9KA 1I5ZA 4XSXF 1X1AA 2FE3A 3V7SA 2LLKA 4RAYA 2K86A 1LKXA 1SC7A 1YYVA 3CJNA 3IH4A 4KUMA 4BAYA 4IQJA 3C2BA 2CUEA 2O9LA 4F92B 2HDDA 3FXRA 3SEZA 3B6CA 4PJ0C 3F21A 3S1NJ 2KRHA 4EATA 2W25A 1IZ1A 2WBMA 3HG9A 5EEAA 1MBFA 4HDUA 1SVOA 1U3EM 3HUGA 1D0YA 2L9SA 4AU7A 4IOCF 2Z99A 2FOWA 5CVJA 1R6RA 2XGCA 4HX4A 2DA1A 1LJ9A 4H0EA 4ESJA 3AL0C 2QBYB 1E17A 1FSHA 5FFZA 2FD5A 2WAFA 2DTZA 3E3VA 3HRSA 4YFXF 2IA2A 3K4BA 2CRGA 2R7SA 4IF4A 2ZO4A 3WU1B 4BE2A 2LF8A 2WY8Q 4L5JA 2ZB9A 3IV5A 2ELKA 1S6LA 2YX4A 4XR6A 3WE2A 4ZH4F 4BJTA 2Y69H 1ONVA 3H5AA 1ZG5A 3HXLA 3JRIA 4BYYA 2XAGA 5A2QZ 4E7KA 2KIUA 2D1HA 3K4MA 1S72I 3BTJA 4LFUA 4XKVA 2LREA 2ZNYA 3K9TA 4BEHA 4HV5A 3J81Z 1JGSA 2KFDA 2JUCA 2V1UA 3DEUA 1W7PA 1HQCA 1A5JA 2RKHA 5JR3A 2NXNB 2BY3A 3FXLA 3MQ0A 1DP7P 2A6HF 3CMMA 1UJ8A 3SZPA 1ETXA 3E5UA 3WHBA 5BNGA 2K9MA 2R7WA 4C3HJ 4XONA 2ID6A 2DAOA 1ZR4A 1AKHA 1FP1D 1UCRA 3RIRA 1JKOC 2VLAA 3MN2A 2K9QA 1VNDA 5DV5A 2LC2A 3SHFA 3BDDA 3WGGA 1YE9A 4XMYA 1ZK8A 3IWZA 2BXZA 5BOXA 2AXTC 1QA6A 3P7NA 3RPQA 3VYTB 2V9KA 1U2WA 2L9VA 2VJIA 3R4KA 1R71A 4NC6A 2KISA 2N8GA 1X1CA 3I64A 5HVQC 3JRFA 4FX4A 4QTRA 3ABTA 1N78A 1T8IA 1XDSA 3JRHA 2HZDA 2VBWA 2GOXB 4UUSA 1XD7A 4MNUA 3L09A 2QQAA 1OJLA 4KDPA 5F1JA 4UUVA 3M4OJ 2XRLA 1TTYA 2NVXJ 2BOLA 1TLHB 2E35A 4Y52J 3RQ4A 1FIAA 3QPLA 2EH3A 1NTCA 1Z21A 3M8JA 3PO2J 3PNYA 3ZN1A 1X1PA 2RREA 3KYLA 3NWSA 2ZNZA 3TO9A 4IL6C 1X1DA 5L3GA 4ENNA 2F5CA 2FSWA 1UHWA 2QVOA 1TW2A 2DU9A 1YS7A 2MH9A 3K4CA 2JWTA 5J8CA 2Z16A 3RTRA 4UXNA 1QRYA 2L3DA 3BWGA 3Q9VA 1ETQA 1WJAA 2HOEA 1FX7A 4IO9F 2LBFA 1IN5A 3F23A 1U0JA 2L7MP 1PJRA 1CF7A 1TWGJ 2OCCH 3K4KA 1N25A 2BY1A 1MSFC 1IN4A 5FRNA 1QZZA 4AIDA 3DLAA 3GTKJ 1C0WA 3GFIA 4RM2A 2XRNA 3OIQA 3C1DA 4Q4ZF 2O61A 2PBIA 1MJBA 1BC8C 2HVSA 2CV2A 1XS9A 2VBZA 2ZXHA 1YJNI 3ZMVA 3E97A 2E36A 3O2PE 4F52A 3L2RA 4ZZLA 3PFIA 5L3CA 4EM2A 1OR7A 2RNJA 3VWBA 1JT6A 4Y13A 3Q5FA 2GA1A 3VOEA 4XKCA 1FLIA 5J4YA 3MZYA 3BY6A 2XF7A 3JRGA 3KFWX 4Y17A 1HLVA 2M0CA 2VJ4A 4PSWA 2UZKA 3JAMZ 5HLGA 2JRMA 3GFMA 5B3SH 1U5TB 1TT0A 4NQWA 5EGOA 1D5YA 1O3QA 1T39A 2QZ8A 4V19K 2ZCWA 5TGTA 3I55I 4DYCA 4G6DA 3CJQB 1TC3C 2Y9YA 3WU2C 3PFYA 4AUXA 4HZFA 4XOPA 1MNDA 2VBXA 4UUSB 4ENJA 1J7KA 3FF5A 3H9GA 4JOMA 4C2TA 3M9AA 4UY8I 2DT6A 1YJ9I 1VQ4I 4G12A 5EJCA 4XRSA 2Y9ZA 3KP4A 4HPQA 1IUYA 1DP3A 4HEA2 2E1NA 3H5RA 3OYMA 4JP0A 1YG2A 2B7EA 1H8AC 2O0YA 1MBGA 3I71A 2NOGA 3I53A 5GAGJ 4D7NA 3VYSB 2EFOA 2HZTA 4IJAA 1FP2A 1B9MA 3QOEA 2IGOA 3BP8A 4U7BA 4B1RA 4IHTA 2PJRA 4DOZA 4O6JA 1XMAA 4RMNA 5D8LB 4LK1F 1OYWA 1JUSA 3OL4A 3CMYA 3DQVC 1IRZA 2VXDA 2EB7A 5F0FA 4JX5A 4ENMA 2GOMA 4ZYAA 4HSRA 4MQVA 2ZMEC 3RSNA 3F22A 3GTPJ 3S8PA 5IPAA 1EH7A 1MZBA 2XKOA 2W57A 4RDUA 1U78A 4UUTA 3PUBA 4EGYA 4Y4RA 2ZJRF 1K7AA 3PSFA 3FXUA 1LQ1A 2CG4A 2ADUA 4M6YA 2VPRA 1SFOJ 3DCFA 2EV6A 1R4NB 3NARA 4O5VA 4D5CA 1LB2A 4BXFA 3F6OA 5AONA 4DYQA 2A69F 1XX5A 1FMVA 3TP3A 1U9OA 2IGNA 1WJCA 2VIXA 1I1SA 4XQFA 2WC2A 4A3IJ 3SEQA 4A0ZA 4WX9A 1KONA 3FMQA 1GLNA 1ZRFA 3H36A 4KFCA 2X1DA 3BG9A 4HYEA 2MD5A 2ELJA 4F91B 2BGCA 2QKMB 3LSMA 3E6CC 1BN5A 1T98A 3DU5A 1R4MB 1Y39A 4PK4A 1YRNB 3GXOA 2EIMH 3PUFA 2K4BA 2M4KA 3T8TA 3HOUJ 3MCZA 4L5EA 5HLHA 5D8KB 4NDLA 3EETA 3E5QA 1ZRCA 4ZTJA 1KGSA 4JBAA 1S8NA 5JI6A 2QQBA 1MNMC 1VQ9I 3NWTA 1XPXA 4RAFA 5BPIA 1G3SA 2P4WA 2STWA 1GXQA 5KNLA 1W0TA 1XGSA 1B59A 4GYIA 4WXCA 2R5YA 2JA2A 1X2NA 4H4KC 1I6HJ 1T33A 2LTPA 3J80K 1Y6IA 2OQRA 3G2BA 1USSA 5E17F 4U87A 3K10A 4IRGA 2MG4A 2CU7A 1POGA 2YU3A 4A5MA 2A61A 1Y8RB 5CQGA 4C3JJ 4JX6A 2HYJA 5K5QA 1HKTA 3BR0A 3CC4I 3LSRA 1TWFJ 3ZN0A 3TP0A 3VSKA 4PSXA 1JGGA 1TZLA 4M73A 1GT0C 1BOBA 1M1EB 1RI7A 3GWZA 4RM3A 2RNGA 3T0YA 1WJDA 3ULQB 1MMGA 1JHFA 1BOAA 3GVAA 4TV7A 4MFEA 1K6OA 1J9IA 1NG6A 1ZKGA 4CYDA 5FGMA 3HOSA 3U2RA 2RDPA 4A3JJ 3V7RA 1X3ZB 2PMHA
chains in the Genus database with same CATH topology
1BW6A 2O7OA 1WI3A 3W6VA 5EYRA 1TWHJ 4X6AJ 2M2EA 1BL0A 3A02A 4XICA 3PM1A 2JA8J 3FK6A 3LOCA 3UKGA 3OIOA 4A3BJ 2E19A 4FE4A 3BTLA 2FQ4A 3K2AA 1ZGWA 2JN6A 5M5YJ 4FE7A 1LE8A 1Q1VA 3HOZJ 3BR3A 2HOAA 1R9TJ 1MH3A 5JLWA 3HOXJ 2K9NA 1RKWA 2DA6A 5M5XJ 1ETVA 3A03A 3BR2A 2MW8A 2LK2A 2FJ1A 3K7AJ 3RZOJ 3FIWA 5M3MJ 3Q3SA 3D1NI 5M3FJ 3WHCA 2LFBA 2X48A 2H8RA 2AHQA 1GDTA 1MSEC 1F36A 2HOTA 2JMWA 2DA7A 2MSYA 4FTHA 1JKPC 1IUFA 3LNQA 2L9RA 3BG3A 1IV6A 5E3MA 1JTYA 2LLKA 4M3GA 4I6ZA 4A3FJ 1P7JA 5HODA 3GTMJ 4X1EA 2QF7A 3IH4A 4CYCA 3C2BA 2CUEA 1QVTA 2O9LA 2JJ7A 2HDDA 3S2DJ 1ENHA 3G1MA 2E1OA 3B6CA 2LKXA 3S1NJ 1MBKA 5EEAA 1AU7A 1MBFA 2ECBA 2RAEA 3IH2A 5GP9A 5EGOB 2R92J 2K9SA 1NK3P 2ECCA 3BR6A 3CCYA 3S17J 2XPVA 1G2HA 5IOYA 1VFCA 2XGCA 2TCTA 3CQZJ 2DA1A 2VUMJ 4DYRA 4BKXA 2FD5A 1B72A 1JTXA 3BTCA 5F0CA 2DTZA 3Q0VA 5FLMJ 1IC8A 4ABZA 2L0KA 3MVPA 2CRGA 5F0HA 2FX0A 1IGNA 2IEKA 3IV5A 1GV2A 2ZB9A 1IDYA 2ELKA 3GTOJ 1H89C 3RQIA 1BW5A 2Y0SN 3SFIA 4BY7J 4M6VA 3FISA 3JRIA 3GTGJ 3Q0WA 3BTJA 2O8KA 4MIMA 1B8IA 5M5WJ 2M9HA 3HDDA 2W48A 3BG5A 1WH7A 3S1QJ 2L7FP 1A5JA 2YUSA 2JK3A 1JJ8C 4I76A 3OOUA 1OFCX 4M3BA 3H0GJ 1WPKA 3HB9A 2R0QC 4A3MJ 2HOSA 1ETXA 4QSHA 3WHBA 5BNGA 5K7FA 4C3HJ 1YRNA 2DA5A 4M3FA 4XRMA 1IG7A 1RKTA 2ID6A 1ZR4A 1AKHA 2AO9A 1SANA 1JKOC 2CQXA 3HKZN 3MN2A 4BBSJ 2WAQN 2K9QA 1VNDA 2HXIA 2K40A 4M3EA 2NVQJ 3H3VK 3HOWJ 2PMZN 3HOVJ 2JA5J 5FKOA 3I4NJ 1ZK8A 3GBGA 4B3AA 2ME0A 3ZQIA 3L1PA 2X6OA 2E2IJ 1MBEA 3S14J 5J3LA 4CYCB 3OSFA 2XPUA 2E2HJ 3A01A 2IBDA 1JJ6C 4A69C 2N8GA 4D5FA 1OCPA 5EG0A 5FKMA 2P81A 3JRFA 1MBJA 3JRBA 4QTRA 5F08A 2HQ5A 1E3OC 3VPRA 3ZOBA 5K7ZA 3JRHA 4UUSA 2LVSA 3HEFA 3ZQFA 2CUFA 5J1UA 5IP7J 2DMQA 1OJLA 1VF9A 5F1JA 1PUFB 3M4OJ 2XRLA 2NVXJ 1X2MA 4Y52J 3O8GA 1JT0A 2E2JJ 2EQRA 1FIAA 3IH3A 2DA3A 2EH3A 3QPLA 5IP9J 1NTCA 3GTJJ 5DTDA 2CJJA 4RBOA 2LD5A 3PO2J 4MO7A 1UHSA 2DMUA 1MH4A 1WCMJ 4V2FA 2Y30A 2R5YB 1IJWC 1ETWA 1BA5A 1ETKA 1WH5A 2DA2A 2JWTA 2LP0A 1WGXA 2R93J 3JR9A 4B4CA 1Z77A 1FTZA 1FTTA 1QRYA 2R5ZB 5J1RA 1XC5A 4AYBN 2HI3A 1ETQA 2MGQA 1BJZA 2XGEA 3PO3J 2L7MP 4GFBA 1FJLA 1P7IA 1TWGJ 1MSFC 2NVTJ 3HM5A 3RKQA 2COBA 2EZLA 3GTKJ 1DU6A 3SDGA 4EEFG 1TWCJ 1EF4A 1U9NA 1HCRA 1XS9A 2LR8A 5EDNA 1U8BA 4FISA 1GUUA 5C3EJ 1QVUA 2QCOA 3OSGA 3LSJA 2GLOA 3S16J 5IP6A 4V2GA 1JT6A 2KT0A 2DMPA 3HBLA 5E3LA 4W1UA 3ZQLA 5K7HA 3BQZA 1I3QJ 1Y1VJ 3G1LA 3JRGA 3FKIJ 3TW7A 1LE8B 4W97A 1HLVA 2EZHA 2WV1A 1I50J 4IHYA 4IHVA 1ZTRA 1Y1WJ 1K83J 2M0CA 2XSDC 1XG1A 4DW6A 2NVYJ 2R7ZJ 3S1RJ 1HDDC 1A6IA 4C2MJ 1VI0A 5EGOA 1D5YA 5E3NA 3GTQJ 4IEJA 2B63J 4DYCA 5EG0B 3JREA 5FKKA 2DN0A 1TC3C 2I10A 2HXOA 2Y9YA 3JRAA 3NAUA 4AUXA 4FCYA 1TWAJ 3BR5A 1ITYA 4UUSB 1F43A 3Q0UA 2VI6A 2DJNA 4A3CJ 3BQYA 1OCTC 3B6AA 2YU9J 1HOMA 2XB0X 4G12A 4XRSA 2Y9ZA 3BTIA 3JRDA 4JP0A 2IAIA 1H8AC 5F04A 1MBGA 2JA6J 2NOGA 2GBYA 4D7NA 5GPCA 2M8GX 4LOCA 3GTLJ 3M3YJ 4B1RA 2XPWA 3BT9A 1ETOA 1ORKA 1LFUP 5J1YA 2NS7A 1IRZA 1JUSA 3CMYA 9ANTA 5FLVA 5F0FA 4JX5A 1UMQA 1HF0A 3S15J 3GTPJ 5IPAA 5FKLA 4RDUA 3LSPA 1U78A 1ZQ3P 5FKNA 1CQTA 4UUTA 3ZQHA 3E7LA 4XIDA 2ME6A 4A3KJ 1O4XA 5FJ8J 1B72B 1AHDP 4DZPA 2VPRA 5IYBJ 1SFOJ 3DCFA 4MFDA 3JRCA 4IHWA 4DZJA 3NARA 2EZIA 4D5CA 3FK7A 2GM4A 1RESA 5C4JJ 4A3EJ 1W0UA 1NK2P 1T56A 4DYQA 3I4MJ 3TP3A 3BR1A 1U9OA 3HOYJ 5IYDJ 3LSGA 1RETA 1Z0XA 2OPTA 2M34A 4BXXJ 4QIWN 5E3OA 4A3IJ 1JKRC 1X58A 3SJMA 1RPWA 2OF7A 1B8IB 4C3IJ 4BY1J 5JLXA 3ZQGA 1JKQC 3BG9A 4XRSG 2YS9A 3MKLA 2CQQA 2NS8A 5GPAA 3TEDA 1DU0A 1APLC 1RR7A 1HDPA 4AC0A 2JA7J 2ID3A 3QQAA 5C44J 2L7ZA 1YRNB 5EF6A 3HOUJ 2EBIA 4IHXA 4L5EA 5DS9A 1AKHB 1PUFA 1S7EA 1FEXA 4NDLA 4XK4A 1LFBA 3HGYA 3S2HJ 1GV5A 1MNMC 3DEWA 3S1MJ 4A93J 4HNVA 2LY9A 1K61A 2DA4A 4MLOA 1JUPA 1W0TA 2VKVA 3QPSA 4M3DA 5IYCJ 2R5YA 1GVDA 1X2NA 2D5VA 1I6HJ 1T33A 2LTPA 3F0CA 1UG2A 1IDZA 4BBRJ 3CDLA 3A01B 4JX4A 2MG4A 2CU7A 2G0EA 1POGA 1QPIA 4JYKA 1ETYA 2XB5A 4D7MA 3TW6A 4A3DJ 2R5ZA 4C3JJ 2WB1N 2HYJA 4JX6A 3BR0A 3ZQCA 3LSRA 1TWFJ 3RZDJ 2DMNA 3G1OA 5EZHA 5F27A 3TP0A 2Y2ZA 1JGGA 5IOZA 1GT0C 2VKEA 2H1KA 1JUMA 3O8HA 2X9DA 2EZKA 4J19A 2Y31A 5C4XJ 2TRTA 1FIPA 1MBHA 4A3GJ 4MFEA 1ZR2A 1ZKGA 1H88C 4S0HB 2KDZA 4A3JJ 4Y7NJ 2XGDA 4A3LJ 2DMTA 3HGGA 5EZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BW6 A;  2O7O A;  1WI3 A;  3W6V A;  5EYR A;  1TWH J;  4X6A J;  2M2E A;  1BL0 A;  3A02 A;  4XIC A;  3PM1 A;  2JA8 J;  3FK6 A;  3LOC A;  3UKG A;  3OIO A;  4A3B J;  2E19 A;  4FE4 A;  3BTL A;  2FQ4 A;  3K2A A;  1ZGW A;  2JN6 A;  5M5Y J;  4FE7 A;  1LE8 A;  1Q1V A;  3HOZ J;  3BR3 A;  2HOA A;  1R9T J;  1MH3 A;  5JLW A;  3HOX J;  2K9N A;  1RKW A;  2DA6 A;  5M5X J;  1ETV A;  3A03 A;  3BR2 A;  2MW8 A;  2LK2 A;  2FJ1 A;  3K7A J;  3RZO J;  3FIW A;  5M3M J;  3Q3S A;  3D1N I;  5M3F J;  3WHC A;  2LFB A;  2X48 A;  2H8R A;  2AHQ A;  1GDT A;  1MSE C;  1F36 A;  2HOT A;  2JMW A;  2DA7 A;  2MSY A;  4FTH A;  1JKP C;  1IUF A;  3LNQ A;  2L9R A;  3BG3 A;  1IV6 A;  5E3M A;  1JTY A;  2LLK A;  4M3G A;  4I6Z A;  4A3F J;  1P7J A;  5HOD A;  3GTM J;  4X1E A;  2QF7 A;  3IH4 A;  4CYC A;  3C2B A;  2CUE A;  1QVT A;  2O9L A;  2JJ7 A;  2HDD A;  3S2D J;  1ENH A;  3G1M A;  2E1O A;  3B6C A;  2LKX A;  3S1N J;  1MBK A;  5EEA A;  1AU7 A;  1MBF A;  2ECB A;  2RAE A;  3IH2 A;  5GP9 A;  5EGO B;  2R92 J;  2K9S A;  1NK3 P;  2ECC A;  3BR6 A;  3CCY A;  3S17 J;  2XPV A;  1G2H A;  5IOY A;  1VFC A;  2XGC A;  2TCT A;  3CQZ J;  2DA1 A;  2VUM J;  4DYR A;  4BKX A;  2FD5 A;  1B72 A;  1JTX A;  3BTC A;  5F0C A;  2DTZ A;  3Q0V A;  5FLM J;  1IC8 A;  4ABZ A;  2L0K A;  3MVP A;  2CRG A;  5F0H A;  2FX0 A;  1IGN A;  2IEK A;  3IV5 A;  1GV2 A;  2ZB9 A;  1IDY A;  2ELK A;  3GTO J;  1H89 C;  3RQI A;  1BW5 A;  2Y0S N;  3SFI A;  4BY7 J;  4M6V A;  3FIS A;  3JRI A;  3GTG J;  3Q0W A;  3BTJ A;  2O8K A;  4MIM A;  1B8I A;  5M5W J;  2M9H A;  3HDD A;  2W48 A;  3BG5 A;  1WH7 A;  3S1Q J;  2L7F P;  1A5J A;  2YUS A;  2JK3 A;  1JJ8 C;  4I76 A;  3OOU A;  1OFC X;  4M3B A;  3H0G J;  1WPK A;  3HB9 A;  2R0Q C;  4A3M J;  2HOS A;  1ETX A;  4QSH A;  3WHB A;  5BNG A;  5K7F A;  4C3H J;  1YRN A;  2DA5 A;  4M3F A;  4XRM A;  1IG7 A;  1RKT A;  2ID6 A;  1ZR4 A;  1AKH A;  2AO9 A;  1SAN A;  1JKO C;  2CQX A;  3HKZ N;  3MN2 A;  4BBS J;  2WAQ N;  2K9Q A;  1VND A;  2HXI A;  2K40 A;  4M3E A;  2NVQ J;  3H3V K;  3HOW J;  2PMZ N;  3HOV J;  2JA5 J;  5FKO A;  3I4N J;  1ZK8 A;  3GBG A;  4B3A A;  2ME0 A;  3ZQI A;  3L1P A;  2X6O A;  2E2I J;  1MBE A;  3S14 J;  5J3L A;  4CYC B;  3OSF A;  2XPU A;  2E2H J;  3A01 A;  2IBD A;  1JJ6 C;  4A69 C;  2N8G A;  4D5F A;  1OCP A;  5EG0 A;  5FKM A;  2P81 A;  3JRF A;  1MBJ A;  3JRB A;  4QTR A;  5F08 A;  2HQ5 A;  1E3O C;  3VPR A;  3ZOB A;  5K7Z A;  3JRH A;  4UUS A;  2LVS A;  3HEF A;  3ZQF A;  2CUF A;  5J1U A;  5IP7 J;  2DMQ A;  1OJL A;  1VF9 A;  5F1J A;  1PUF B;  3M4O J;  2XRL A;  2NVX J;  1X2M A;  4Y52 J;  3O8G A;  1JT0 A;  2E2J J;  2EQR A;  1FIA A;  3IH3 A;  2DA3 A;  2EH3 A;  3QPL A;  5IP9 J;  1NTC A;  3GTJ J;  5DTD A;  2CJJ A;  4RBO A;  2LD5 A;  3PO2 J;  4MO7 A;  1UHS A;  2DMU A;  1MH4 A;  1WCM J;  4V2F A;  2Y30 A;  2R5Y B;  1IJW C;  1ETW A;  1BA5 A;  1ETK A;  1WH5 A;  2DA2 A;  2JWT A;  2LP0 A;  1WGX A;  2R93 J;  3JR9 A;  4B4C A;  1Z77 A;  1FTZ A;  1FTT A;  1QRY A;  2R5Z B;  5J1R A;  1XC5 A;  4AYB N;  2HI3 A;  1ETQ A;  2MGQ A;  1BJZ A;  2XGE A;  3PO3 J;  2L7M P;  4GFB A;  1FJL A;  1P7I A;  1TWG J;  1MSF C;  2NVT J;  3HM5 A;  3RKQ A;  2COB A;  2EZL A;  3GTK J;  1DU6 A;  3SDG A;  4EEF G;  1TWC J;  1EF4 A;  1U9N A;  1HCR A;  1XS9 A;  2LR8 A;  5EDN A;  1U8B A;  4FIS A;  1GUU A;  5C3E J;  1QVU A;  2QCO A;  3OSG A;  3LSJ A;  2GLO A;  3S16 J;  5IP6 A;  4V2G A;  1JT6 A;  2KT0 A;  2DMP A;  3HBL A;  5E3L A;  4W1U A;  3ZQL A;  5K7H A;  3BQZ A;  1I3Q J;  1Y1V J;  3G1L A;  3JRG A;  3FKI J;  3TW7 A;  1LE8 B;  4W97 A;  1HLV A;  2EZH A;  2WV1 A;  1I50 J;  4IHY A;  4IHV A;  1ZTR A;  1Y1W J;  1K83 J;  2M0C A;  2XSD C;  1XG1 A;  4DW6 A;  2NVY J;  2R7Z J;  3S1R J;  1HDD C;  1A6I A;  4C2M J;  1VI0 A;  5EGO A;  1D5Y A;  5E3N A;  3GTQ J;  4IEJ A;  2B63 J;  4DYC A;  5EG0 B;  3JRE A;  5FKK A;  2DN0 A;  1TC3 C;  2I10 A;  2HXO A;  2Y9Y A;  3JRA A;  3NAU A;  4AUX A;  4FCY A;  1TWA J;  3BR5 A;  1ITY A;  4UUS B;  1F43 A;  3Q0U A;  2VI6 A;  2DJN A;  4A3C J;  3BQY A;  1OCT C;  3B6A A;  2YU9 J;  1HOM A;  2XB0 X;  4G12 A;  4XRS A;  2Y9Z A;  3BTI A;  3JRD A;  4JP0 A;  2IAI A;  1H8A C;  5F04 A;  1MBG A;  2JA6 J;  2NOG A;  2GBY A;  4D7N A;  5GPC A;  2M8G X;  4LOC A;  3GTL J;  3M3Y J;  4B1R A;  2XPW A;  3BT9 A;  1ETO A;  1ORK A;  1LFU P;  5J1Y A;  2NS7 A;  1IRZ A;  1JUS A;  3CMY A;  9ANT A;  5FLV A;  5F0F A;  4JX5 A;  1UMQ A;  1HF0 A;  3S15 J;  3GTP J;  5IPA A;  5FKL A;  4RDU A;  3LSP A;  1U78 A;  1ZQ3 P;  5FKN A;  1CQT A;  4UUT A;  3ZQH A;  3E7L A;  4XID A;  2ME6 A;  4A3K J;  1O4X A;  5FJ8 J;  1B72 B;  1AHD P;  4DZP A;  2VPR A;  5IYB J;  1SFO J;  3DCF A;  4MFD A;  3JRC A;  4IHW A;  4DZJ A;  3NAR A;  2EZI A;  4D5C A;  3FK7 A;  2GM4 A;  1RES A;  5C4J J;  4A3E J;  1W0U A;  1NK2 P;  1T56 A;  4DYQ A;  3I4M J;  3TP3 A;  3BR1 A;  1U9O A;  3HOY J;  5IYD J;  3LSG A;  1RET A;  1Z0X A;  2OPT A;  2M34 A;  4BXX J;  4QIW N;  5E3O A;  4A3I J;  1JKR C;  1X58 A;  3SJM A;  1RPW A;  2OF7 A;  1B8I B;  4C3I J;  4BY1 J;  5JLX A;  3ZQG A;  1JKQ C;  3BG9 A;  4XRS G;  2YS9 A;  3MKL A;  2CQQ A;  2NS8 A;  5GPA A;  3TED A;  1DU0 A;  1APL C;  1RR7 A;  1HDP A;  4AC0 A;  2JA7 J;  2ID3 A;  3QQA A;  5C44 J;  2L7Z A;  1YRN B;  5EF6 A;  3HOU J;  2EBI A;  4IHX A;  4L5E A;  5DS9 A;  1AKH B;  1PUF A;  1S7E A;  1FEX A;  4NDL A;  4XK4 A;  1LFB A;  3HGY A;  3S2H J;  1GV5 A;  1MNM C;  3DEW A;  3S1M J;  4A93 J;  4HNV A;  2LY9 A;  1K61 A;  2DA4 A;  4MLO A;  1JUP A;  1W0T A;  2VKV A;  3QPS A;  4M3D A;  5IYC J;  2R5Y A;  1GVD A;  1X2N A;  2D5V A;  1I6H J;  1T33 A;  2LTP A;  3F0C A;  1UG2 A;  1IDZ A;  4BBR J;  3CDL A;  3A01 B;  4JX4 A;  2MG4 A;  2CU7 A;  2G0E A;  1POG A;  1QPI A;  4JYK A;  1ETY A;  2XB5 A;  4D7M A;  3TW6 A;  4A3D J;  2R5Z A;  4C3J J;  2WB1 N;  2HYJ A;  4JX6 A;  3BR0 A;  3ZQC A;  3LSR A;  1TWF J;  3RZD J;  2DMN A;  3G1O A;  5EZH A;  5F27 A;  3TP0 A;  2Y2Z A;  1JGG A;  5IOZ A;  1GT0 C;  2VKE A;  2H1K A;  1JUM A;  3O8H A;  2X9D A;  2EZK A;  4J19 A;  2Y31 A;  5C4X J;  2TRT A;  1FIP A;  1MBH A;  4A3G J;  4MFE A;  1ZR2 A;  1ZKG A;  1H88 C;  4S0H B;  2KDZ A;  4A3J J;  4Y7N J;  2XGD A;  4A3L J;  2DMT A;  3HGG A;  5EZG A; 
#chains in the Genus database with same CATH topology
 1BW6 A;  3KP7 A;  2O7O A;  3VYU B;  1X3W B;  4BDY A;  2R7R A;  1TWH J;  2Y48 A;  3ZMT A;  2HEO A;  3C7J A;  4N0B A;  5AIQ A;  4XIC A;  4MTE A;  1WRJ A;  4FE4 A;  3BTL A;  4IXA A;  3KZZ A;  2ISZ A;  2A5Y B;  1TQI A;  2XGX A;  2HU9 A;  2CGP A;  2HOA A;  2L9N A;  4N9I A;  4ZDP A;  2M7B A;  1R9T J;  4L9V A;  4RGX A;  5KK1 A;  1UEL B;  3RI4 A;  3BR2 A;  4ZZD A;  4L18 B;  2M7A A;  3NRV A;  2FJ1 A;  3TDU C;  3CCJ I;  2LOO A;  3WG7 H;  4BHB A;  3DF8 A;  5GAH J;  5M3M J;  3Q3S A;  3KX2 A;  2X48 A;  4B09 A;  1S9H A;  1T08 B;  5KAF C;  2NYX A;  3WTW C;  3U9G A;  2HOT A;  4XOT A;  3OYE A;  3ABU A;  3KP6 A;  1JKP C;  3I4P A;  1A35 A;  2L9R A;  1K4T A;  2VOO A;  4UVB A;  3OYL A;  1EV7 A;  5E3M A;  4WWC A;  1BR4 A;  5F64 A;  4M3G A;  2V6C A;  1G8X A;  3IKV A;  3DBR B;  5HOD A;  3GTM J;  4X1E A;  2QF7 A;  3C18 A;  2BYV E;  5F1R A;  4DGW B;  5A2Q K;  3L2V A;  4OIQ F;  4E4H A;  1S3J A;  3AL0 B;  4EJW A;  4HOB A;  3VOD A;  1MBK A;  1R1U A;  1I39 A;  3IRQ A;  1AU7 A;  3IH2 A;  2F5E A;  2WB1 A;  2R92 J;  4UNO A;  1KYZ A;  2F4O B;  3BR6 A;  3FMR A;  2XPV A;  5LEK A;  1G2H A;  2V1X A;  1SAU A;  4PDK A;  1UZC A;  2HS5 A;  1XMK A;  3OYK A;  4RB1 A;  4J01 A;  3CQZ J;  2X6X A;  4M9Z A;  4GDF A;  1QQI A;  4Q48 A;  1F9N A;  1LEA A;  3Q9S A;  4DYR A;  4BKX A;  2Z1D A;  4RLQ A;  1QGP A;  2M5W A;  3BTC A;  2K02 A;  5ILS A;  4IQ4 A;  3ISP A;  1IC8 A;  1J2X A;  4G7H F;  2V1D A;  4ABZ A;  2L0K A;  3MVP A;  4XBF A;  3R6S A;  1ODD A;  1IGN A;  2STT A;  2XAF A;  2IEK A;  1GV2 A;  3HKZ A;  5LFA A;  2WAQ A;  5FO5 A;  2K5C A;  3EUA A;  1YIT I;  1BM9 A;  1RUO A;  1H89 C;  2BE5 F;  3OYI A;  2PMZ A;  2CQ7 A;  2IS4 A;  2VN2 A;  3OIP A;  1BW5 A;  1BIB A;  3FDY A;  1HW1 A;  3FIS A;  3G6E I;  2DW4 A;  4HF2 A;  2EIJ H;  4PGG A;  3CO6 C;  1B8I A;  3HDD A;  4RB2 C;  1UB9 A;  5JVG F;  2KJB A;  1WH7 A;  4BE1 A;  3TKY A;  5H20 A;  3W2A A;  2YUS A;  4EJT A;  4I76 A;  2LY2 A;  2GXG A;  3BCA A;  3DPU A;  1OFC X;  1D1B A;  4M3B A;  4Z6Y A;  3V8L A;  4A3M J;  4QSH A;  3RCO A;  5K7F A;  5IT9 Z;  2DA5 A;  4XRM A;  2R3S A;  1RKT A;  5B66 C;  2DBB A;  2WAD A;  2KIM A;  4LGW A;  5FD6 A;  4BBS J;  3HKZ N;  4HNU A;  2CQN A;  2WAQ N;  3UR3 C;  2K40 A;  2HXI A;  3QOP A;  2NVQ J;  1WJ5 A;  4G7Z F;  2PMZ N;  3HOV J;  1MDM B;  3GF2 A;  5HS8 A;  2JA5 J;  1LFP A;  4A6E A;  4C9Y A;  4L0Z B;  3CCV I;  4YIF A;  1XDU A;  3GBG A;  3GFL A;  3DV8 A;  2HR3 A;  2VKD A;  4EJV A;  2K9L A;  2A5W A;  3L1P A;  2HQN A;  2XAS A;  4UV9 A;  2Q2E A;  2X6O A;  3QU6 A;  2FQ3 A;  3O6B B;  1D1C A;  4U7D A;  3ERE D;  3FKJ A;  2HFH A;  2XF5 A;  3MWM A;  2IBD A;  1JJ6 C;  3LFU A;  2QWW A;  5LHI A;  4XRF A;  1S7O A;  4D5F A;  1OCP A;  5EG0 A;  3IUO A;  5FKM A;  5J40 A;  2KLO A;  1MBJ A;  5F08 A;  4BXU A;  1E3O C;  3ESW B;  3GLX A;  3W6K B;  3L2C A;  2F4I A;  3ZQF A;  2CUF A;  5IP7 J;  4YFN F;  1SFX A;  3DPT A;  1PUF B;  4P5O A;  4GXO A;  5CPR B;  2DOD A;  2OTL I;  4LIU A;  4BU2 A;  4HV6 A;  2EQR A;  3IH3 A;  1K78 A;  4CCO A;  4NNJ A;  1XTA A;  2ZME A;  3R61 A;  2P7C B;  5DTD A;  4RBO A;  3LSH A;  1OCR H;  3BPV A;  3KLO A;  4IPA A;  5K1Y A;  2MYS A;  3BZ6 A;  4OAZ A;  1KU3 A;  3F8B A;  1WCM J;  3RYP A;  2KDO A;  2P5V A;  2Y30 A;  3ZQQ A;  2JZY A;  1ZAO A;  2DOE A;  2HTJ A;  4L9J A;  1VQ8 I;  1IXS B;  2KZV A;  4I0B A;  3QP6 A;  1A31 A;  3MMY B;  1D0Z A;  1ETK A;  1WH5 A;  3H0D A;  2J5O A;  3KE2 A;  3JAM K;  1HW2 A;  2LP0 A;  1KU2 A;  2R93 J;  3JR9 A;  1V4R A;  2HKX A;  4I01 A;  2F5F A;  1Z77 A;  1FTZ A;  3BJO A;  3CC7 I;  1FTT A;  5J1R A;  1XC5 A;  2HI3 A;  4RLF A;  3RKY A;  4CSW A;  1E2X A;  1V5F A;  2GIZ A;  2KJC A;  3VEP A;  1FMW A;  2P0W A;  2X6W A;  4M72 A;  1P2F A;  4P9F A;  2VC0 A;  1R22 A;  2NVT J;  4KNY A;  4LJZ F;  1R00 A;  1SD5 A;  4B8X A;  2EZL A;  4BUP A;  2Z33 A;  4EEF G;  2ACJ A;  1Y0N A;  5D5V B;  1U9N A;  3WTS C;  1F5T A;  2WY7 Q;  4ESB A;  2LR8 A;  4HQM A;  4PFO A;  1U8B A;  4FIS A;  1GUU A;  5C3E J;  1QVU A;  3OSG A;  3LSJ A;  3S16 J;  5IP6 A;  2ELH A;  2HDC A;  1WHU A;  2DMP A;  2YR2 A;  1NHA A;  4FX0 A;  5CVV A;  2Z5U A;  2DDA A;  2LH9 A;  3OMY A;  2BEO A;  5GAE J;  4A5N A;  1YTY A;  4AWX B;  1R1T A;  1LE8 B;  4UVA A;  4W97 A;  3DTK A;  4N4O B;  2P6T A;  3WOD F;  4OIP F;  4IHV A;  1K83 J;  1VQL I;  1B6A A;  2DOA A;  1XCV A;  2R7F A;  3LAJ A;  2NVY J;  3VYR B;  5TIS C;  4YEL A;  2MC4 A;  3S1R J;  3FBN B;  1A6I A;  4ZYE A;  4C2M J;  1LVA A;  3GFJ A;  2R4G A;  4QPQ A;  4CCK A;  5E3N A;  2GXB A;  4NB5 A;  2AQF A;  2B63 J;  1UAA A;  4Y3O A;  5EG0 B;  2A68 F;  2O3F A;  2Q0O A;  5BS6 A;  3R0A A;  1UFM A;  1G3T A;  1ZHF A;  1TWA J;  3BR5 A;  1E0E A;  1F43 A;  3P9C A;  1N77 A;  2VI6 A;  2DJN A;  4A3C J;  2EFW A;  2YU9 J;  5CLS A;  3BG7 A;  2M45 A;  3AG1 H;  1QZE A;  1V3F A;  2XV4 S;  5E79 C;  3TO6 A;  4IVN A;  2JA6 J;  3RPU D;  2BXY A;  3GTL J;  4AM3 A;  1XN7 A;  4HST A;  3GCM A;  3M3Y J;  3OOP A;  3H5N A;  2XAH A;  2XPW A;  4B44 A;  1TL8 A;  5H2F C;  1MMA A;  5LGT A;  3SQN A;  1MKM A;  5D5X B;  3G73 A;  1U8R A;  9ANT A;  3K1M A;  1G3Y A;  1J09 A;  2CSO A;  1BI3 A;  4NC7 A;  3HUG B;  2KQR A;  3SZG A;  1WKM A;  5K5R A;  3J7A O;  3FXQ A;  5FKL A;  3CP8 A;  2UXN A;  3K6G A;  4IX7 A;  1ZQ3 P;  1CQT A;  2X51 A;  5B5E C;  4A3K J;  1O4X A;  3HHG A;  5FJ8 J;  5LGU A;  4BHP A;  4DZP A;  1R49 A;  1YW8 A;  4MFD A;  3JRC A;  2XAQ A;  3CDH A;  2BW3 A;  2MBF A;  3FK7 A;  2M3A A;  1L3L A;  1YHQ I;  1T95 A;  2OV7 A;  3GZ5 A;  1J75 A;  1BR2 A;  1YW7 A;  1NK2 P;  1I3A A;  4BAC A;  2VON A;  3BR1 A;  4BE0 A;  3LSG A;  2BY2 A;  2P6S A;  1Z0X A;  5D6F A;  1V55 H;  1A04 A;  2FU4 A;  2NNY A;  2A6T A;  4KIB A;  4QIW N;  2VPL A;  5J47 A;  3SJM A;  4ZDO A;  1X1B A;  1AA7 A;  2XIG A;  4BEH B;  1JI8 A;  4LK0 F;  2V7F A;  2F6C A;  1Z7L A;  1J59 A;  1R5H A;  2VOD A;  1W7P B;  4KIG A;  3ZQG A;  3MAJ A;  4KT6 A;  4XKW A;  2DDB A;  4XRS G;  1DUX C;  2LSO A;  2VB6 A;  2CQQ A;  2NS8 A;  4CO8 A;  1V5E A;  3KEO A;  4E7Z A;  1FYL A;  3K0L A;  3M1E A;  3SXY A;  3IAM 2;  4AC0 A;  3BJA A;  1HSJ A;  1RZ4 A;  3I9V 2;  3RKW A;  4GO1 A;  4BDZ A;  2VXZ A;  5C44 J;  5EF6 A;  4RGS A;  1EJ9 A;  1AKH B;  2OZU A;  3JTG A;  1NH3 A;  4D0P A;  1B1B A;  1FEX A;  4F93 B;  3V7C A;  1LVK A;  1W5T A;  2UWM A;  3NEU A;  3GO5 A;  2IVM A;  5DDG A;  2VBY A;  3J7Z I;  5DUK A;  4DBQ A;  3P9I A;  5J6X A;  1ON1 A;  3AG2 H;  2G7H A;  3M7G A;  4MLO A;  2D45 A;  2RQP A;  1E3H A;  2E1C A;  1DPU A;  2H6C A;  1WSU A;  1QHH D;  1ZEL A;  2OTJ I;  1UG0 A;  4N4N B;  1SVM A;  5ILV A;  3F0C A;  1IDZ A;  1G59 A;  2Q1Z B;  4E70 A;  1BI0 A;  4BBR J;  1XSD A;  3LWF A;  4JX4 A;  4KMU X;  2G0E A;  5HDN A;  3WGH A;  1QPI A;  4D7M A;  2KKO A;  3LMM A;  4FET A;  2R5Z A;  3ZQC A;  1YLF A;  4E6K G;  3QPT A;  2GXA A;  2A05 A;  2H94 A;  2DFI A;  3G1O A;  5F27 A;  1VZ0 A;  3K70 C;  3CUQ A;  4R1H A;  1Z3Y A;  2H1K A;  2ZJ2 A;  2VKE A;  1MMS A;  3EUK L;  1RR8 C;  3O8H A;  2MH2 A;  2X9D A;  3OR1 C;  2M30 A;  4GRI A;  4J19 A;  2Y31 A;  2GWR A;  3I3L A;  1T38 A;  4PJJ A;  1MMD A;  4HBL A;  1MBH A;  1ZH5 A;  4A3G J;  3CLQ A;  2KDZ A;  2QQ9 A;  1RIO H;  2XGD A;  4AVP A;  3H92 A;  3HGG A;  1FC3 A;  2WTE A;  4WXD A;  1WI3 A;  1VQK I;  3W6V A;  4HAM A;  1HKQ A;  3QYF A;  2GZW A;  2LF7 A;  1DPR A;  1KU7 A;  1X19 A;  3A02 A;  4OAY A;  3TDZ C;  1T6S A;  3FK6 A;  5ILU A;  2F5D A;  3OIO A;  2JA8 J;  4A3B J;  3T5X A;  3KET A;  4A12 A;  1ZG3 A;  4FE7 A;  1Q1V A;  2K3P A;  3BRO A;  3FWE A;  3HOZ J;  3CZ6 A;  1XB4 A;  3QOD A;  1O3R A;  2CWE A;  3BZK A;  3H1C A;  3R60 A;  4ZDL A;  5JLW A;  1OCC H;  1RKW A;  1ERD A;  4OIN F;  1ETV A;  2E1M B;  1IRG A;  4O3M A;  2IS6 A;  1BR1 A;  1EH8 A;  3VB2 A;  5JFR A;  2LBF B;  2MW8 A;  5E8I A;  3S3N A;  2LDU A;  3AG4 H;  2R7T A;  1EA3 A;  1CF7 B;  4GCV A;  3K7A J;  1J5Y A;  2CW0 F;  5L3F A;  1YX3 A;  3FIW A;  1IXR C;  2HVR A;  1PP8 F;  2FBK A;  2YX7 A;  2LFB A;  2H8R A;  2DFE A;  4PJL A;  2AHQ A;  1GDT A;  1MSE C;  1Z9C A;  4Q5S F;  1ACI A;  3CCQ I;  1I27 A;  4FTH A;  1IUF A;  1KQ9 A;  1Y8Q B;  2FUG 2;  2W1O A;  1JTY A;  2O8X A;  4RS8 A;  3LST A;  1TQP A;  5J4V A;  4K2E A;  3DLL F;  3FXO A;  1WJE A;  1CGP A;  1G3W A;  3K1N A;  1B9N A;  2HKO A;  3OYF A;  3WTV C;  2RN7 A;  2JJ7 A;  3S2D J;  3G1M A;  2E1O A;  1VQN I;  1MIJ A;  2GAU A;  2M8E A;  3S2W A;  2CS3 A;  3E0J B;  4ZYD A;  2L7K A;  1YOV B;  2ECB A;  2QKL B;  2PFB A;  4EV0 A;  1SD7 A;  4NQW B;  2HYF A;  2VQG A;  5EGO B;  2VKH A;  1NK3 P;  2ECC A;  2FNA A;  3F8N A;  2L4A A;  2CYY A;  4CZZ A;  2DFF A;  4M9X A;  3ONQ A;  2K85 A;  2KIF A;  2IRF G;  5TJJ A;  2V9P A;  1B72 A;  3S3M A;  2EFP A;  1JTX A;  3BOQ A;  5BPD A;  1FOY A;  1FT9 A;  5FLM J;  4Q47 A;  5F6F A;  3JCU C;  3ZMS A;  5K5O A;  3KYD B;  2V26 A;  2HGC A;  4KN7 X;  1RUN A;  5JHF A;  1IDY A;  3HRU A;  3S93 A;  3ZMD A;  3HIF A;  3RKX A;  3FMS A;  2NAZ A;  3RQI A;  2PJR B;  2Y0S N;  1N75 A;  1FOW A;  4M6V A;  1BJA A;  4L9T A;  4BY7 J;  1OKR A;  5J8F A;  2ZFW A;  2PN6 A;  3ZXS A;  1MW7 A;  2V1N A;  1WWX A;  4ASN A;  3KZY A;  1P4W A;  3IP4 B;  5CJ9 A;  4R8H A;  3ML6 A;  3I56 I;  5M5W J;  1MNE A;  2M9H A;  2AS5 F;  4F55 A;  5L3B A;  3F9K A;  2A6E F;  1I6X A;  3QP5 A;  1P4X A;  3ZPL A;  3DKY A;  4EMS A;  4OMY A;  5IT3 A;  2H27 A;  1JJ8 C;  2OBP A;  1SEU A;  3H0G J;  4LMY A;  3RJP A;  3ZCO A;  4BNC A;  1HST A;  1UHM A;  2KZG A;  3HB9 A;  1YW9 A;  2DI3 A;  2R0Q C;  2HOS A;  3BZC A;  1Z05 A;  3D0S A;  1X3U A;  3KZI C;  2P5L C;  4G6T B;  5CKT A;  2VAS A;  1IG7 A;  2E7X A;  1ZLJ A;  2HWV A;  2W4S A;  5DCM A;  2EFN A;  2ZBK A;  1SAN A;  4I98 B;  4WXH A;  5EEH A;  1TQM A;  4QWQ A;  1S5L C;  1TBX A;  4M3E A;  4HNT A;  3HOW J;  2KL4 A;  4XNF A;  2I8D A;  3L2W A;  2G7U A;  1F4K A;  3H3V K;  4HQE A;  2LMD A;  1O7F A;  1W1W E;  3I4N J;  5DM7 F;  2AQE A;  1U5T C;  2G9W A;  5FD5 A;  2ME0 A;  4B3A A;  1Z6T A;  3AG3 H;  3OYJ A;  5DUI A;  2R7X A;  1FYM A;  4G94 A;  1LDD A;  4ZYH A;  2QEX I;  1X4O A;  2X0L A;  2F2E A;  2E2I J;  3KCC A;  1X4P A;  2R7D A;  5J3L A;  2XPU A;  3HRT A;  1IAW A;  2IS1 A;  1STZ A;  2NOJ B;  2VL8 A;  4P9U A;  3A01 A;  3IL2 A;  5LEJ A;  2R7V A;  1OMI A;  4D9J A;  2CO5 A;  5H6Q A;  2IP2 A;  2MC3 A;  2P81 A;  5JHU A;  1TT5 B;  3JRB A;  2XAU A;  3QU3 A;  3OYA A;  2HQ5 A;  1YS6 A;  3KYC B;  5K7Z A;  4Z2Y A;  2PQ8 A;  3PIO F;  5FLX Z;  3OY9 A;  1WJF A;  3WE3 A;  5J1U A;  2DMQ A;  5FFX A;  4L9N A;  4A2U A;  1VF9 A;  2YSR A;  1H9G A;  1Z91 A;  5ICG A;  4IKF A;  3WG9 A;  4FT8 A;  1FBU A;  3W3C A;  4BQA A;  2GQQ A;  3OL3 A;  2E2J J;  3IC7 A;  4E7L A;  2DA3 A;  3KP3 A;  3WTZ A;  1VQ5 I;  2CJJ A;  2L2O A;  4DQ2 A;  5DM6 F;  1UHS A;  1MH4 A;  1PUE E;  1A6Q A;  3ZMZ A;  4G7O F;  4V2F A;  1LNW A;  3EDP A;  3J81 K;  2R5Y B;  1FSE A;  1IJW C;  4CCM A;  3OYB A;  2DYR H;  1ETW A;  4A6D A;  1EKE A;  1XCB A;  3GYH X;  2CV1 A;  4NC8 A;  2V6E A;  3ROU A;  2FEZ A;  1MMN A;  3GZN B;  2FRH A;  1QHG A;  2KIQ A;  4BH9 A;  1G4D A;  1BJZ A;  3RPU A;  3W2W A;  4EM1 A;  2XGE A;  3OYH A;  2MLK A;  1P7I A;  1VQP I;  3A0H C;  3F8M A;  3SZT A;  3CD6 I;  1HA8 A;  2W85 A;  2DXI A;  1BBY A;  2DPU A;  5HS7 A;  3RKQ A;  1ZRE A;  2KHM A;  1Z1D A;  3FM3 A;  5H6R A;  3WTY C;  4BGD A;  3OV8 A;  2DCE A;  2K7L A;  4II2 A;  3SDG A;  5LRS A;  1TWC J;  2O6G E;  3B02 A;  1T0F C;  3BPX A;  2DFH A;  4I09 A;  2Z9O A;  2O03 A;  5EDN A;  2XRO A;  4XLE A;  2QCO A;  3VSL A;  3CUQ C;  2J5P A;  4XM3 A;  2HQR A;  3CUO A;  3HRM A;  3EYY A;  2HVQ A;  2GLO A;  1R7J A;  2FBH A;  2L54 A;  3DU6 A;  3F8C A;  1JXS A;  4V2G A;  4UV8 A;  5HS9 A;  4LB5 A;  4W1U A;  3ZQL A;  1DQU A;  1A36 A;  3ASN H;  4LIT A;  2LKS A;  2M1B A;  2JRT A;  3CCU I;  1I3Q J;  3ZGK A;  3G1L A;  4XKB A;  3FKI J;  3TW7 A;  3NQO A;  2HTS A;  3CJR B;  1YIO A;  2WV1 A;  3HSE A;  1I50 J;  3LA7 A;  3M8F A;  5KHD A;  2L5Q A;  4HA8 A;  3G3Z A;  5ICC A;  1SFU A;  4Y15 A;  2COM A;  2XSD C;  2F4M B;  1XG1 A;  4DW6 A;  3CMA I;  2R7Z J;  4HLX A;  3K4L A;  4KN4 X;  1VI0 A;  3F72 A;  1LDK B;  2D2W A;  3GTQ J;  3KEQ A;  2W24 A;  4IEJ A;  3I54 A;  2FXA A;  1QNT A;  3K69 A;  5FKK A;  1LUJ B;  3JRE A;  2RVC A;  2PMU A;  4YIR X;  2HXO A;  2M87 A;  2P5K A;  1SVL A;  1IW7 F;  2QLZ A;  3FBI B;  3EPZ A;  3NAU A;  4U0V A;  4XLC A;  4FCY A;  1SAX A;  4JQF A;  2DQR A;  2QBY A;  2DOF A;  3MD2 A;  3V8J A;  2DYS H;  5CVR A;  1GXP A;  3BQY A;  1OCT C;  3B6A A;  4NBQ A;  3OS0 A;  1Y56 A;  2ZSH B;  3FX3 A;  2X1C A;  3BTI A;  2BHY A;  2XSJ C;  3JRD A;  2IAI A;  2ZC2 A;  3ELK A;  3M8E A;  3PNT A;  5F04 A;  3PQK A;  2WAE A;  4BQQ A;  2GBY A;  2JPB A;  3GZ6 A;  1XSX A;  3U21 A;  3BT9 A;  4I99 C;  1DGW Y;  4C2U A;  1R1V A;  4KT5 C;  4CDG A;  1LFU P;  1LEB A;  4XLA A;  5J1Y A;  1Q1H A;  2NS7 A;  1TNS A;  2ZXJ A;  4IRH A;  4ON0 A;  2VOP A;  1UMQ A;  3T8R A;  4EQQ A;  2QGU A;  3EUH C;  1HF0 A;  3S15 J;  5L3E A;  2H8W A;  3J80 Z;  3TGN A;  1FBQ A;  5D5U B;  3DXJ F;  3LSP A;  4OIO F;  2B9S A;  2EV5 A;  1R5G A;  1V54 H;  3MKW B;  5KCM A;  3ZQH A;  3CP2 A;  4OOI A;  4HF1 A;  4XID A;  4QLC U;  4GYG A;  4A0Y A;  1AHD P;  3L2U A;  2B0L A;  5LD2 C;  4P96 A;  1Z6R A;  4BS9 A;  5HOO A;  4PGH A;  4DBR A;  4DZJ A;  4IHW A;  2M0M A;  4KIF A;  2PJP A;  3T1B A;  1RES A;  1Y0U A;  3A1Y A;  3JSP A;  2GM4 A;  3LAP A;  4ZTF A;  2EIN H;  2IGM A;  2KRC A;  4D1Q A;  4AIK A;  1BI1 A;  1W0U A;  3FM5 A;  3MKZ A;  3G4S I;  1ZG1 A;  4MGR A;  1JHH A;  3I4M J;  2OZ6 A;  1SMT A;  2P8T A;  3E1S A;  2R7O A;  1RET A;  5CYV A;  2M34 A;  1PDN C;  4BXX J;  3OR2 C;  3R0J A;  2W00 A;  1MJ9 A;  2JVH A;  3WGI A;  2IS2 A;  3L9F A;  1JKR C;  1RPW A;  4KYW A;  2NNN A;  2OF7 A;  2HQA A;  1B8I B;  2Z2S B;  4BY1 J;  3KPH A;  4IHS A;  3D5S C;  2EPF A;  5E1Z B;  5JLX A;  2PI0 A;  3L2Q A;  4ETS A;  4XLN F;  4G6Q A;  4ZYG A;  2YS9 A;  3MKL A;  5GPA A;  3TED A;  3FXJ A;  1W5S A;  3I0T A;  2AXL A;  4RA2 A;  2WWY A;  1DU0 A;  4AIH A;  2EK5 A;  4PUS A;  1APL C;  4PJM A;  1J0R A;  1FWZ A;  1HDP A;  1HKS A;  3QQA A;  4WF2 A;  4U88 A;  2L7Z A;  1WI9 A;  2EBI A;  2FOK A;  3JTH A;  5BQT A;  4ZJZ A;  1D5V A;  4A0X A;  1S7E A;  1LFB A;  3HGY A;  3S2H J;  1GV5 A;  3CCL I;  1ON2 A;  2ZJQ F;  5AIP A;  4ZC3 A;  3J7Y J;  3DEW A;  4YII A;  2EWN A;  3F3X A;  2Y0M A;  3GEZ A;  2E5N A;  2E60 A;  2LY9 A;  4S04 A;  2DA4 A;  1K61 A;  4CIC A;  1JUP A;  2VKV A;  2A07 F;  3ERM A;  3QPS A;  1OCZ H;  3K4J A;  3LQQ A;  4M3D A;  2Q2E B;  2OQG A;  3KIO A;  3PSI A;  2ETH A;  2DT5 A;  5D6E A;  1IXC A;  2EFQ A;  6PAX A;  3GX4 X;  1RC9 A;  3K4N A;  1ETY A;  3TW6 A;  4A3D J;  2OC6 A;  1L0O C;  1R23 A;  4HF0 A;  2ZJP F;  3CCE I;  4IZZ A;  1VQO I;  2KRF A;  4EM0 B;  5EZH A;  3H9J A;  2Y2Z A;  2L4M A;  3L00 A;  2ESH A;  5IOZ A;  1JUM A;  3A2K A;  2TRT A;  1V5G A;  1FIP A;  5GTH C;  4XLH A;  1SFK A;  5LHH A;  2OUM A;  3ABL H;  1OCO H;  1H88 C;  3OYD A;  4Y7N J;  1K78 B;  4A3L J;  1R5I D;  2ZME B;  3ECO A;  2QQ8 A;  5EYR A;  4X6A J;  3D5L A;  4WK8 F;  2M2E A;  1BL0 A;  4UB6 C;  3PM1 A;  2DT7 B;  3E6B A;  4LD5 A;  3LOC A;  4I02 A;  1D1A A;  3EYI A;  1ZGJ A;  1IF1 A;  2FQ4 A;  5JVT A;  5GTI C;  1ZGW A;  2JN6 A;  4DNC A;  1YJW I;  1B4A A;  1XMX A;  3V4G A;  5L3D A;  5FRO A;  4BHC A;  3QRF F;  1MH3 A;  2H6B A;  3L7W A;  3QAH A;  4NHJ A;  1KQ8 A;  2DA6 A;  3GLL A;  5M5X J;  2JT1 A;  4MQ9 F;  1U5T A;  3KP5 A;  5DD4 A;  2BBY A;  3OWT A;  3WTU C;  2FML A;  5E1W A;  3A03 A;  4E7S A;  3TQN A;  3WTX C;  2GA2 A;  2LK2 A;  1JE8 A;  3C3W A;  2VQC A;  3RZO J;  2Q8K A;  2FMY A;  1QU3 A;  3E5X A;  3D1N I;  5LHG A;  5M3F J;  2IXS A;  3CLO A;  3WHC A;  1I1G A;  3CCM I;  3IWF A;  2L02 A;  4R79 A;  4XSZ F;  3OYG A;  2NVU B;  1LDJ A;  2JTV A;  4CXF A;  3LNQ A;  4EJU A;  1IV6 A;  3QPH A;  4FQG A;  1AWC A;  4AVZ A;  3O3K A;  4LLG F;  4I6Z A;  4A3F J;  1P7J A;  2X6Y A;  4MHG A;  1D3Y A;  2ZXI A;  2IPQ X;  3HYI A;  4KIS A;  4CYC A;  3WTT C;  4CA0 A;  3GUD A;  1WJB A;  1QVT A;  5ED4 A;  3CC2 I;  3HPG A;  1ENH A;  4J00 A;  3GW2 A;  1IO2 A;  3PNV A;  4XOR A;  4MTD A;  2LKX A;  3TBI A;  3K70 D;  1GHC A;  1MD0 A;  3HOT A;  3IAS 2;  1ZAR A;  2RAE A;  2VQL A;  3E6D A;  3HTU A;  5GP9 A;  2K9S A;  2X85 A;  3CCY A;  2EA2 A;  3S17 J;  3F8F A;  4OU0 A;  2BZT A;  5IOY A;  1VFC A;  2LNB A;  1ZRD A;  4PFP A;  2JQ7 A;  2TCT A;  2XF6 A;  2VUM J;  1W4M A;  5LLQ A;  1YI2 I;  2C6Y A;  1OYI A;  5F0C A;  3Q0V A;  5D5W B;  2QM3 A;  4F3Q A;  5F0H A;  3A0B C;  1OYY A;  2KPM A;  3HL2 A;  2XDV A;  2FX0 A;  4BQO A;  2E5Z A;  3GTO J;  4CZC A;  1SD6 A;  4XN0 A;  2JPC A;  2V79 A;  4N9H A;  1D8J A;  1YIJ I;  3I59 A;  2CFX A;  3SFI A;  4UVC A;  2OA4 A;  2RQQ A;  3MZ8 A;  3GTG J;  4IRI A;  3COA C;  3CO7 C;  3Q0W A;  1T0F A;  2O8K A;  4MIM A;  4RAG A;  1QZY A;  2W48 A;  4BL0 B;  3BG5 A;  2F48 A;  3TOA A;  4B3X A;  5HNF A;  2EV0 A;  4AD9 A;  4CGZ A;  3S1Q J;  1HW5 A;  2OU2 A;  2UUZ A;  2L7F P;  1WVR A;  3M1C A;  3DTE A;  2JK3 A;  3I5U A;  4EGZ A;  3OOU A;  4LG0 A;  5FLX K;  3TMO A;  1WPK A;  3CES A;  2VC1 A;  4KIC A;  2EIL H;  3H9Q A;  4U0W A;  2BY0 A;  1YRN A;  4M3F A;  2PX9 A;  1OLT A;  4RGU A;  3M07 A;  4XLF A;  1HC8 A;  1O3T A;  2AO9 A;  5HDK A;  5HLT A;  2BW3 B;  2CQX A;  2VJJ A;  1IRX A;  3IKT A;  4LG3 A;  1KA8 A;  2K4J A;  5FKO A;  3N97 A;  4MEY F;  2OD5 A;  2DLL A;  1O57 A;  1K79 A;  2EJR A;  1YX5 A;  3ZQI A;  2JSP A;  1SFE A;  1PYV A;  5LGN A;  1VQ7 I;  1ZLK A;  1BIA A;  5CVI A;  4WCG A;  2W7N A;  3HTS B;  2NRA C;  4CCN A;  1MBE A;  3GME A;  3S14 J;  4CYC B;  3TL4 X;  3OSF A;  3LSI A;  4M6X A;  2E2H J;  3PJR A;  2MFZ A;  4RB0 A;  4HRI A;  4A69 C;  1FOK A;  4BJ6 C;  4S05 A;  3DP7 A;  4QPO A;  3DEE A;  4NUB A;  4CHU A;  2CW8 A;  2XKP A;  3VPR A;  4AYB A;  3U1D A;  3ZOB A;  3DFG A;  1TP4 A;  2HDW A;  3OS1 A;  2LVS A;  3HEF A;  3IRR A;  1OQY A;  1AOY A;  2QYO A;  2XHK A;  2EIK H;  3LA3 A;  5HLI A;  1IN8 A;  4I0A A;  5E18 F;  2QSH X;  2K3F A;  4HX7 A;  3HJE A;  2E7W A;  1X2M A;  1D0X A;  3O8G A;  5KVR A;  1JT0 A;  3JW4 A;  2JUG A;  1W7P D;  3EUH A;  3REO A;  4UB8 C;  5IP9 J;  2XAJ A;  5LBQ A;  4CCL A;  3GTJ J;  2QSG X;  2LD5 A;  4MO7 A;  4HDV A;  4YEJ A;  2DMU A;  2VQH A;  1ULY A;  2MD0 A;  3ZRG A;  4YRV A;  1NG7 A;  2Y0S A;  4EVI A;  3CF2 A;  5DD8 A;  2RC4 A;  3C2H A;  1BA5 A;  3HHH A;  1VQM I;  4IOA F;  3I59 B;  2DPD A;  2DA2 A;  1Z7U A;  1WGX A;  1P9Q C;  3H35 A;  4B4C A;  2R5Z B;  3TOB A;  2LG4 A;  4AYB N;  1QPM A;  5ERI A;  2P7V B;  2ISY A;  2LYC A;  3LSK A;  3BJ6 A;  5IT9 K;  1W5C C;  2MGQ A;  2CUJ A;  3HSR A;  3B73 A;  3LQR A;  4HG2 A;  4CCJ A;  4RAZ A;  3CUQ B;  3HZJ A;  2MLG A;  3PO3 J;  3MKY B;  3IHU A;  4GFB A;  1FJL A;  3OS2 A;  1KU9 A;  1REP C;  1BC7 C;  3DBH B;  5CVU A;  2VT2 A;  3HM5 A;  4LG0 B;  1FNN A;  2COB A;  3S32 A;  1LPQ A;  1DU6 A;  4P1W A;  1FBS A;  3AFH A;  3E6M A;  2ZXW H;  3HC7 A;  4LIV A;  4PZJ A;  1BI2 A;  1EH6 A;  2ZFU A;  3DPL C;  2XUB A;  1IN6 A;  3EQL F;  1HCR A;  1EF4 A;  3I58 A;  1E3P A;  4E7J A;  5HDG A;  3U1K A;  5BMZ A;  1XGM A;  2QA4 I;  2R7Q A;  3MZH A;  2D1V A;  4G9Y A;  2MAB A;  2KT0 A;  3HBL A;  5KAI C;  5E3L A;  5IY5 H;  3BLY A;  4PJN A;  4OIR F;  1PP7 U;  5K7H A;  3A4C A;  3BQZ A;  4MEX F;  2HNH A;  1Y1V J;  3PQJ A;  3LA2 A;  1HXD A;  1F1Z A;  2EZH A;  2PG4 A;  3TO7 A;  4IHY A;  1ZTR A;  4JK1 X;  3MEX A;  1Y1W J;  1XSV A;  1RRJ A;  2VE8 A;  5DEQ A;  3K1P A;  2X1E A;  3AKZ A;  3V42 A;  3PL8 A;  4RGR A;  2CH0 A;  1W36 D;  1HDD C;  3DBL B;  2ESN A;  1VTN C;  3UNG C;  5LRR A;  1IV8 A;  3OYN A;  2PLY A;  5D4R A;  1IRF A;  3MFK A;  1YQA A;  2DN0 A;  2I10 A;  1VQ6 I;  1H9T A;  3JRA A;  2E34 A;  2CW7 A;  4BQN A;  3SDB A;  5E20 A;  3DWL E;  1ITY A;  3X2Q H;  2PEX A;  4AIJ A;  3Q0U A;  4B47 A;  2JSC A;  2RGV A;  2TDX A;  1WZ2 A;  2DQL A;  1HOM A;  2K27 A;  2XB0 X;  1GVJ A;  5FB2 A;  2EA4 A;  4I7H A;  3W6J B;  4ESF A;  4ENK A;  2DO7 A;  4F7Z A;  3ASO H;  5TRD A;  3FZV A;  5GPC A;  2M8G X;  4LOC A;  1YO5 C;  1HBX G;  1ZGA A;  3CME I;  1P4A A;  4L0Y B;  1ETO A;  4HLY A;  1ORK A;  2V9V A;  2IJL A;  2X4H A;  3JSO A;  3CCR I;  3BC8 A;  4M74 A;  5FLV A;  1Z67 A;  2XC7 A;  4KMF A;  1O7L A;  2VJ5 A;  2QEN A;  1PVE A;  2R7U A;  3W2V A;  4G8X A;  1W36 C;  1SMY F;  1P92 A;  2VT3 A;  2UV1 A;  1FYK A;  5FKN A;  2GIV A;  5ICF A;  3D5R C;  3E7L A;  3F6V A;  4YG2 F;  3LFK A;  1QBJ A;  2ME6 A;  1B72 B;  1FPQ A;  2XVC A;  2RV8 A;  3J7A Y;  5IYB J;  2LRD A;  2M4G A;  2EZI A;  3SFZ A;  3N05 A;  1K6Y A;  1XGO A;  3CTA A;  4ITV A;  2ZKZ A;  3KP2 A;  5E1X A;  5C4J J;  4A3E J;  3V8K A;  1H0M A;  4DJA A;  3QYB A;  3FHZ A;  3ZP5 A;  1MDM A;  2E1M C;  1S29 A;  1T56 A;  4B43 A;  5FRM A;  2KP6 A;  3ECH A;  3HOY J;  5IYD J;  3OYC A;  2OPT A;  1TW3 A;  3DKW A;  4LLL A;  5E3O A;  1MJA A;  1RNL A;  1X58 A;  4YFK F;  3KLN A;  1ZN2 A;  4L5I A;  4LB6 B;  4C3I J;  3PIP F;  2VE9 A;  3ZR8 X;  4U0Y A;  2OAZ A;  1JKQ C;  3DTI A;  1KQ0 A;  4RB3 C;  1D8K A;  2HPI A;  4Y33 A;  3KEY A;  2FNP A;  2QSF X;  2QUF A;  1OR7 C;  2FBI A;  1UST A;  1RR7 A;  3FXK A;  2JA7 J;  3K2Z A;  2ID3 A;  3VFZ A;  1FY7 A;  4UHT A;  3CJT B;  2H09 A;  2Z3Y A;  4B48 A;  2HYG D;  3DKX A;  3N4M A;  2FA5 A;  5GAD J;  4IHX A;  5DS9 A;  4CUG A;  5DCM B;  1PUF A;  2CV0 A;  3HSF A;  1OPC A;  2UXX A;  4KIT B;  4KA4 A;  2WV0 A;  4XK4 A;  2DK8 A;  3LL7 A;  2NS0 A;  5ICE A;  3VDX A;  2H1L A;  3BCB A;  3ABM H;  3AAF A;  3CCS I;  1FOX A;  3S1M J;  4A93 J;  2IA0 A;  4HNV A;  4EJO A;  4KJZ A;  3RDI A;  1T2K A;  4OWR B;  4DIQ A;  3CDI A;  4XLP F;  5IYC J;  5CQE A;  1GVD A;  4CH7 A;  2D5V A;  2WA0 A;  4HX8 A;  4E7H A;  1UG2 A;  3WU0 A;  5B1B H;  2JVG A;  4BJ5 C;  3C2G A;  4XL9 A;  2CFO A;  2ZSI B;  3CDL A;  2BVL A;  3A01 B;  4C30 A;  4P55 A;  4JYK A;  2XB5 A;  2ICW G;  4ANJ A;  4HW0 A;  2BVM A;  2WB1 N;  2IA1 A;  5E8G A;  4XN3 A;  1QO0 D;  1S7A A;  3BG6 A;  1KZH A;  3SYT A;  4X0G A;  1WFX A;  2DMN A;  3RZD J;  2OJE D;  3RYR A;  3P5J A;  3FHN A;  3ZQ7 A;  2IW5 A;  1R36 A;  1G6N A;  1XGN A;  2EZK A;  4PCQ A;  3QWL A;  5C4X J;  2FF4 A;  4I2O A;  2MA3 A;  2L01 A;  3HPH A;  1ZR2 A;  2LY1 A;  2I5U A;  4S0H B;  3H3Z A;  2Y75 A;  2DMT A;  3FXM A;  2OCE A;  3H3U A;  1O3S A;  1R58 A;  5EZG A;  1U6G A;  1K4S A;  3ZMU A;  2YPR A;  1ZYR F;  1TNT A;  1MGT A;  1IN7 A;  2IT0 A;  1Z3X A;  5B1A H;  4OMZ A;  1WQ2 A;  3UKG A;  3G71 I;  2E19 A;  2CMP A;  4M9S A;  3K2A A;  5M5Y J;  5EEG A;  3ABK H;  1LE8 A;  5D4S A;  1KYW A;  2V4J C;  3S3O A;  2E71 A;  1OIS A;  2DTR A;  4GGG A;  4II3 A;  1YFH A;  3BR3 A;  2KMU A;  1FZP B;  3QYE A;  2W84 A;  1SD4 A;  2W82 A;  3HOX J;  2K9N A;  4FAS D;  1P6R A;  2BHZ A;  2A3S A;  2BV6 A;  5DYM A;  2F5V A;  2CUZ A;  4M71 A;  5DCF A;  2HPM A;  2LKP A;  1DGR M;  2CQK A;  2DK5 A;  1DDN A;  4E7I A;  2DJI A;  4LLN A;  2IGK A;  5HNH A;  1F36 A;  4FHT A;  3CF5 F;  2JMW A;  2DA7 A;  2MSY A;  2O5R A;  3BG3 A;  3P9K A;  1I5Z A;  4XSX F;  1X1A A;  2FE3 A;  3V7S A;  2LLK A;  4RAY A;  2K86 A;  1LKX A;  1SC7 A;  1YYV A;  3CJN A;  3IH4 A;  4KUM A;  4BAY A;  4IQJ A;  3C2B A;  2CUE A;  2O9L A;  4F92 B;  2HDD A;  3FXR A;  3SEZ A;  3B6C A;  4PJ0 C;  3F21 A;  3S1N J;  2KRH A;  4EAT A;  2W25 A;  1IZ1 A;  2WBM A;  3HG9 A;  5EEA A;  1MBF A;  4HDU A;  1SVO A;  1U3E M;  3HUG A;  1D0Y A;  2L9S A;  4AU7 A;  4IOC F;  2Z99 A;  2FOW A;  5CVJ A;  1R6R A;  2XGC A;  4HX4 A;  2DA1 A;  1LJ9 A;  4H0E A;  4ESJ A;  3AL0 C;  2QBY B;  1E17 A;  1FSH A;  5FFZ A;  2FD5 A;  2WAF A;  2DTZ A;  3E3V A;  3HRS A;  4YFX F;  2IA2 A;  3K4B A;  2CRG A;  2R7S A;  4IF4 A;  2ZO4 A;  3WU1 B;  4BE2 A;  2LF8 A;  2WY8 Q;  4L5J A;  2ZB9 A;  3IV5 A;  2ELK A;  1S6L A;  2YX4 A;  4XR6 A;  3WE2 A;  4ZH4 F;  4BJT A;  2Y69 H;  1ONV A;  3H5A A;  1ZG5 A;  3HXL A;  3JRI A;  4BYY A;  2XAG A;  5A2Q Z;  4E7K A;  2KIU A;  2D1H A;  3K4M A;  1S72 I;  3BTJ A;  4LFU A;  4XKV A;  2LRE A;  2ZNY A;  3K9T A;  4BEH A;  4HV5 A;  3J81 Z;  1JGS A;  2KFD A;  2JUC A;  2V1U A;  3DEU A;  1W7P A;  1HQC A;  1A5J A;  2RKH A;  5JR3 A;  2NXN B;  2BY3 A;  3FXL A;  3MQ0 A;  1DP7 P;  2A6H F;  3CMM A;  1UJ8 A;  3SZP A;  1ETX A;  3E5U A;  3WHB A;  5BNG A;  2K9M A;  2R7W A;  4C3H J;  4XON A;  2ID6 A;  2DAO A;  1ZR4 A;  1AKH A;  1FP1 D;  1UCR A;  3RIR A;  1JKO C;  2VLA A;  3MN2 A;  2K9Q A;  1VND A;  5DV5 A;  2LC2 A;  3SHF A;  3BDD A;  3WGG A;  1YE9 A;  4XMY A;  1ZK8 A;  3IWZ A;  2BXZ A;  5BOX A;  2AXT C;  1QA6 A;  3P7N A;  3RPQ A;  3VYT B;  2V9K A;  1U2W A;  2L9V A;  2VJI A;  3R4K A;  1R71 A;  4NC6 A;  2KIS A;  2N8G A;  1X1C A;  3I64 A;  5HVQ C;  3JRF A;  4FX4 A;  4QTR A;  3ABT A;  1N78 A;  1T8I A;  1XDS A;  3JRH A;  2HZD A;  2VBW A;  2GOX B;  4UUS A;  1XD7 A;  4MNU A;  3L09 A;  2QQA A;  1OJL A;  4KDP A;  5F1J A;  4UUV A;  3M4O J;  2XRL A;  1TTY A;  2NVX J;  2BOL A;  1TLH B;  2E35 A;  4Y52 J;  3RQ4 A;  1FIA A;  3QPL A;  2EH3 A;  1NTC A;  1Z21 A;  3M8J A;  3PO2 J;  3PNY A;  3ZN1 A;  1X1P A;  2RRE A;  3KYL A;  3NWS A;  2ZNZ A;  3TO9 A;  4IL6 C;  1X1D A;  5L3G A;  4ENN A;  2F5C A;  2FSW A;  1UHW A;  2QVO A;  1TW2 A;  2DU9 A;  1YS7 A;  2MH9 A;  3K4C A;  2JWT A;  5J8C A;  2Z16 A;  3RTR A;  4UXN A;  1QRY A;  2L3D A;  3BWG A;  3Q9V A;  1ETQ A;  1WJA A;  2HOE A;  1FX7 A;  4IO9 F;  2LBF A;  1IN5 A;  3F23 A;  1U0J A;  2L7M P;  1PJR A;  1CF7 A;  1TWG J;  2OCC H;  3K4K A;  1N25 A;  2BY1 A;  1MSF C;  1IN4 A;  5FRN A;  1QZZ A;  4AID A;  3DLA A;  3GTK J;  1C0W A;  3GFI A;  4RM2 A;  2XRN A;  3OIQ A;  3C1D A;  4Q4Z F;  2O61 A;  2PBI A;  1MJB A;  1BC8 C;  2HVS A;  2CV2 A;  1XS9 A;  2VBZ A;  2ZXH A;  1YJN I;  3ZMV A;  3E97 A;  2E36 A;  3O2P E;  4F52 A;  3L2R A;  4ZZL A;  3PFI A;  5L3C A;  4EM2 A;  1OR7 A;  2RNJ A;  3VWB A;  1JT6 A;  4Y13 A;  3Q5F A;  2GA1 A;  3VOE A;  4XKC A;  1FLI A;  5J4Y A;  3MZY A;  3BY6 A;  2XF7 A;  3JRG A;  3KFW X;  4Y17 A;  1HLV A;  2M0C A;  2VJ4 A;  4PSW A;  2UZK A;  3JAM Z;  5HLG A;  2JRM A;  3GFM A;  5B3S H;  1U5T B;  1TT0 A;  4NQW A;  5EGO A;  1D5Y A;  1O3Q A;  1T39 A;  2QZ8 A;  4V19 K;  2ZCW A;  5TGT A;  3I55 I;  4DYC A;  4G6D A;  3CJQ B;  1TC3 C;  2Y9Y A;  3WU2 C;  3PFY A;  4AUX A;  4HZF A;  4XOP A;  1MND A;  2VBX A;  4UUS B;  4ENJ A;  1J7K A;  3FF5 A;  3H9G A;  4JOM A;  4C2T A;  3M9A A;  4UY8 I;  2DT6 A;  1YJ9 I;  1VQ4 I;  4G12 A;  5EJC A;  4XRS A;  2Y9Z A;  3KP4 A;  4HPQ A;  1IUY A;  1DP3 A;  4HEA 2;  2E1N A;  3H5R A;  3OYM A;  4JP0 A;  1YG2 A;  2B7E A;  1H8A C;  2O0Y A;  1MBG A;  3I71 A;  2NOG A;  3I53 A;  5GAG J;  4D7N A;  3VYS B;  2EFO A;  2HZT A;  4IJA A;  1FP2 A;  1B9M A;  3QOE A;  2IGO A;  3BP8 A;  4U7B A;  4B1R A;  4IHT A;  2PJR A;  4DOZ A;  4O6J A;  1XMA A;  4RMN A;  5D8L B;  4LK1 F;  1OYW A;  1JUS A;  3OL4 A;  3CMY A;  3DQV C;  1IRZ A;  2VXD A;  2EB7 A;  5F0F A;  4JX5 A;  4ENM A;  2GOM A;  4ZYA A;  4HSR A;  4MQV A;  2ZME C;  3RSN A;  3F22 A;  3GTP J;  3S8P A;  5IPA A;  1EH7 A;  1MZB A;  2XKO A;  2W57 A;  4RDU A;  1U78 A;  4UUT A;  3PUB A;  4EGY A;  4Y4R A;  2ZJR F;  1K7A A;  3PSF A;  3FXU A;  1LQ1 A;  2CG4 A;  2ADU A;  4M6Y A;  2VPR A;  1SFO J;  3DCF A;  2EV6 A;  1R4N B;  3NAR A;  4O5V A;  4D5C A;  1LB2 A;  4BXF A;  3F6O A;  5AON A;  4DYQ A;  2A69 F;  1XX5 A;  1FMV A;  3TP3 A;  1U9O A;  2IGN A;  1WJC A;  2VIX A;  1I1S A;  4XQF A;  2WC2 A;  4A3I J;  3SEQ A;  4A0Z A;  4WX9 A;  1KON A;  3FMQ A;  1GLN A;  1ZRF A;  3H36 A;  4KFC A;  2X1D A;  3BG9 A;  4HYE A;  2MD5 A;  2ELJ A;  4F91 B;  2BGC A;  2QKM B;  3LSM A;  3E6C C;  1BN5 A;  1T98 A;  3DU5 A;  1R4M B;  1Y39 A;  4PK4 A;  1YRN B;  3GXO A;  2EIM H;  3PUF A;  2K4B A;  2M4K A;  3T8T A;  3HOU J;  3MCZ A;  4L5E A;  5HLH A;  5D8K B;  4NDL A;  3EET A;  3E5Q A;  1ZRC A;  4ZTJ A;  1KGS A;  4JBA A;  1S8N A;  5JI6 A;  2QQB A;  1MNM C;  1VQ9 I;  3NWT A;  1XPX A;  4RAF A;  5BPI A;  1G3S A;  2P4W A;  2STW A;  1GXQ A;  5KNL A;  1W0T A;  1XGS A;  1B59 A;  4GYI A;  4WXC A;  2R5Y A;  2JA2 A;  1X2N A;  4H4K C;  1I6H J;  1T33 A;  2LTP A;  3J80 K;  1Y6I A;  2OQR A;  3G2B A;  1USS A;  5E17 F;  4U87 A;  3K10 A;  4IRG A;  2MG4 A;  2CU7 A;  1POG A;  2YU3 A;  4A5M A;  2A61 A;  1Y8R B;  5CQG A;  4C3J J;  4JX6 A;  2HYJ A;  5K5Q A;  1HKT A;  3BR0 A;  3CC4 I;  3LSR A;  1TWF J;  3ZN0 A;  3TP0 A;  3VSK A;  4PSX A;  1JGG A;  1TZL A;  4M73 A;  1GT0 C;  1BOB A;  1M1E B;  1RI7 A;  3GWZ A;  4RM3 A;  2RNG A;  3T0Y A;  1WJD A;  3ULQ B;  1MMG A;  1JHF A;  1BOA A;  3GVA A;  4TV7 A;  4MFE A;  1K6O A;  1J9I A;  1NG6 A;  1ZKG A;  4CYD A;  5FGM A;  3HOS A;  3U2R A;  2RDP A;  4A3J J;  3V7R A;  1X3Z B;  2PMH A; 
#chains in the Genus database with same CATH homology
 1BW6 A;  2O7O A;  1WI3 A;  3W6V A;  5EYR A;  1TWH J;  4X6A J;  2M2E A;  1BL0 A;  3A02 A;  4XIC A;  3PM1 A;  2JA8 J;  3FK6 A;  3LOC A;  3UKG A;  3OIO A;  4A3B J;  2E19 A;  4FE4 A;  3BTL A;  2FQ4 A;  3K2A A;  1ZGW A;  2JN6 A;  5M5Y J;  4FE7 A;  1LE8 A;  1Q1V A;  3HOZ J;  3BR3 A;  2HOA A;  1R9T J;  1MH3 A;  5JLW A;  3HOX J;  2K9N A;  1RKW A;  2DA6 A;  5M5X J;  1ETV A;  3A03 A;  3BR2 A;  2MW8 A;  2LK2 A;  2FJ1 A;  3K7A J;  3RZO J;  3FIW A;  5M3M J;  3Q3S A;  3D1N I;  5M3F J;  3WHC A;  2LFB A;  2X48 A;  2H8R A;  2AHQ A;  1GDT A;  1MSE C;  1F36 A;  2HOT A;  2JMW A;  2DA7 A;  2MSY A;  4FTH A;  1JKP C;  1IUF A;  3LNQ A;  2L9R A;  3BG3 A;  1IV6 A;  5E3M A;  1JTY A;  2LLK A;  4M3G A;  4I6Z A;  4A3F J;  1P7J A;  5HOD A;  3GTM J;  4X1E A;  2QF7 A;  3IH4 A;  4CYC A;  3C2B A;  2CUE A;  1QVT A;  2O9L A;  2JJ7 A;  2HDD A;  3S2D J;  1ENH A;  3G1M A;  2E1O A;  3B6C A;  2LKX A;  3S1N J;  1MBK A;  5EEA A;  1AU7 A;  1MBF A;  2ECB A;  2RAE A;  3IH2 A;  5GP9 A;  5EGO B;  2R92 J;  2K9S A;  1NK3 P;  2ECC A;  3BR6 A;  3CCY A;  3S17 J;  2XPV A;  1G2H A;  5IOY A;  1VFC A;  2XGC A;  2TCT A;  3CQZ J;  2DA1 A;  2VUM J;  4DYR A;  4BKX A;  2FD5 A;  1B72 A;  1JTX A;  3BTC A;  5F0C A;  2DTZ A;  3Q0V A;  5FLM J;  1IC8 A;  4ABZ A;  2L0K A;  3MVP A;  2CRG A;  5F0H A;  2FX0 A;  1IGN A;  2IEK A;  3IV5 A;  1GV2 A;  2ZB9 A;  1IDY A;  2ELK A;  3GTO J;  1H89 C;  3RQI A;  1BW5 A;  2Y0S N;  3SFI A;  4BY7 J;  4M6V A;  3FIS A;  3JRI A;  3GTG J;  3Q0W A;  3BTJ A;  2O8K A;  4MIM A;  1B8I A;  5M5W J;  2M9H A;  3HDD A;  2W48 A;  3BG5 A;  1WH7 A;  3S1Q J;  2L7F P;  1A5J A;  2YUS A;  2JK3 A;  1JJ8 C;  4I76 A;  3OOU A;  1OFC X;  4M3B A;  3H0G J;  1WPK A;  3HB9 A;  2R0Q C;  4A3M J;  2HOS A;  1ETX A;  4QSH A;  3WHB A;  5BNG A;  5K7F A;  4C3H J;  1YRN A;  2DA5 A;  4M3F A;  4XRM A;  1IG7 A;  1RKT A;  2ID6 A;  1ZR4 A;  1AKH A;  2AO9 A;  1SAN A;  1JKO C;  2CQX A;  3HKZ N;  3MN2 A;  4BBS J;  2WAQ N;  2K9Q A;  1VND A;  2HXI A;  2K40 A;  4M3E A;  2NVQ J;  3H3V K;  3HOW J;  2PMZ N;  3HOV J;  2JA5 J;  5FKO A;  3I4N J;  1ZK8 A;  3GBG A;  4B3A A;  2ME0 A;  3ZQI A;  3L1P A;  2X6O A;  2E2I J;  1MBE A;  3S14 J;  5J3L A;  4CYC B;  3OSF A;  2XPU A;  2E2H J;  3A01 A;  2IBD A;  1JJ6 C;  4A69 C;  2N8G A;  4D5F A;  1OCP A;  5EG0 A;  5FKM A;  2P81 A;  3JRF A;  1MBJ A;  3JRB A;  4QTR A;  5F08 A;  2HQ5 A;  1E3O C;  3VPR A;  3ZOB A;  5K7Z A;  3JRH A;  4UUS A;  2LVS A;  3HEF A;  3ZQF A;  2CUF A;  5J1U A;  5IP7 J;  2DMQ A;  1OJL A;  1VF9 A;  5F1J A;  1PUF B;  3M4O J;  2XRL A;  2NVX J;  1X2M A;  4Y52 J;  3O8G A;  1JT0 A;  2E2J J;  2EQR A;  1FIA A;  3IH3 A;  2DA3 A;  2EH3 A;  3QPL A;  5IP9 J;  1NTC A;  3GTJ J;  5DTD A;  2CJJ A;  4RBO A;  2LD5 A;  3PO2 J;  4MO7 A;  1UHS A;  2DMU A;  1MH4 A;  1WCM J;  4V2F A;  2Y30 A;  2R5Y B;  1IJW C;  1ETW A;  1BA5 A;  1ETK A;  1WH5 A;  2DA2 A;  2JWT A;  2LP0 A;  1WGX A;  2R93 J;  3JR9 A;  4B4C A;  1Z77 A;  1FTZ A;  1FTT A;  1QRY A;  2R5Z B;  5J1R A;  1XC5 A;  4AYB N;  2HI3 A;  1ETQ A;  2MGQ A;  1BJZ A;  2XGE A;  3PO3 J;  2L7M P;  4GFB A;  1FJL A;  1P7I A;  1TWG J;  1MSF C;  2NVT J;  3HM5 A;  3RKQ A;  2COB A;  2EZL A;  3GTK J;  1DU6 A;  3SDG A;  4EEF G;  1TWC J;  1EF4 A;  1U9N A;  1HCR A;  1XS9 A;  2LR8 A;  5EDN A;  1U8B A;  4FIS A;  1GUU A;  5C3E J;  1QVU A;  2QCO A;  3OSG A;  3LSJ A;  2GLO A;  3S16 J;  5IP6 A;  4V2G A;  1JT6 A;  2KT0 A;  2DMP A;  3HBL A;  5E3L A;  4W1U A;  3ZQL A;  5K7H A;  3BQZ A;  1I3Q J;  1Y1V J;  3G1L A;  3JRG A;  3FKI J;  3TW7 A;  1LE8 B;  4W97 A;  1HLV A;  2EZH A;  2WV1 A;  1I50 J;  4IHY A;  4IHV A;  1ZTR A;  1Y1W J;  1K83 J;  2M0C A;  2XSD C;  1XG1 A;  4DW6 A;  2NVY J;  2R7Z J;  3S1R J;  1HDD C;  1A6I A;  4C2M J;  1VI0 A;  5EGO A;  1D5Y A;  5E3N A;  3GTQ J;  4IEJ A;  2B63 J;  4DYC A;  5EG0 B;  3JRE A;  5FKK A;  2DN0 A;  1TC3 C;  2I10 A;  2HXO A;  2Y9Y A;  3JRA A;  3NAU A;  4AUX A;  4FCY A;  1TWA J;  3BR5 A;  1ITY A;  4UUS B;  1F43 A;  3Q0U A;  2VI6 A;  2DJN A;  4A3C J;  3BQY A;  1OCT C;  3B6A A;  2YU9 J;  1HOM A;  2XB0 X;  4G12 A;  4XRS A;  2Y9Z A;  3BTI A;  3JRD A;  4JP0 A;  2IAI A;  1H8A C;  5F04 A;  1MBG A;  2JA6 J;  2NOG A;  2GBY A;  4D7N A;  5GPC A;  2M8G X;  4LOC A;  3GTL J;  3M3Y J;  4B1R A;  2XPW A;  3BT9 A;  1ETO A;  1ORK A;  1LFU P;  5J1Y A;  2NS7 A;  1IRZ A;  1JUS A;  3CMY A;  9ANT A;  5FLV A;  5F0F A;  4JX5 A;  1UMQ A;  1HF0 A;  3S15 J;  3GTP J;  5IPA A;  5FKL A;  4RDU A;  3LSP A;  1U78 A;  1ZQ3 P;  5FKN A;  1CQT A;  4UUT A;  3ZQH A;  3E7L A;  4XID A;  2ME6 A;  4A3K J;  1O4X A;  5FJ8 J;  1B72 B;  1AHD P;  4DZP A;  2VPR A;  5IYB J;  1SFO J;  3DCF A;  4MFD A;  3JRC A;  4IHW A;  4DZJ A;  3NAR A;  2EZI A;  4D5C A;  3FK7 A;  2GM4 A;  1RES A;  5C4J J;  4A3E J;  1W0U A;  1NK2 P;  1T56 A;  4DYQ A;  3I4M J;  3TP3 A;  3BR1 A;  1U9O A;  3HOY J;  5IYD J;  3LSG A;  1RET A;  1Z0X A;  2OPT A;  2M34 A;  4BXX J;  4QIW N;  5E3O A;  4A3I J;  1JKR C;  1X58 A;  3SJM A;  1RPW A;  2OF7 A;  1B8I B;  4C3I J;  4BY1 J;  5JLX A;  3ZQG A;  1JKQ C;  3BG9 A;  4XRS G;  2YS9 A;  3MKL A;  2CQQ A;  2NS8 A;  5GPA A;  3TED A;  1DU0 A;  1APL C;  1RR7 A;  1HDP A;  4AC0 A;  2JA7 J;  2ID3 A;  3QQA A;  5C44 J;  2L7Z A;  1YRN B;  5EF6 A;  3HOU J;  2EBI A;  4IHX A;  4L5E A;  5DS9 A;  1AKH B;  1PUF A;  1S7E A;  1FEX A;  4NDL A;  4XK4 A;  1LFB A;  3HGY A;  3S2H J;  1GV5 A;  1MNM C;  3DEW A;  3S1M J;  4A93 J;  4HNV A;  2LY9 A;  1K61 A;  2DA4 A;  4MLO A;  1JUP A;  1W0T A;  2VKV A;  3QPS A;  4M3D A;  5IYC J;  2R5Y A;  1GVD A;  1X2N A;  2D5V A;  1I6H J;  1T33 A;  2LTP A;  3F0C A;  1UG2 A;  1IDZ A;  4BBR J;  3CDL A;  3A01 B;  4JX4 A;  2MG4 A;  2CU7 A;  2G0E A;  1POG A;  1QPI A;  4JYK A;  1ETY A;  2XB5 A;  4D7M A;  3TW6 A;  4A3D J;  2R5Z A;  4C3J J;  2WB1 N;  2HYJ A;  4JX6 A;  3BR0 A;  3ZQC A;  3LSR A;  1TWF J;  3RZD J;  2DMN A;  3G1O A;  5EZH A;  5F27 A;  3TP0 A;  2Y2Z A;  1JGG A;  5IOZ A;  1GT0 C;  2VKE A;  2H1K A;  1JUM A;  3O8H A;  2X9D A;  2EZK A;  4J19 A;  2Y31 A;  5C4X J;  2TRT A;  1FIP A;  1MBH A;  4A3G J;  4MFE A;  1ZR2 A;  1ZKG A;  1H88 C;  4S0H B;  2KDZ A;  4A3J J;  4Y7N J;  2XGD A;  4A3L J;  2DMT A;  3HGG A;  5EZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...