3RZOJ

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3rzoJ00
3OIOA 2XSDC 1F43A 4MIMA 1JTXA 3B6AA 1MBJA 5K7ZA 3JR9A 3GTMJ 2ME6A 2VI6A 4JX5A 2DA5A 4DZPA 1HOMA 3JRFA 2NOGA 5F0FA 1OCTC 1QVUA 2EZKA 2EZLA 1WCMJ 3D1NI 1HCRA 4B4CA 4XICA 2PMZN 2E2HJ 5F04A 5J1UA 4IHXA 1ETQA 4IEJA 1K83J 3LSJA 4D5FA 2FD5A 5M3FJ 2VKVA 3ZOBA 3Q0VA 5C4JJ 4NDLA 4MO7A 3Q3SA 1BL0A 2CQXA 1B8IA 4A3KJ 4M6VA 1PUFB 3FK6A 4IHWA 3MVPA 4BBRJ 4LOCA 5FKNA 5J3LA 2ME0A 3QPSA 4FCYA 4A3BJ 1ETWA 1G2HA 1ZK8A 3HBLA 3OSGA 3I4NJ 3HGGA 1HDPA 2IEKA 3ZQCA 2LP0A 4AYBN 2CUEA 1TWHJ 2R0QC 3OOUA 1RETA 1FJLA 2O7OA 1MH3A 1MSFC 1H88C 4CYCB 2IAIA 1GDTA 1Z77A 1LFBA 1I3QJ 4Y7NJ 2YS9A 1ETOA 5EGOB 1JKQC 3HDDA 5IPAA 1A5JA 3B6CA 1JKOC 2AHQA 3NARA 1X58A 1B8IB 2RAEA 1WH7A 5F08A 3SJMA 1JT0A 2L7ZA 3GBGA 4FE4A 5IP6A 1WPKA 3BR5A 3DEWA 1Y1WJ 1R9TJ 2KDZA 1JGGA 4C3IJ 2TRTA 4A3FJ 4A3LJ 2FX0A 3S1RJ 3NAUA 4XRSA 1TWGJ 4X1EA 5HODA 2CU7A 2ECBA 3JREA 1QVTA 2GBYA 1ENHA 4G12A 3JRGA 1LE8B 3BT9A 4QTRA 2FJ1A 1MBGA 2MG4A 2DJNA 4DZJA 2ID6A 2LTPA 4DYCA 1U78A 2DA2A 3BQZA 3RZOJ 2OPTA 2HDDA 3BR2A 5GPCA 1NK2P 1YRNB 2B63J 2EZHA 2LLKA 3LOCA 1RPWA 1UG2A 1WGXA 2COBA 3TW6A 2D5VA 3F0CA 3PO2J 3ZQHA 2DA1A 3OSFA 3SFIA 3A03A 2WB1N 4A3CJ 2HOAA 5IYDJ 4L5EA 1K61A 2E2JJ 4M3BA 3IH3A 4BKXA 1FIPA 3BQYA 4EEFG 2DTZA 4MFDA 3HOXJ 1W0UA 5J1YA 4AUXA 1JUPA 4W1UA 1B72A 3QPLA 1IUFA 5EYRA 3TW7A 4I6ZA 4FE7A 1IDYA 2ID3A 5IP7J 4GFBA 2GM4A 2Y9YA 4M3EA 5J1RA 1DU0A 2JA7J 2AO9A 1FTTA 3GTKJ 2LK2A 1JTYA 2WAQN 1D5YA 2XGDA 1HDDC 4BXXJ 4M3FA 2MGQA 3BR6A 2I10A 1WI3A 2LFBA 3TEDA 2HOTA 1H8AC 2L9RA 5EEAA 4BBSJ 1SANA 1TC3C 3M4OJ 1LFUP 2CJJA 4XIDA 5FKMA 1I6HJ 4XK4A 1S7EA 2DMTA 3DCFA 5FKKA 4JP0A 1Q1VA 2DMNA 2K40A 3CDLA 1AKHB 1GV5A 4UUSB 4ABZA 2E1OA 1P7IA 3S15J 3HEFA 4A3MJ 3S1QJ 3UKGA 3HGYA 3S16J 2R5YB 4X6AJ 1ZR4A 2HXOA 2H8RA 3ZQFA 1VI0A 2W48A 2XGCA 1BA5A 1B72B 3GTGJ 4B3AA 2JN6A 3WHBA 1CQTA 3RKQA 1FTZA 3SDGA 3S2DJ 1WH5A 2MSYA 1MNMC 3VPRA 4FTHA 1RKWA 2M8GX 5IOZA 5IYBJ 3S17J 1POGA 2K9NA 1JUSA 5DS9A 1F36A 1MSEC 5FJ8J 3S1NJ 3Q0WA 1UMQA 3I4MJ 5IP9J 1IRZA 4MLOA 3RZDJ 5M5WJ 5C44J 1ITYA 5K7FA 2VKEA 2NS7A 3IH2A 3ZQLA 1ETXA 3PM1A 4DYQA 3QQAA 2M0CA 1NK3P 1VF9A 3JRHA 5F27A 9ANTA 1JKPC 2Y0SN 1LE8A 3WHCA 3W6VA 3H3VK 1MBKA 4A3IJ 4DYRA 1JKRC 1QRYA 5JLXA 2E2IJ 2HXIA 4HNVA 1ZTRA 5F1JA 4UUTA 3ZQGA 2IBDA 2NVTJ 4A93J 2YU9J 5FLMJ 4A3EJ 1DU6A 2JWTA 1ETKA 2X6OA 1ZR2A 2HI3A 1IC8A 2O8KA 4Y52J 3TP3A 5E3LA 5FKOA 5EGOA 3JRBA 4B1RA 3S14J 5IOYA 4QSHA 2MW8A 1SFOJ 3PO3J 2G0EA 2OF7A 1Z0XA 3LSRA 2GLOA 2LVSA 2QF7A 3HOZJ 2L0KA 2JJ7A 1AKHA 3HOVJ 2L7MP 2L7FP 1BJZA 3FKIJ 2XGEA 4C3HJ 2R7ZJ 3IV5A 1ETYA 2DMUA 3GTJJ 3C2BA 4RBOA 3HOUJ 3JRIA 1XC5A 5E3MA 3MN2A 2DA4A 2XPUA 2NVQJ 4D5CA 1IG7A 1OCPA 1QPIA 2CUFA 5EF6A 3IH4A 2JMWA 3K7AJ 1U9NA 1JUMA 3BTLA 5K7HA 2K9SA 3BG9A 4RDUA 1JJ6C 2R5ZA 1RR7A 1ZGWA 2JA6J 1VNDA 4D7NA 1TWFJ 4A3GJ 4S0HB 3BR1A 1Y1VJ 5GPAA 1TWCJ 4A69C 4C3JJ 4M3GA 2EZIA 2R5YA 2X9DA 3FIWA 1RESA 2N8GA 1APLC 1ETVA 3JRAA 1RKTA 4I76A 3GTLJ 2Y9ZA 2O9LA 1BW5A 1X2NA 2DA7A 2NS8A 2M2EA 4JX4A 2LR8A 1ZQ3P 1IGNA 1BW6A 4M3DA 1HLVA 5FKLA 3GTQJ 3JRDA 5E3NA 2P81A 5F0CA 1O4XA 2DN0A 2Y31A 3H0GJ 4DW6A 3FISA 2YUSA 4D7MA 4J19A 1GT0C 2JA8J 1TWAJ 3BR3A 3S1MJ 1ZKGA 3BTIA 2XB5A 2XPVA 3LSPA 3A02A 1T56A 3S2HJ 1P7JA 3CMYA 4A3JJ 5M3MJ 3HOWJ 4V2GA 2X48A 2ZB9A 5EG0A 3L1PA 2HQ5A 3CQZJ 1MBHA 1OFCX 1FEXA 1MBFA 5C3EJ 2QCOA 3LSGA 4AC0A 3MKLA 3O8GA 3RQIA 3O8HA 4W97A 3HKZN 1U9OA 2M9HA 2E19A 2EH3A 2M34A 2ECCA 3Q0UA 1GVDA 3A01B 2WV1A 1MBEA 2EQRA 1XG1A 1AHDP 3BG5A 2CQQA 3LNQA 2VPRA 5DTDA 2DMPA 4BY1J 1OJLA 1UHSA 1A6IA 3G1OA 3BR0A 5F0HA 2LY9A 3K2AA 4IHYA 3G1MA 2NVXJ 4XRMA 4QIWN 2JK3A 3BTJA 3GTPJ 4V2FA 1E3OC 5EZGA 5EG0B 3GTOJ 3HOYJ 5GP9A 1ORKA 5JLWA 1YRNA 2XB0X 1GV2A 2EBIA 3ZQIA 2DA6A 5BNGA 2R5ZB 2HOSA 2XPWA 2H1KA 2Y30A 1VFCA 2ELKA 3CCYA 5FLVA 2NVYJ 1IDZA 3HM5A 1W0TA 1AU7A 1IV6A 1GUUA 1PUFA 1NTCA 3JRCA 1IJWC 2XRLA 3E7LA 3G1LA 4BY7J 4FISA 2DA3A 2LD5A 4JX6A 5E3OA 1HF0A 3A01A 2KT0A 4XRSG 3FK7A 3TP0A 4C2MJ 5M5XJ 1FIAA 3M3YJ 5IYCJ 2JA5J 5C4XJ 2R93J 4CYCA 1JJ8C 2DMQA 2TCTA 1X2MA 5M5YJ 2Y2ZA 1U8BA 4IHVA 3BTCA 3HB9A 2FQ4A 1JT6A 4MFEA 1EF4A 3BG3A 2K9QA 1H89C 5EZHA 1MH4A 5EDNA 2LKXA 2CRGA 4A3DJ 2VUMJ 2HYJA 1T33A 1I50J 4JYKA 1XS9A 2R92J 4UUSA
chains in the Genus database with same CATH superfamily
2G9WA 3OIOA 3CTAA 4P9UA 3CUQC 2HDWA 4M6XA 3CC2I 3J7YJ 1MBJA 1TBXA 3QOEA 3WTTC 3JR9A 5DYMA 1FC3A 2DA5A 1IN4A 1HOMA 2NOGA 1AWCA 2LOOA 5F0FA 1ZARA 4ASNA 1W1WE 1OCTC 1U5TC 2M8EA 2V6CA 2ZXHA 4CUGA 4I02A 4RGUA 3TO9A 2E2HJ 2PMZN 4XKBA 3ZCOA 2QBYA 1ZREA 5J8CA 4CDGA 1KQ0A 2JSPA 1IZ1A 4MQ9F 2FD5A 2YX7A 1A36A 4GCVA 3ZOBA 2R3SA 3C18A 1J2XA 3DBRB 1TQPA 3DF8A 2F6CA 3FMRA 4CA0A 3FK6A 4N4NB 2F2EA 3MVPA 3ROUA 2VE8A 3TL4X 3QPSA 1ETWA 1YJNI 1G2HA 4YELA 3OYIA 3F22A 3HGGA 4ANJA 3ZQCA 3I59A 3M8FA 1HW1A 1WFXA 2LP0A 3ZMDA 2CUEA 1WJ5A 2JPCA 2Z16A 2KRFA 3WODF 1WWXA 2R0QC 2Z2SB 3K4LA 1UAAA 1LVKA 2DW4A 3E5UA 3MKWB 2PMHA 2WWYA 5HDKA 2OCEA 1H88C 1IV8A 4B48A 3OYFA 2CS3A 1MKMA 1TQMA 1JXSA 4BXUA 5EGOB 4PJMA 1JKQC 5DV5A 2DPDA 5IPAA 2E35A 1YI2I 4CZCA 4ENMA 2FMLA 1NH3A 5LEJA 2RVCA 1KU7A 4HQMA 2E1CA 4BH9A 2WB1A 1B8IB 5F08A 3D0SA 3KEYA 2FMYA 4AIHA 4FE4A 4E7JA 1P4WA 3BR5A 3H1CA 4XMYA 4LIUA 4EJVA 2FX0A 3NAUA 2L4AA 2PN6A 2R7OA 3OYLA 1MMDA 3E0JB 3HTUA 1VQ8I 3DPTA 4EGZA 3P7NA 2DJNA 3AG4H 4DZJA 3CMEI 2BE5F 1G8XA 5CYVA 2LTPA 2BBYA 1U78A 2DA2A 3ISPA 5BMZA 5CJ9A 2Y69H 3RZOJ 1YS6A 4WK8F 2OPTA 3QP5A 4MNUA 3LA7A 1IN6A 2R7RA 2HDDA 4QLCU 3BR2A 1NK2P 2B63J 2HPIA 1RPWA 1MIJA 1WGXA 4OMYA 3H0DA 4PUSA 5K1YA 3F0CA 5KVRA 4MTEA 2VONA 3O6BB 4UB6C 1TZLA 3RDIA 2OBPA 1ZGJA 3L2WA 3C2GA 4A3CJ 3OL4A 4ZC3A 2QWWA 2K02A 2NYXA 5IYDJ 2R7QA 4IRGA 3QU6A 3BG6A 1O7FA 1VQMI 3SEZA 4BKXA 2F4MB 3KZZA 3BQYA 4EEFG 5EEHA 4MFDA 3HOXJ 3WGGA 4W1UA 2FUG2 3C1DA 3GZ5A 1Z7LA 5EYRA 3WU1B 1IDYA 2RGVA 4GFBA 5D8KB 2Y75A 2GM4A 5KK1A 2E5NA 3H5NA 1D1CA 3EPZA 3K4CA 2KRHA 3GTKJ 4G8XA 3BWGA 2BW3A 4BEHA 4LMYA 4EJUA 2UWMA 3BDDA 1XD7A 2VIXA 3BR6A 3GLXA 4UV8A 4MHGA 3TEDA 2B9SA 4Y15A 2HU9A 4FASD 3DEUA 3DLLF 2QUFA 1R1VA 3SHFA 4CO8A 1SANA 3DKXA 3RI4A 2CJJA 3I64A 1AOYA 4KYWA 4LLNA 2DMTA 4XRFA 4JP0A 2DMNA 2K40A 4KT5C 1FOXA 3BC8A 3OMYA 3IP4B 3S15J 4BHPA 1FOWA 1D5VA 2XF7A 3UKGA 5CVVA 3WTYC 3I55I 1K6OA 4A0ZA 2VQCA 2H8RA 1P2FA 5AONA 1KQ8A 2ICWG 3MZHA 3DBLB 4G94A 1BM9A 4YIRX 2XHKA 1MNMC 1XPXA 2CW8A 5E18F 3LA2A 3FF5A 3GZ6A 2GIVA 4B43A 5IOZA 2JSCA 3HG9A 2HEOA 1WKMA 2HR3A 1F36A 3DV8A 4ON0A 4IJAA 3S1NJ 1R71A 2WADA 2X4HA 5IP9J 4ETSA 1IRZA 4GDFA 2LF7A 3IRQA 3PNVA 4BQNA 3RYPA 5M5WJ 2BOLA 3OYEA 4A0YA 1DPRA 3QPTA 3WG7H 3WTZA 2VT2A 2NS7A 3ZQLA 3KFWX 5B3SH 5GTIC 4DYQA 1IN5A 3F3XA 2M0CA 2FXAA 1Z1DA 2RKHA 3PNTA 4NQWA 2W85A 1HA8A 3FZVA 4S04A 9ANTA 2M87A 2WBMA 4M72A 4PJNA 1J9IA 2HDCA 2P5VA 2Z5UA 2DT5A 3F8FA 4A5MA 1MBKA 1RR8C 4AIJA 4G7OF 2JPBA 2ZMEB 3T0YA 1QRYA 5KNLA 4PZJA 4UV9A 5F1JA 1XCBA 2L9NA 2NRAC 2A6TA 2Y0MA 2KDOA 4HX4A 1DU6A 4A3EJ 2X6WA 1SFXA 2X6OA 1ZR2A 3UR3C 3BPXA 4L18B 3CCMI 5H6QA 1YO5C 2RNJA 2DOAA 2L2OA 3FBNB 5JVTA 4IOAF 1G6NA 3EUKL 1F9NA 4Y3OA 4I0BA 3S8PA 5E3LA 1X3WB 1XN7A 5EGOA 1BC7C 3K1NA 4EGYA 3WU0A 1DUXC 1OISA 3S3OA 1B6AA 4YRVA 1YW8A 1OCRH 5JHFA 2F5EA 3JAMK 1K78A 2HTJA 1T38A 4QSHA 3KYLA 2OF7A 3F8NA 1IXCA 1HBXG 3HL2A 3HOZJ 4RB0A 1T0FA 2JJ7A 3EETA 1O7LA 1P4AA 2A68F 5E1WA 4XORA 1MZBA 4IO9F 1YTYA 1Z21A 2VJ4A 4M6YA 1FX7A 3DFGA 2EFPA 4OIPF 3HOUJ 5E3MA 3K69A 4Z2YA 2XPUA 3IC7A 1IG7A 3PJRA 5LGNA 3HUGB 2IA1A 2QA4I 3AL0B 1Q1HA 3TDUC 1HKSA 3CCEI 1MD0A 2JMWA 3MMYB 2K9SA 2FOWA 4B44A 4RDUA 1JJ6C 3I56I 1MNDA 2IXSA 5DM7F 4OINF 3K9TA 2F5FA 2H6BA 2LH9A 1L3LA 2OZ6A 3K70C 1TWFJ 4QPOA 1K4SA 2RV8A 2OA4A 1U0JA 4A69C 3F8BA 1RUNA 3DWLE 2RC4A 2CW7A 1MNEA 2IP2A 3FIWA 2VOOA 3FXLA 2H09A 2LBFA 3KZYA 4IOCF 2RREA 3RPUD 4V19K 4IRIA 4LD5A 2Y9ZA 1BW5A 2EINH 2NS8A 2M2EA 3CP2A 2LR8A 4RB1A 1VQLI 1IN8A 3IUOA 3GTQJ 1OR7C 5D4SA 5E3NA 2DQLA 3R4KA 1R4MB 1O3QA 1F1ZA 2EV0A 4D7MA 4J19A 4J01A 2CQ7A 1R5HA 4IZZA 4ESJA 5JI6A 2XB5A 4NNJA 2PMZA 2OC6A 3P5JA 4G6QA 1GXQA 1KYWA 2ZBKA 5FFZA 3R6SA 4BE0A 2O03A 1GHCA 2CQNA 3L1PA 2ZSHB 3J81Z 5K5OA 2BYVE 1D0ZA 3CQZJ 1Z7UA 1MBHA 1OFCX 1MBFA 2HOEA 2QCOA 5C3EJ 2DI3A 4UUVA 1HQCA 2DT7B 2VASA 4W97A 2YX4A 3LSMA 3HKZN 1ZRCA 2DT6A 4XLCA 2DQRA 2F4IA 2GIZA 4I09A 3OYBA 1R1TA 2E19A 3DTEA 2A5YB 2VPRA 2MFZA 2FSWA 1A6IA 2PJRA 3VDXA 3VODA 2OQRA 1I5ZA 3K2AA 3IAS2 1XGOA 4U0WA 4AVPA 1OCCH 1UG0A 2JTVA 3IRRA 4L0ZB 3TMOA 3ZMVA 3GTPJ 2CV2A 1E3OC 1H9TA 5LRSA 5HVQC 4CCNA 2KZVA 4XNFA 5D5UB 1RRJA 2LKSA 5BNGA 2XPWA 2XROA 3BOQA 3GMEA 3L9FA 3DQVC 3M8EA 3Q9VA 2ELKA 2ZXWH 2DFFA 4A6DA 2W84A 3OS1A 3BPVA 2OCCH 3A0HC 3HM5A 1MJAA 1W0TA 2VB6A 1AU7A 4BL0B 4U88A 1YITI 1IV6A 2KIFA 2L9SA 2E71A 1PUFA 4LG0B 2IS1A 2F5CA 2HNHA 4OIRF 3TGNA 4BJTA 1ON2A 2HZTA 5J40A 1HF0A 1S7OA 3V7RA 4RAFA 1GLNA 2UV1A 3FK7A 3TP0A 4BEHB 3M3YJ 4G6TB 4ZTJA 4ZH4F 4CYCA 3PFYA 1SMTA 1RIOH 2DMQA 3KP7A 1T2KA 1X2MA 2Y2ZA 4IHVA 3HB9A 1JGSA 5D4RA 2IRFG 2DODA 5LLQA 4HF2A 2K9QA 3HSEA 3S2WA 2ZJQF 4O5VA 4HSTA 1MH4A 2CRGA 3SZTA 4C30A 1R5ID 4A3DJ 1SD5A 2KRCA 3L2UA 3OS0A 2WTEA 1IRFA 4BDZA 5BPIA 3F23A 5E79C 3QWLA 2EILH 2O61A 1YQAA 3NEUA 2JUCA 5LRRA 1UJ8A 3OR2C 1R58A 1O57A 2MLKA 4XKCA 4JX5A 4HNTA 2Q2EB 2STTA 1TT0A 2YSRA 4Q4ZF 4OWRB 2EZKA 3HRSA 1LPQA 2QM3A 5J1UA 2DXIA 1QHHD 2KJCA 2G7HA 2VLAA 4ESBA 1K83J 4MEXF 1E3PA 1NG7A 1I1GA 1HKQA 1WQ2A 2EPFA 2LY2A 1S5LC 4M9XA 1LEBA 3MKZA 3ZPLA 5LFAA 2EIMH 2M45A 2R7SA 2GOMA 1B8IA 4LG0A 1PUFB 4IHWA 3HHHA 3M1CA 3HOTA 2EA2A 4GYGA 5FKNA 1G59A 3GEZA 4KNYA 3HIFA 3LA3A 2AQFA 2BVLA 4UXNA 2EV5A 4FCYA 1X1AA 4HX8A 3PQJA 2DJIA 5ICGA 3HBLA 3OSGA 3V8LA 1HDPA 2PFBA 3M1EA 3OIPA 5L3DA 3I53A 3OOUA 1YIOA 3CP8A 1V5EA 2EIKH 4I99C 1QZZA 3ERED 1UFMA 2IAIA 1GDTA 1RUOA 2OTJI 1ETOA 4H0EA 3AG1H 3JAMZ 2KISA 2QGUA 2IS6A 3NARA 2VPLA 3G73A 1X58A 3BROA 3MFKA 3FWEA 2RAEA 2VBXA 1JT0A 3LSHA 4I2OA 1WPKA 3BZKA 5GAHJ 5LBQA 5D8LB 1JGGA 2ZKZA 2TRTA 4A3LJ 5KAIC 1OKRA 3OR1C 1FMVA 4X1EA 2AXLA 4RB2C 4PDKA 4HNUA 1HC8A 5F64A 2E36A 2NAZA 2ECBA 2NOJB 1QVTA 2GBYA 1ZRFA 4G12A 2AS5F 3T1BA 2YR2A 3BT9A 2E1MC 3EUHA 2MG4A 3JTHA 1FY7A 4A12A 4BUPA 2Q2EA 2WAQA 2ZJRF 2QKMB 2VXZA 4JBAA 3LQQA 3BQZA 3KYCB 2L01A 1W36C 1Y6IA 4N9HA 2W82A 2V9KA 5GPCA 1PUEE 4B47A 3OS2A 4FX4A 4AVZA 4PSXA 1X4OA 3GX4X 4E7LA 2IW5A 3VOEA 2W25A 4KT6A 3ZQHA 1IF1A 1BIAA 3OSFA 2A6HF 3SFIA 2K9LA 3A03A 5LGUA 2WB1N 3FXJA 4XLPF 2O8XA 4C2TA 1O3TA 4YEJA 5LEKA 4OIQF 3LFKA 4WX9A 2ADUA 2CUZA 2ESHA 2LBFB 3KZIC 4CICA 1VQKI 3W2WA 1JUPA 1S9HA 2MBFA 3QPLA 2DCEA 4NQWB 3TW7A 3L09A 2M4GA 2J5OA 2BZTA 3NWTA 2ID3A 1B1BA 3LAPA 2BEOA 1U5TB 5J1RA 1DU0A 1U5TA 2M4KA 2AO9A 2EJRA 4PJLA 2JA2A 3AFHA 1YG2A 3KP4A 4A2UA 3AAFA 2LK2A 1JTYA 3JSPA 2RDPA 1HDDC 4BXXJ 3QRFF 1O3SA 3H9QA 1EH6A 4DJAA 3FHZA 1VQNI 2JT1A 3WGHA 4BYYA 4OMZA 2A69F 1WI3A 4LITA 2V9PA 2LFBA 5CQGA 1H8AC 3CUQA 4BHBA 2BHYA 3CLQA 2O0YA 5J8FA 2L9RA 2HKOA 2OV7A 3H9JA 3TQNA 1SFKA 1N78A 1I6HJ 3LSTA 5FKKA 1Q1VA 3QU3A 3CDLA 2CMPA 1X19A 4ABZA 5JVGF 3K1MA 3TBIA 5JHUA 3UNGC 3I59B 3HEFA 1VQ7I 4A3MJ 3S1QJ 4HPQA 2R5YB 1TNTA 4HW0A 5HLIA 3MWMA 1KA8A 2CSOA 2PG4A 1K6YA 2W48A 3E97A 1OYWA 1SAXA 1B72B 1W5CC 1DP3A 3GWZA 1U3EM 3SDGA 4IF4A 1VQPI 1J0RA 2IGOA 5CVUA 4ZYHA 3NWSA 4G9YA 5LHIA 3L7WA 1Z3XA 3JW4A 4L5JA 3KLNA 2WY7Q 3FM3A 4TV7A 5FD5A 1PVEA 3SZGA 1G3TA 1POGA 2K27A 5FO5A 1D1AA 4HV6A 3AG3H 2VXDA 2WAFA 3GCMA 3KIOA 2FU4A 3VYUB 5FJ8J 2FRHA 1I27A 4QWQA 3OL3A 3DP7A 2ISZA 3G4SI 5HLHA 3RZDJ 4U0YA 5IT9K 1FLIA 2KP6A 3ECHA 1ITYA 2HWVA 1BR1A 2VKEA 3DU5A 1IN7A 5K7FA 4E70A 1ETXA 4XLFA 1LVAA 2DOFA 3J80Z 4BAYA 3ECOA 1FBUA 1VF9A 1KU3A 2MC3A 3H9GA 3HJEA 4NC8A 4D1QA 3TDZC 3L2QA 5GADJ 2Y0SN 1GXPA 1OMIA 3FM5A 4BJ6C 3W6VA 4XOTA 3K4KA 4J00A 5TRDA 2ZCWA 1JKRC 3OYMA 4RLQA 5ICCA 5JLXA 2E2IJ 5DCMA 1ZTRA 2H1LA 2HVQA 1O3RA 4CCMA 4RAGA 2VJJA 1X3UA 4UUTA 2HYFA 2PMUA 4AU7A 2NVTJ 4A93J 1LJ9A 1OLTA 2XV4S 4IHTA 3FXUA 2PEXA 1VQOI 3OYJA 1OPCA 1YX5A 3KE2A 1XSVA 2O8KA 5TISC 1GVJA 1YOVB 4LLLA 2P6SA 3HSRA 3REOA 2R7WA 1VQ5I 1SVLA 3C7JA 5IOYA 4KICA 3CCRI 4EVIA 2QSGX 4NB5A 1WHUA 2ZNZA 1WI9A 1PDNC 1SFOJ 5ED4A 4UVCA 3K4JA 4HLYA 1T95A 5L3FA 2HQRA 4YFNF 4YIFA 4NC7A 3HOVJ 1YS7A 1KGSA 4Y13A 3GFLA 2XGEA 3NQOA 1CF7B 1ETYA 3RKXA 3GTJJ 2VBWA 3CJTB 1DDNA 2VKHA 4F55A 2DYSH 3D5RC 3BCAA 1ON1A 5DCMB 1SD4A 1OCPA 1V5GA 3I3LA 3HOSA 3TKYA 2CUFA 3IH4A 2XUBA 5AIQA 5K7HA 2YU3A 1XGNA 1I39A 3BG9A 4AIKA 3EYIA 2KHMA 4AYBA 1JHHA 4RAZA 3Q5FA 2JA6J 2R7TA 1TW3A 4R1HA 1VNDA 2KL4A 1KZHA 1P6RA 3CLOA 2EWNA 4D7NA 1HSJA 2R4GA 2L02A 4KMFA 2IS2A 3U2RA 3CCUI 3W6KB 1MW7A 2F5DA 2L4MA 3DPLC 3HSFA 3T5XA 4M3GA 2VL8A 2GA2A 3HXLA 2CFXA 2B7EA 2GOXB 3ABLH 1APLC 1ETVA 3JRAA 3U21A 3HHGA 4P9FA 1X2NA 2DA7A 4JX4A 5ILUA 4LK1F 1YE9A 1IGNA 2GA1A 3ELKA 2ZSIB 4M3DA 3MZYA 5FKLA 4HA8A 5F0CA 1O4XA 3QPHA 2IGMA 2Y31A 2CV1A 4DW6A 2YUSA 2JA8J 1TWAJ 4EMSA 3S1MJ 1DP7P 3CD6I 2UXNA 5CVJA 3OYHA 2XPVA 5DCFA 2JRTA 3A02A 4O3MA 1IUYA 3CMYA 2DDAA 5LHGA 1SEUA 3CF5F 2D2WA 4V2GA 2ZB9A 2DU9A 3I9V2 2V6EA 2K85A 5FD6A 1WJAA 1UELB 4OU0A 4R79A 1OCZH 3K70D 1FEXA 3RPQA 2HVRA 4AC0A 2B0LA 2XDVA 4KMUX 3CO6C 3CCSI 3DTIA 4UVAA 3N05A 1AA7A 4U7DA 1U9OA 3BY6A 1QQIA 2LSOA 2M9HA 4E6KG 3A01B 2M30A 3GYHX 2ECCA 1GVDA 1MBEA 2EQRA 1SC7A 1R23A 1E17A 1WRJA 4DBQA 4BY1J 1KU2A 1LUJB 1UHSA 4I7HA 3G1OA 2I8DA 2X1CA 4HQEA 1W5TA 1H0MA 1V5FA 5H6RA 2NVXJ 4XRMA 2K86A 1M1EB 1U8RA 1EKEA 2JK3A 4QIWN 3ABKH 4V2FA 3SDBA 5EZGA 1B4AA 3ZN1A 3PSFA 3GTOJ 3HOYJ 3WE3A 1BR2A 1YRNA 2CGPA 1NG6A 1Z6TA 1G4DA 1Z91A 2DA6A 3WTWC 2GXAA 2DDBA 2H1KA 1TP4A 2IJLA 2FA5A 1J7KA 4KA4A 4NBQA 4XOPA 1VFCA 3CCVI 3HRMA 3JSOA 3LFUA 1IDZA 1D0YA 1ZG5A 5DM6F 1NTCA 2X1EA 1IJWC 2XRLA 1B9NA 3E7LA 1S3JA 4BY7J 2DA3A 1PP8F 1YLFA 4S05A 2BXYA 2W4SA 3A01A 1IXRC 4XRSG 4Y17A 5M5XJ 4C2MJ 3BJOA 4Y4RA 1FIAA 5IYCJ 2DFEA 3M8JA 1P92A 1E2XA 3C3WA 2PX9A 2OD5A 1XSDA 4DGWB 1X1PA 1OYIA 4D9JA 1JJ8C 3CMMA 3FHNA 3KEQA 2V1NA 5GAEJ 4YIIA 1J5YA 5HLGA 3VFZA 1FZPB 3M07A 3BTCA 4MFEA 2M0MA 3RQ4A 1EF4A 2LMDA 1BI0A 3K4MA 4HV5A 1I50J 4M9SA 2QYOA 1XS9A 1ACIA 3SEQA 2VBZA 2ELHA 1HSTA 3MEXA 2FNPA 2K9MA 3DBHB 2KKOA 4FQGA 2E5ZA 2CQKA 3E6MA 3CCQI 2L3DA 1F43A 4MIMA 1JTXA 4PJ0C 2PI0A 4LB5A 2P7VB 5E17F 4ENKA 2K3FA 3CJQB 5K7ZA 1Z05A 4UHTA 2V1DA 2IGKA 1QZYA 4DZPA 3KCCA 4E7SA 2V26A 4RA2A 3JRFA 2P7CB 2HVSA 1TTYA 2MA3A 4CXFA 1WCMJ 3D1NI 1LKXA 4XICA 4IHXA 1SAUA 1ETQA 5L3CA 1D8JA 3RKWA 3RPUA 2UZKA 2EK5A 5D6FA 5IY5H 1YJ9I 3LSJA 4CHUA 2LRDA 4I98B 3H36A 5C4JJ 2JRMA 4L0YB 4NDLA 3IAM2 1BL0A 3JTGA 5H2FC 4E4HA 1UB9A 4A3KJ 3MZ8A 4LLGF 2MD0A 3CF2A 4BBRJ 4LOCA 5LD2C 1REPC 4ZDOA 2ZNYA 1LDDA 4JQFA 3CCLI 2ZMEA 5KAFC 5HDNA 3ZMTA 4A5NA 3AKZA 3ONQA 4WWCA 3I4NJ 2IEKA 4NUBA 1B9MA 4AYBN 3DLAA 3ZMZA 2BY3A 6PAXA 3WTXC 3BZ6A 2IPQX 1FJLA 2O7OA 4KIGA 3WTSC 3WGIA 4WXHA 4U7BA 4N9IA 4HX7A 1TL8A 2VE9A 3W3CA 3RJPA 1YW9A 4DBRA 3SZPA 2YS9A 3HDDA 3B6CA 1JKOC 1ZRDA 2H27A 2H94A 2E1NA 5ICFA 2XAUA 4JK1X 2LG4A 4M71A 1B59A 2ZFUA 5J47A 4IVNA 3GBGA 1A31A 5IP6A 2K5CA 1EH7A 3DEWA 1Y1WJ 2KDZA 3TO7A 1R49A 1J09A 4XBFA 4C3IJ 3S1RJ 2EV6A 3E1SA 5J6XA 4K2EA 1A35A 2QKLB 3BJ6A 1C0WA 1ZGAA 3KX2A 5IT3A 5K5RA 1YJWI 1UCRA 4H4KC 4DOZA 3TOAA 1LE8B 4UNOA 1EH8A 4CCOA 1ZN2A 3F6VA 4R8HA 1X4PA 5E8GA 3FXRA 2FBKA 2RNGA 4XLAA 2F48A 4EV0A 2ZO4A 1XDUA 4OAYA 5FLXZ 4MTDA 4IRHA 3A2KA 2EZHA 2LLKA 1EA3A 1W7PA 1UG2A 3HPHA 3WTUC 2COBA 3TW6A 4RS8A 2D5VA 3PO2J 4HBLA 2JVGA 3CDHA 1Z6RA 3L2VA 4MQVA 2L7KA 2VOPA 3I5UA 4L5EA 1K61A 4CH7A 4M3BA 1FBSA 3B02A 1UZCA 1D8KA 4F3QA 4BQOA 1W0UA 5J1YA 1IO2A 4AUXA 1B72A 1IUFA 4I6ZA 3ASNH 2Q8KA 3JCUC 5IP7J 4P5OA 3ZMUA 2XIGA 1V4RA 2WAQN 2ZJ2A 4M3FA 4OOIA 2E34A 2MGQA 3FX3A 5BPDA 4RAYA 4PGHA 5H20A 1USSA 3D5LA 2D1VA 2GZWA 1DPUA 4GYIA 3IKVA 3I54A 1BR4A 4XM3A 5CKTA 3R0JA 5EEAA 4RMNA 4BBSJ 1TQIA 1F5TA 3WG9A 3M4OJ 2P4WA 1LFUP 1LFPA 2RN7A 2M7BA 3E5QA 4XK4A 5GTHC 1X1DA 4EJTA 4XLHA 1GV5A 1AKHB 2E7XA 5FRNA 1ZELA 4UUSB 3G71I 4LJZF 1FBQA 1D0XA 2E1OA 5GAGJ 1P7IA 4YFXF 1MDMB 3ABTA 4HZFA 3VYSB 4E7ZA 4U0VA 2DOEA 2G7UA 2LYCA 1ZR4A 2ZFWA 4HOBA 3COAC 3KP5A 4M73A 2HGCA 2QSHX 3ZQFA 4OAZA 3FMQA 1BA5A 4B3AA 3WHBA 1CQTA 3RKQA 2EFNA 1FTZA 2EFOA 2OJED 3FMSA 2Z1DA 5B66C 2MSYA 1OQYA 3VPRA 3DU6A 1MMSA 4Q5SF 2XF5A 4B8XA 4FTHA 1RKWA 2CFOA 1QGPA 3S17J 2P5KA 2K9NA 1JUSA 5DS9A 4LG3A 3CUOA 1WZ2A 3Q0WA 1Y0UA 3BG7A 1UMQA 1VQ4I 4BQAA 4G6DA 2X0LA 2ZC2A 5TJJA 5HNFA 1H9GA 3BCBA 1OYYA 1WJDA 1JHFA 2A61A 4ZYAA 2WAEA 4KISA 2VC0A 1PJRA 3IWFA 3NRVA 1G3WA 2AQEA 5HS8A 1ONVA 2XASA 4GXOA 4X0GA 3W2VA 1LE8A 3MQ0A 3WHCA 2KQRA 3H3VK 1R6RA 4DYRA 4RB3C 2NVUB 1UHWA 2RQPA 3L2RA 2A07F 3M9AA 4E7HA 2HXIA 4HNVA 1OCOH 4IPAA 1FYKA 2IBDA 4DNCA 2YU9J 3KETA 1VZ0A 2NXNB 2Z9OA 2JWTA 1ETKA 2BVMA 2KFDA 2XVCA 1I6XA 1E3HA 2FE3A 3OYCA 1KONA 1IC8A 1VTNC 3W6JB 2O5RA 3TP3A 4KUMA 4BE2A 2WV0A 2GWRA 1BI2A 1W4MA 3CUQB 5CQEA 4YG2F 2JQ7A 3S14J 2XF6A 3HYIA 3HPGA 3O2PE 1S29A 4F91B 1Z0XA 3KP6A 3MAJA 1SFEA 2DK5A 2IA2A 2LDUA 2Q1ZB 2GLOA 2MYSA 2M3AA 4I0AA 2L7MP 3HRTA 2L7FP 3E3VA 2MH9A 3ZN0A 1TT5B 3FKIJ 1SFUA 1FYMA 3PUBA 5J4YA 4C3HJ 4HF1A 3PIOF 3IV5A 5ILVA 4RBOA 3QOPA 2ETHA 2P6TA 1TLHB 1XC5A 2CW0F 3MN2A 2DYRH 4PGGA 4D5CA 3LL7A 1ZG1A 2ZJPF 2FQ3A 3CCJI 1ERDA 3IWZA 2LF8A 4L5IA 4RGRA 5EF6A 3CO7C 1U9NA 2XAQA 3L00A 3U9GA 1WJBA 3HC7A 1RR7A 4HLXA 4ZJZA 3SYTA 2FEZA 3WE2A 2HPMA 2X1DA 5KHDA 2CUJA 3K4NA 4A3GJ 3X2QH 1RI7A 3BR1A 2A3SA 1BI3A 1TWCJ 1D3YA 3V7CA 3S3MA 5D6EA 4C3JJ 4EJOA 1BOAA 4KN4X 2Y48A 2EZIA 2W57A 2F5VA 1X1BA 1RESA 4E7IA 2N8GA 2BV6A 3CJRB 1BBYA 2XRNA 1RKTA 4PCQA 4I76A 3GTLJ 3ML6A 3ERMA 2P8TA 1ZQ3P 2CYYA 5ICEA 1BW6A 4ENNA 4KN7X 2XKPA 4L9VA 1MMNA 2P81A 2XSJC 2DN0A 3H0GJ 1GT0C 3FISA 3K2ZA 3OWTA 2Z3YA 3BR3A 1ZKGA 1JI8A 1XGMA 2IA0A 3S2HJ 1T56A 4PSWA 1P7JA 2R7FA 5DD4A 4KJZA 3QYBA 4GGGA 4DQ2A 5M3MJ 1LEAA 3HOWJ 1RNLA 2H8WA 4GRIA 4LGWA 5EG0A 2V9VA 1FSHA 4GO1A 2HQ5A 2A6EF 2X6XA 3LSGA 3O8GA 4QPQA 3RQIA 3O8HA 2DK8A 4RM3A 1FWZA 1ZH5A 2EH3A 3Q0UA 1R22A 5FLXK 2WY8Q 2QEXI 3CC4I 1AHDP 3DXJF 2OAZA 4AIDA 2MLGA 5DTDA 3LNQA 2JZYA 1OJLA 2LREA 4HG2A 1Z3YA 3BR0A 1ODDA 3G1MA 3I4PA 3H5RA 4B3XA 3ABMH 4CCKA 3GZNB 3BTJA 3I0TA 2H6CA 4KITB 2QQ9A 2HZDA 1WJFA 2HFHA 4IXAA 2VODA 5GP9A 1L0OC 2V1XA 1KQ9A 5JLWA 5LHHA 3CZ6A 1U6GA 2FNAA 2XB0X 1GV2A 2EBIA 2R5ZB 2HOSA 5HOOA 3SQNA 2PQ8A 2A05A 4IQ4A 2Y30A 3G6EI 3V8KA 1K4TA 2KZGA 2K4JA 4PFOA 3QAHA 3RTRA 1XMKA 1FPQA 4II2A 3DEEA 5E1XA 3V4GA 5F1RA 1K79A 3JRCA 2KJBA 3GW2A 3G1LA 3GUDA 4FISA 1J75A 1DQUA 2LD5A 1FOKA 5E3OA 1P4XA 2X51A 3PUFA 1YYVA 3CJNA 1Y56A 3OOPA 1E0EA 2LNBA 3VB2A 1QHGA 3PFIA 4BXFA 5C4XJ 4WXDA 2BY2A 3W2AA 2I5UA 3VYRB 4UY8I 5AIPA 1ZG3A 1DGWY 3OYGA 3WTVC 3V42A 2VT3A 1SD6A 3QYEA 2D1HA 4LB6B 1U8BA 4XSZF 2FQ4A 1JT6A 2BGCA 3LSIA 5FGMA 1H89C 1FP2A 3WU2C 1YW7A 1UHMA 2LKXA 3MD2A 2ESNA 2QVOA 2XAJA 2VUMJ 2HYJA 2QLZA 4ITVA 4C9YA 4ESFA 4U87A 3TO6A 1YHQI 3KP2A 2R92J 3EUAA 4CZZA 4UUSA 3P9IA 2DPUA 2R7UA 2M7AA 2IS4A 3GXOA 2XSDC 3I58A 4A6EA 4ZZLA 5BOXA 1ZLJA 4FHTA 2PJRB 3B6AA 1XX5A 3GTMJ 2ME6A 2A5WA 2VI6A 1ZAOA 1HW5A 2VQGA 2E1MB 1QVUA 2EZLA 3U1DA 1LB2A 1HCRA 4B4CA 1T98A 5EJCA 5F04A 4IKFA 5A2QZ 5B1AH 4IEJA 1XCVA 4EM1A 4AM3A 3RYRA 3PQKA 3D5SC 5FB2A 2CWEA 3LAJA 3KEOA 4IQJA 4ZZDA 4D5FA 2GXGA 5M3FJ 2VKVA 4AD9A 2ISYA 3Q0VA 5HS7A 5HS9A 3L2CA 4MO7A 3Q3SA 1HW2A 1V54H 2Q0OA 3DKWA 2CQXA 1JE8A 4FT8A 2QQAA 1T08B 3OIQA 4M6VA 5DUIA 1S6LA 5L3BA 2WC2A 5J3LA 2HQNA 1IXSB 2KMUA 1SVOA 2ME0A 3IKTA 4A3BJ 2Y0SA 3CDIA 1ZK8A 1IRXA 3E6BA 5LGTA 3KPHA 3OYNA 2JA7J 2K7LA 1BJAA 2XAHA 1Y8RB 3ZMSA 3K6GA 4KDPA 1TWHJ 1STZA 4Z6YA 2E60A 1RETA 2QBYB 2KLOA 3V8JA 1XGSA 4G7ZF 1MH3A 3F9KA 4MGRA 2HTSA 5TGTA 1MSFC 2RQQA 2WA0A 1QO0D 4BS9A 4F52A 4CYCB 3E6CC 1R1UA 3BLYA 2AXTC 2QENA 4AWXB 1WSUA 2CV0A 1Z77A 1LFBA 1I3QJ 1TNSA 4Y7NJ 1A5JA 1SMYF 3R60A 1IW7F 1LQ1A 4BNCA 2AHQA 1VQ9I 3U1KA 1W7PB 3E5XA 2P5LC 4Y33A 2OZUA 1J59A 1G3YA 1WH7A 3SJMA 1S72I 2L7ZA 3ASOH 2YPRA 3VSKA 1R9TJ 2ELJA 3ZQQA 4A3FJ 1W36D 1LDJA 4EM0B 2TDXA 4XRSA 1TWGJ 4F92B 5HODA 4YFKF 2O6GE 2CU7A 1P9QC 4HAMA 3JREA 1ENHA 3JRGA 1X3ZB 4QTRA 2FJ1A 2UXXA 1MBGA 3VWBA 1QA6A 2UUZA 2ID6A 2L5QA 3AL0C 4DYCA 4DIQA 2ZXJA 1XB4A 4RM2A 3GVAA 1YRNB 1VQ6I 4BJ5C 3LOCA 1OR7A 3KLOA 1ZLKA 2VQLA 2EA4A 2LY1A 2ZMEC 2XC7A 3E6DA 3RKYA 4XSXF 3ABUA 2VN2A 4BACA 4XR6A 2DA1A 3GFIA 1QU3A 4KFCA 2HOAA 4UB8C 2R7VA 3P9KA 5HLTA 3OY9A 3IHUA 2E2JJ 4M74A 2JVHA 5L3EA 1Z67A 3CMAI 3IH3A 1FIPA 2OU2A 2DTZA 1R4NB 1MGTA 2GQQA 2IVMA 2XKOA 1LNWA 3PIPF 4HF0A 4FE7A 5ERIA 4WF2A 3FXMA 1MJ9A 2Y9YA 5JFRA 4M3EA 3FXOA 1QNTA 2ZXIA 3DKYA 5DEQA 1FTTA 2MD5A 5BQTA 2EIJH 2QZ8A 3J7ZI 2XGDA 1D5YA 1EJ9A 4ZYEA 5ILSA 2EB7A 2QSFX 5DDGA 2VQHA 4RGSA 4P1WA 1BC8C 2I10A 3EQLF 3S3NA 2HOTA 2CG4A 4ENJA 2IT0A 4JOMA 1SD7A 4BU2A 3J81K 1XDSA 1TC3C 1QZEA 4Q47A 2R7XA 4XIDA 5CVIA 5FKMA 3PSIA 2K3PA 3G2BA 1S7EA 2DFIA 3DCFA 4L9JA 1WJEA 2FOKA 4ZDPA 1A6QA 2X85A 4L9NA 4MEYF 3R61A 4PFPA 2DFHA 2KIMA 2Z99A 1Y8QB 2ACJA 3LMMA 3CC7I 3HGYA 3PL8A 3S16J 4EJWA 4X6AJ 3ZP5A 3F8MA 2HQAA 4I01A 4EQQA 2HXOA 2BW3B 1VI0A 2XGCA 1FOYA 2MABA 4XQFA 3GTGJ 3J7AY 4WCGA 2JN6A 1G3SA 4ZYGA 2E7WA 3BJAA 5D5XB 5D5WB 5DD8A 3S2DJ 1WH5A 3VSLA 2V1UA 4G7HF 1DGRM 2DLLA 2DTRA 2M8GX 5IYBJ 3LSKA 3EDPA 4HDVA 2VKDA 1SVMA 4HYEA 2D45A 2V7FA 3HUGA 3K4BA 1MSEC 4HRIA 1A04A 3I4MJ 1N75A 2MH2A 4CGZA 4MLOA 4Q48A 3KP3A 5C44J 3N97A 3IH2A 5K5QA 3PM1A 3QQAA 1NK3P 3J80K 3JRHA 4XN0A 1Y0NA 3K0LA 2L9VA 3OYAA 4IL6C 1K78B 2DO7A 5F27A 5E1ZB 3J7AO 2FBHA 1JKPC 3F8CA 4XKVA 3DTKA 1F4KA 3H3UA 4KIBA 1FYLA 2W7NA 4XL9A 2KIQA 4A3IJ 3LWFA 1FMWA 5FFXA 1ZHFA 2MC4A 3HTSB 1PYVA 3SXYA 2XAFA 3TOBA 5E20A 2O3FA 3T8RA 2EFWA 3ZQGA 4CYDA 1EV7A 3K1PA 1I3AA 4HSRA 2DBBA 2CH0A 1ULYA 3HKZA 5FROA 5FLMJ 3T8TA 3QODA 2GXBA 3QP6A 2OQGA 4A0XA 4O6JA 4UVBA 2LKPA 2HI3A 1S7AA 3SFZA 3RIRA 4Y52J 4HEA2 2VJ5A 5FKOA 1D1BA 1YFHA 3S93A 3JRBA 1MJBA 2VC1A 5KCMA 4B1RA 2STWA 1HKTA 1ZYRF 1LDKB 3F6OA 3K10A 2MW8A 4LIVA 1FNNA 3PO3J 2G0EA 3LSRA 2FF4A 2LVSA 2QF7A 3ZXSA 2L0KA 1AKHA 4ZDLA 4BE1A 4II3A 4F7ZA 1YX3A 1BJZA 4P55A 2OTLI 3H5AA 3GF2A 1CF7A 3RSNA 3OV8A 3ZQ7A 4BQQA 2R7ZJ 2DMUA 3V7SA 2CO5A 1WJCA 3C2BA 3M7GA 3JRIA 2OUMA 3GFJA 3ZRGA 3KYDB 2DA4A 3FBIB 4N4OB 1T39A 5DUKA 2NVQJ 3A1YA 1WVRA 3C2HA 2XGXA 1XSXA 4RGXA 1QPIA 1R5GA 3HZJA 2W00A 2M5WA 3K7AJ 3VEPA 2BY1A 1JUMA 2IGNA 3BTLA 3PNYA 4EATA 1R36A 3A4CA 2R5ZA 1KYZA 1V3FA 1ZGWA 3DPUA 1BN5A 2K4BA 4XONA 5F6FA 1R00A 2V79A 4S0HB 4IX7A 4B09A 1Y39A 1NHAA 1Y1VJ 5GPAA 2KIUA 2V4JC 2GAUA 5BS6A 2JUGA 4CCLA 2R5YA 2X9DA 2QQBA 4RLFA 3IL2A 3FXKA 3GLLA 4LFUA 3G3ZA 2O9LA 3F21A 4FETA 4ZYDA 1TW2A 3RCOA 1BOBA 1X1CA 2R7DA 5B5EC 1HLVA 3JRDA 5IT9Z 3H35A 1S8NA 1N25A 1XMAA 2FBIA 2HS5A 3AG2H 1T0FC 3EYYA 3MKYB 1FSEA 3HRUA 2EFQA 3BTIA 2Z33A 3I71A 2COMA 2DAOA 3O3KA 4E7KA 3LSPA 2W1OA 3F72A 4A3JJ 3P9CA 3EUHC 4XLNF 1I1SA 1FT9A 5HDGA 1KU9A 2X48A 1MDMA 1T8IA 1W7PD 1XTAA 3ESWB 5HNHA 1K7AA 4IHSA 1QPMA 5FRMA 1T6SA 2HYGD 2XAGA 3OYKA 2QQ8A 3MKLA 2KPMA 2M34A 2WV1A 5CLSA 1XG1A 3BG5A 3B73A 3GFMA 2CQQA 4XN3A 2DMPA 2NS0A 1USTA 3OYDA 4FX0A 1R7JA 5F0HA 2LY9A 4BDYA 4IHYA 3QYFA 4L9TA 3BP8A 4PK4A 1PP7U 2PJPA 2X6YA 4EM2A 4LK0F 1N77A 4F93B 2NNNA 4HDUA 5EG0B 4ZTFA 4KIFA 1BI1A 1ORKA 3GO5A 4CCJA 2L54A 1U2WA 2P0WA 3ZQIA 1YIJI 5EEGA 4BGDA 3ULQB 2VJIA 2M1BA 2VBYA 4D0PA 3FKJA 4M9ZA 3CCYA 3Q9SA 4N0BA 1MMGA 1IAWA 5FLVA 2NVYJ 3LQRA 4WXCA 1GUUA 4PJJA 3VYTB 2C6YA 3A0BC 4JX6A 5J4VA 1FP1D 2PLYA 4XLEA 1MMAA 1RC9A 2BY0A 2KT0A 4OIOF 1RZ4A 2W24A 2BHZA 4NC6A 3N4MA 3H3ZA 2JA5J 5B1BH 4CSWA 1XMXA 3H92A 3ZGKA 3MCZA 1Z9CA 2F4OB 3FDYA 2R93J 5JR3A 4BHCA 3CESA 2TCTA 3BZCA 3FXQA 2NNYA 1V55H 1W5SA 5M5YJ 3ZR8X 1HXDA 4P96A 3S32A 5E8IA 1CGPA 5CVRA 3BG3A 5CPRB 2PBIA 4XKWA 5EZHA 5EDNA 2BXZA 5L3GA 5D5VB 1IRGA 3R0AA 1BIBA 5A2QK 4NHJA 1T33A 2J5PA 4JYKA 4C2UA 2LC2A 2HKXA 1QBJA
chains in the Genus database with same CATH topology
3OIOA 2XSDC 1F43A 4MIMA 1JTXA 3B6AA 1MBJA 5K7ZA 3JR9A 3GTMJ 2ME6A 2VI6A 4JX5A 2DA5A 4DZPA 1HOMA 3JRFA 2NOGA 5F0FA 1OCTC 1QVUA 2EZKA 2EZLA 1WCMJ 3D1NI 1HCRA 4B4CA 4XICA 2PMZN 2E2HJ 5F04A 5J1UA 4IHXA 1ETQA 4IEJA 1K83J 3LSJA 4D5FA 2FD5A 5M3FJ 2VKVA 3ZOBA 3Q0VA 5C4JJ 4NDLA 4MO7A 3Q3SA 1BL0A 2CQXA 1B8IA 4A3KJ 4M6VA 1PUFB 3FK6A 4IHWA 3MVPA 4BBRJ 4LOCA 5FKNA 5J3LA 2ME0A 3QPSA 4FCYA 4A3BJ 1ETWA 1G2HA 1ZK8A 3HBLA 3OSGA 3I4NJ 3HGGA 1HDPA 2IEKA 3ZQCA 2LP0A 4AYBN 2CUEA 1TWHJ 2R0QC 3OOUA 1RETA 1FJLA 2O7OA 1MH3A 1MSFC 1H88C 4CYCB 2IAIA 1GDTA 1Z77A 1LFBA 1I3QJ 4Y7NJ 2YS9A 1ETOA 5EGOB 1JKQC 3HDDA 5IPAA 1A5JA 3B6CA 1JKOC 2AHQA 3NARA 1X58A 1B8IB 2RAEA 1WH7A 5F08A 3SJMA 1JT0A 2L7ZA 3GBGA 4FE4A 5IP6A 1WPKA 3BR5A 3DEWA 1Y1WJ 1R9TJ 2KDZA 1JGGA 4C3IJ 2TRTA 4A3FJ 4A3LJ 2FX0A 3S1RJ 3NAUA 4XRSA 1TWGJ 4X1EA 5HODA 2CU7A 2ECBA 3JREA 1QVTA 2GBYA 1ENHA 4G12A 3JRGA 1LE8B 3BT9A 4QTRA 2FJ1A 1MBGA 2MG4A 2DJNA 4DZJA 2ID6A 2LTPA 4DYCA 1U78A 2DA2A 3BQZA 3RZOJ 2OPTA 2HDDA 3BR2A 5GPCA 1NK2P 1YRNB 2B63J 2EZHA 2LLKA 3LOCA 1RPWA 1UG2A 1WGXA 2COBA 3TW6A 2D5VA 3F0CA 3PO2J 3ZQHA 2DA1A 3OSFA 3SFIA 3A03A 2WB1N 4A3CJ 2HOAA 5IYDJ 4L5EA 1K61A 2E2JJ 4M3BA 3IH3A 4BKXA 1FIPA 3BQYA 4EEFG 2DTZA 4MFDA 3HOXJ 1W0UA 5J1YA 4AUXA 1JUPA 4W1UA 1B72A 3QPLA 1IUFA 5EYRA 3TW7A 4I6ZA 4FE7A 1IDYA 2ID3A 5IP7J 4GFBA 2GM4A 2Y9YA 4M3EA 5J1RA 1DU0A 2JA7J 2AO9A 1FTTA 3GTKJ 2LK2A 1JTYA 2WAQN 1D5YA 2XGDA 1HDDC 4BXXJ 4M3FA 2MGQA 3BR6A 2I10A 1WI3A 2LFBA 3TEDA 2HOTA 1H8AC 2L9RA 5EEAA 4BBSJ 1SANA 1TC3C 3M4OJ 1LFUP 2CJJA 4XIDA 5FKMA 1I6HJ 4XK4A 1S7EA 2DMTA 3DCFA 5FKKA 4JP0A 1Q1VA 2DMNA 2K40A 3CDLA 1AKHB 1GV5A 4UUSB 4ABZA 2E1OA 1P7IA 3S15J 3HEFA 4A3MJ 3S1QJ 3UKGA 3HGYA 3S16J 2R5YB 4X6AJ 1ZR4A 2HXOA 2H8RA 3ZQFA 1VI0A 2W48A 2XGCA 1BA5A 1B72B 3GTGJ 4B3AA 2JN6A 3WHBA 1CQTA 3RKQA 1FTZA 3SDGA 3S2DJ 1WH5A 2MSYA 1MNMC 3VPRA 4FTHA 1RKWA 2M8GX 5IOZA 5IYBJ 3S17J 1POGA 2K9NA 1JUSA 5DS9A 1F36A 1MSEC 5FJ8J 3S1NJ 3Q0WA 1UMQA 3I4MJ 5IP9J 1IRZA 4MLOA 3RZDJ 5M5WJ 5C44J 1ITYA 5K7FA 2VKEA 2NS7A 3IH2A 3ZQLA 1ETXA 3PM1A 4DYQA 3QQAA 2M0CA 1NK3P 1VF9A 3JRHA 5F27A 9ANTA 1JKPC 2Y0SN 1LE8A 3WHCA 3W6VA 3H3VK 1MBKA 4A3IJ 4DYRA 1JKRC 1QRYA 5JLXA 2E2IJ 2HXIA 4HNVA 1ZTRA 5F1JA 4UUTA 3ZQGA 2IBDA 2NVTJ 4A93J 2YU9J 5FLMJ 4A3EJ 1DU6A 2JWTA 1ETKA 2X6OA 1ZR2A 2HI3A 1IC8A 2O8KA 4Y52J 3TP3A 5E3LA 5FKOA 5EGOA 3JRBA 4B1RA 3S14J 5IOYA 4QSHA 2MW8A 1SFOJ 3PO3J 2G0EA 2OF7A 1Z0XA 3LSRA 2GLOA 2LVSA 2QF7A 3HOZJ 2L0KA 2JJ7A 1AKHA 3HOVJ 2L7MP 2L7FP 1BJZA 3FKIJ 2XGEA 4C3HJ 2R7ZJ 3IV5A 1ETYA 2DMUA 3GTJJ 3C2BA 4RBOA 3HOUJ 3JRIA 1XC5A 5E3MA 3MN2A 2DA4A 2XPUA 2NVQJ 4D5CA 1IG7A 1OCPA 1QPIA 2CUFA 5EF6A 3IH4A 2JMWA 3K7AJ 1U9NA 1JUMA 3BTLA 5K7HA 2K9SA 3BG9A 4RDUA 1JJ6C 2R5ZA 1RR7A 1ZGWA 2JA6J 1VNDA 4D7NA 1TWFJ 4A3GJ 4S0HB 3BR1A 1Y1VJ 5GPAA 1TWCJ 4A69C 4C3JJ 4M3GA 2EZIA 2R5YA 2X9DA 3FIWA 1RESA 2N8GA 1APLC 1ETVA 3JRAA 1RKTA 4I76A 3GTLJ 2Y9ZA 2O9LA 1BW5A 1X2NA 2DA7A 2NS8A 2M2EA 4JX4A 2LR8A 1ZQ3P 1IGNA 1BW6A 4M3DA 1HLVA 5FKLA 3GTQJ 3JRDA 5E3NA 2P81A 5F0CA 1O4XA 2DN0A 2Y31A 3H0GJ 4DW6A 3FISA 2YUSA 4D7MA 4J19A 1GT0C 2JA8J 1TWAJ 3BR3A 3S1MJ 1ZKGA 3BTIA 2XB5A 2XPVA 3LSPA 3A02A 1T56A 3S2HJ 1P7JA 3CMYA 4A3JJ 5M3MJ 3HOWJ 4V2GA 2X48A 2ZB9A 5EG0A 3L1PA 2HQ5A 3CQZJ 1MBHA 1OFCX 1FEXA 1MBFA 5C3EJ 2QCOA 3LSGA 4AC0A 3MKLA 3O8GA 3RQIA 3O8HA 4W97A 3HKZN 1U9OA 2M9HA 2E19A 2EH3A 2M34A 2ECCA 3Q0UA 1GVDA 3A01B 2WV1A 1MBEA 2EQRA 1XG1A 1AHDP 3BG5A 2CQQA 3LNQA 2VPRA 5DTDA 2DMPA 4BY1J 1OJLA 1UHSA 1A6IA 3G1OA 3BR0A 5F0HA 2LY9A 3K2AA 4IHYA 3G1MA 2NVXJ 4XRMA 4QIWN 2JK3A 3BTJA 3GTPJ 4V2FA 1E3OC 5EZGA 5EG0B 3GTOJ 3HOYJ 5GP9A 1ORKA 5JLWA 1YRNA 2XB0X 1GV2A 2EBIA 3ZQIA 2DA6A 5BNGA 2R5ZB 2HOSA 2XPWA 2H1KA 2Y30A 1VFCA 2ELKA 3CCYA 5FLVA 2NVYJ 1IDZA 3HM5A 1W0TA 1AU7A 1IV6A 1GUUA 1PUFA 1NTCA 3JRCA 1IJWC 2XRLA 3E7LA 3G1LA 4BY7J 4FISA 2DA3A 2LD5A 4JX6A 5E3OA 1HF0A 3A01A 2KT0A 4XRSG 3FK7A 3TP0A 4C2MJ 5M5XJ 1FIAA 3M3YJ 5IYCJ 2JA5J 5C4XJ 2R93J 4CYCA 1JJ8C 2DMQA 2TCTA 1X2MA 5M5YJ 2Y2ZA 1U8BA 4IHVA 3BTCA 3HB9A 2FQ4A 1JT6A 4MFEA 1EF4A 3BG3A 2K9QA 1H89C 5EZHA 1MH4A 5EDNA 2LKXA 2CRGA 4A3DJ 2VUMJ 2HYJA 1T33A 1I50J 4JYKA 1XS9A 2R92J 4UUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OIO A;  2XSD C;  1F43 A;  4MIM A;  1JTX A;  3B6A A;  1MBJ A;  5K7Z A;  3JR9 A;  3GTM J;  2ME6 A;  2VI6 A;  4JX5 A;  2DA5 A;  4DZP A;  1HOM A;  3JRF A;  2NOG A;  5F0F A;  1OCT C;  1QVU A;  2EZK A;  2EZL A;  1WCM J;  3D1N I;  1HCR A;  4B4C A;  4XIC A;  2PMZ N;  2E2H J;  5F04 A;  5J1U A;  4IHX A;  1ETQ A;  4IEJ A;  1K83 J;  3LSJ A;  4D5F A;  2FD5 A;  5M3F J;  2VKV A;  3ZOB A;  3Q0V A;  5C4J J;  4NDL A;  4MO7 A;  3Q3S A;  1BL0 A;  2CQX A;  1B8I A;  4A3K J;  4M6V A;  1PUF B;  3FK6 A;  4IHW A;  3MVP A;  4BBR J;  4LOC A;  5FKN A;  5J3L A;  2ME0 A;  3QPS A;  4FCY A;  4A3B J;  1ETW A;  1G2H A;  1ZK8 A;  3HBL A;  3OSG A;  3I4N J;  3HGG A;  1HDP A;  2IEK A;  3ZQC A;  2LP0 A;  4AYB N;  2CUE A;  1TWH J;  2R0Q C;  3OOU A;  1RET A;  1FJL A;  2O7O A;  1MH3 A;  1MSF C;  1H88 C;  4CYC B;  2IAI A;  1GDT A;  1Z77 A;  1LFB A;  1I3Q J;  4Y7N J;  2YS9 A;  1ETO A;  5EGO B;  1JKQ C;  3HDD A;  5IPA A;  1A5J A;  3B6C A;  1JKO C;  2AHQ A;  3NAR A;  1X58 A;  1B8I B;  2RAE A;  1WH7 A;  5F08 A;  3SJM A;  1JT0 A;  2L7Z A;  3GBG A;  4FE4 A;  5IP6 A;  1WPK A;  3BR5 A;  3DEW A;  1Y1W J;  1R9T J;  2KDZ A;  1JGG A;  4C3I J;  2TRT A;  4A3F J;  4A3L J;  2FX0 A;  3S1R J;  3NAU A;  4XRS A;  1TWG J;  4X1E A;  5HOD A;  2CU7 A;  2ECB A;  3JRE A;  1QVT A;  2GBY A;  1ENH A;  4G12 A;  3JRG A;  1LE8 B;  3BT9 A;  4QTR A;  2FJ1 A;  1MBG A;  2MG4 A;  2DJN A;  4DZJ A;  2ID6 A;  2LTP A;  4DYC A;  1U78 A;  2DA2 A;  3BQZ A;  3RZO J;  2OPT A;  2HDD A;  3BR2 A;  5GPC A;  1NK2 P;  1YRN B;  2B63 J;  2EZH A;  2LLK A;  3LOC A;  1RPW A;  1UG2 A;  1WGX A;  2COB A;  3TW6 A;  2D5V A;  3F0C A;  3PO2 J;  3ZQH A;  2DA1 A;  3OSF A;  3SFI A;  3A03 A;  2WB1 N;  4A3C J;  2HOA A;  5IYD J;  4L5E A;  1K61 A;  2E2J J;  4M3B A;  3IH3 A;  4BKX A;  1FIP A;  3BQY A;  4EEF G;  2DTZ A;  4MFD A;  3HOX J;  1W0U A;  5J1Y A;  4AUX A;  1JUP A;  4W1U A;  1B72 A;  3QPL A;  1IUF A;  5EYR A;  3TW7 A;  4I6Z A;  4FE7 A;  1IDY A;  2ID3 A;  5IP7 J;  4GFB A;  2GM4 A;  2Y9Y A;  4M3E A;  5J1R A;  1DU0 A;  2JA7 J;  2AO9 A;  1FTT A;  3GTK J;  2LK2 A;  1JTY A;  2WAQ N;  1D5Y A;  2XGD A;  1HDD C;  4BXX J;  4M3F A;  2MGQ A;  3BR6 A;  2I10 A;  1WI3 A;  2LFB A;  3TED A;  2HOT A;  1H8A C;  2L9R A;  5EEA A;  4BBS J;  1SAN A;  1TC3 C;  3M4O J;  1LFU P;  2CJJ A;  4XID A;  5FKM A;  1I6H J;  4XK4 A;  1S7E A;  2DMT A;  3DCF A;  5FKK A;  4JP0 A;  1Q1V A;  2DMN A;  2K40 A;  3CDL A;  1AKH B;  1GV5 A;  4UUS B;  4ABZ A;  2E1O A;  1P7I A;  3S15 J;  3HEF A;  4A3M J;  3S1Q J;  3UKG A;  3HGY A;  3S16 J;  2R5Y B;  4X6A J;  1ZR4 A;  2HXO A;  2H8R A;  3ZQF A;  1VI0 A;  2W48 A;  2XGC A;  1BA5 A;  1B72 B;  3GTG J;  4B3A A;  2JN6 A;  3WHB A;  1CQT A;  3RKQ A;  1FTZ A;  3SDG A;  3S2D J;  1WH5 A;  2MSY A;  1MNM C;  3VPR A;  4FTH A;  1RKW A;  2M8G X;  5IOZ A;  5IYB J;  3S17 J;  1POG A;  2K9N A;  1JUS A;  5DS9 A;  1F36 A;  1MSE C;  5FJ8 J;  3S1N J;  3Q0W A;  1UMQ A;  3I4M J;  5IP9 J;  1IRZ A;  4MLO A;  3RZD J;  5M5W J;  5C44 J;  1ITY A;  5K7F A;  2VKE A;  2NS7 A;  3IH2 A;  3ZQL A;  1ETX A;  3PM1 A;  4DYQ A;  3QQA A;  2M0C A;  1NK3 P;  1VF9 A;  3JRH A;  5F27 A;  9ANT A;  1JKP C;  2Y0S N;  1LE8 A;  3WHC A;  3W6V A;  3H3V K;  1MBK A;  4A3I J;  4DYR A;  1JKR C;  1QRY A;  5JLX A;  2E2I J;  2HXI A;  4HNV A;  1ZTR A;  5F1J A;  4UUT A;  3ZQG A;  2IBD A;  2NVT J;  4A93 J;  2YU9 J;  5FLM J;  4A3E J;  1DU6 A;  2JWT A;  1ETK A;  2X6O A;  1ZR2 A;  2HI3 A;  1IC8 A;  2O8K A;  4Y52 J;  3TP3 A;  5E3L A;  5FKO A;  5EGO A;  3JRB A;  4B1R A;  3S14 J;  5IOY A;  4QSH A;  2MW8 A;  1SFO J;  3PO3 J;  2G0E A;  2OF7 A;  1Z0X A;  3LSR A;  2GLO A;  2LVS A;  2QF7 A;  3HOZ J;  2L0K A;  2JJ7 A;  1AKH A;  3HOV J;  2L7M P;  2L7F P;  1BJZ A;  3FKI J;  2XGE A;  4C3H J;  2R7Z J;  3IV5 A;  1ETY A;  2DMU A;  3GTJ J;  3C2B A;  4RBO A;  3HOU J;  3JRI A;  1XC5 A;  5E3M A;  3MN2 A;  2DA4 A;  2XPU A;  2NVQ J;  4D5C A;  1IG7 A;  1OCP A;  1QPI A;  2CUF A;  5EF6 A;  3IH4 A;  2JMW A;  3K7A J;  1U9N A;  1JUM A;  3BTL A;  5K7H A;  2K9S A;  3BG9 A;  4RDU A;  1JJ6 C;  2R5Z A;  1RR7 A;  1ZGW A;  2JA6 J;  1VND A;  4D7N A;  1TWF J;  4A3G J;  4S0H B;  3BR1 A;  1Y1V J;  5GPA A;  1TWC J;  4A69 C;  4C3J J;  4M3G A;  2EZI A;  2R5Y A;  2X9D A;  3FIW A;  1RES A;  2N8G A;  1APL C;  1ETV A;  3JRA A;  1RKT A;  4I76 A;  3GTL J;  2Y9Z A;  2O9L A;  1BW5 A;  1X2N A;  2DA7 A;  2NS8 A;  2M2E A;  4JX4 A;  2LR8 A;  1ZQ3 P;  1IGN A;  1BW6 A;  4M3D A;  1HLV A;  5FKL A;  3GTQ J;  3JRD A;  5E3N A;  2P81 A;  5F0C A;  1O4X A;  2DN0 A;  2Y31 A;  3H0G J;  4DW6 A;  3FIS A;  2YUS A;  4D7M A;  4J19 A;  1GT0 C;  2JA8 J;  1TWA J;  3BR3 A;  3S1M J;  1ZKG A;  3BTI A;  2XB5 A;  2XPV A;  3LSP A;  3A02 A;  1T56 A;  3S2H J;  1P7J A;  3CMY A;  4A3J J;  5M3M J;  3HOW J;  4V2G A;  2X48 A;  2ZB9 A;  5EG0 A;  3L1P A;  2HQ5 A;  3CQZ J;  1MBH A;  1OFC X;  1FEX A;  1MBF A;  5C3E J;  2QCO A;  3LSG A;  4AC0 A;  3MKL A;  3O8G A;  3RQI A;  3O8H A;  4W97 A;  3HKZ N;  1U9O A;  2M9H A;  2E19 A;  2EH3 A;  2M34 A;  2ECC A;  3Q0U A;  1GVD A;  3A01 B;  2WV1 A;  1MBE A;  2EQR A;  1XG1 A;  1AHD P;  3BG5 A;  2CQQ A;  3LNQ A;  2VPR A;  5DTD A;  2DMP A;  4BY1 J;  1OJL A;  1UHS A;  1A6I A;  3G1O A;  3BR0 A;  5F0H A;  2LY9 A;  3K2A A;  4IHY A;  3G1M A;  2NVX J;  4XRM A;  4QIW N;  2JK3 A;  3BTJ A;  3GTP J;  4V2F A;  1E3O C;  5EZG A;  5EG0 B;  3GTO J;  3HOY J;  5GP9 A;  1ORK A;  5JLW A;  1YRN A;  2XB0 X;  1GV2 A;  2EBI A;  3ZQI A;  2DA6 A;  5BNG A;  2R5Z B;  2HOS A;  2XPW A;  2H1K A;  2Y30 A;  1VFC A;  2ELK A;  3CCY A;  5FLV A;  2NVY J;  1IDZ A;  3HM5 A;  1W0T A;  1AU7 A;  1IV6 A;  1GUU A;  1PUF A;  1NTC A;  3JRC A;  1IJW C;  2XRL A;  3E7L A;  3G1L A;  4BY7 J;  4FIS A;  2DA3 A;  2LD5 A;  4JX6 A;  5E3O A;  1HF0 A;  3A01 A;  2KT0 A;  4XRS G;  3FK7 A;  3TP0 A;  4C2M J;  5M5X J;  1FIA A;  3M3Y J;  5IYC J;  2JA5 J;  5C4X J;  2R93 J;  4CYC A;  1JJ8 C;  2DMQ A;  2TCT A;  1X2M A;  5M5Y J;  2Y2Z A;  1U8B A;  4IHV A;  3BTC A;  3HB9 A;  2FQ4 A;  1JT6 A;  4MFE A;  1EF4 A;  3BG3 A;  2K9Q A;  1H89 C;  5EZH A;  1MH4 A;  5EDN A;  2LKX A;  2CRG A;  4A3D J;  2VUM J;  2HYJ A;  1T33 A;  1I50 J;  4JYK A;  1XS9 A;  2R92 J;  4UUS A; 
#chains in the Genus database with same CATH topology
 2G9W A;  3OIO A;  3CTA A;  4P9U A;  3CUQ C;  2HDW A;  4M6X A;  3CC2 I;  3J7Y J;  1MBJ A;  1TBX A;  3QOE A;  3WTT C;  3JR9 A;  5DYM A;  1FC3 A;  2DA5 A;  1IN4 A;  1HOM A;  2NOG A;  1AWC A;  2LOO A;  5F0F A;  1ZAR A;  4ASN A;  1W1W E;  1OCT C;  1U5T C;  2M8E A;  2V6C A;  2ZXH A;  4CUG A;  4I02 A;  4RGU A;  3TO9 A;  2E2H J;  2PMZ N;  4XKB A;  3ZCO A;  2QBY A;  1ZRE A;  5J8C A;  4CDG A;  1KQ0 A;  2JSP A;  1IZ1 A;  4MQ9 F;  2FD5 A;  2YX7 A;  1A36 A;  4GCV A;  3ZOB A;  2R3S A;  3C18 A;  1J2X A;  3DBR B;  1TQP A;  3DF8 A;  2F6C A;  3FMR A;  4CA0 A;  3FK6 A;  4N4N B;  2F2E A;  3MVP A;  3ROU A;  2VE8 A;  3TL4 X;  3QPS A;  1ETW A;  1YJN I;  1G2H A;  4YEL A;  3OYI A;  3F22 A;  3HGG A;  4ANJ A;  3ZQC A;  3I59 A;  3M8F A;  1HW1 A;  1WFX A;  2LP0 A;  3ZMD A;  2CUE A;  1WJ5 A;  2JPC A;  2Z16 A;  2KRF A;  3WOD F;  1WWX A;  2R0Q C;  2Z2S B;  3K4L A;  1UAA A;  1LVK A;  2DW4 A;  3E5U A;  3MKW B;  2PMH A;  2WWY A;  5HDK A;  2OCE A;  1H88 C;  1IV8 A;  4B48 A;  3OYF A;  2CS3 A;  1MKM A;  1TQM A;  1JXS A;  4BXU A;  5EGO B;  4PJM A;  1JKQ C;  5DV5 A;  2DPD A;  5IPA A;  2E35 A;  1YI2 I;  4CZC A;  4ENM A;  2FML A;  1NH3 A;  5LEJ A;  2RVC A;  1KU7 A;  4HQM A;  2E1C A;  4BH9 A;  2WB1 A;  1B8I B;  5F08 A;  3D0S A;  3KEY A;  2FMY A;  4AIH A;  4FE4 A;  4E7J A;  1P4W A;  3BR5 A;  3H1C A;  4XMY A;  4LIU A;  4EJV A;  2FX0 A;  3NAU A;  2L4A A;  2PN6 A;  2R7O A;  3OYL A;  1MMD A;  3E0J B;  3HTU A;  1VQ8 I;  3DPT A;  4EGZ A;  3P7N A;  2DJN A;  3AG4 H;  4DZJ A;  3CME I;  2BE5 F;  1G8X A;  5CYV A;  2LTP A;  2BBY A;  1U78 A;  2DA2 A;  3ISP A;  5BMZ A;  5CJ9 A;  2Y69 H;  3RZO J;  1YS6 A;  4WK8 F;  2OPT A;  3QP5 A;  4MNU A;  3LA7 A;  1IN6 A;  2R7R A;  2HDD A;  4QLC U;  3BR2 A;  1NK2 P;  2B63 J;  2HPI A;  1RPW A;  1MIJ A;  1WGX A;  4OMY A;  3H0D A;  4PUS A;  5K1Y A;  3F0C A;  5KVR A;  4MTE A;  2VON A;  3O6B B;  4UB6 C;  1TZL A;  3RDI A;  2OBP A;  1ZGJ A;  3L2W A;  3C2G A;  4A3C J;  3OL4 A;  4ZC3 A;  2QWW A;  2K02 A;  2NYX A;  5IYD J;  2R7Q A;  4IRG A;  3QU6 A;  3BG6 A;  1O7F A;  1VQM I;  3SEZ A;  4BKX A;  2F4M B;  3KZZ A;  3BQY A;  4EEF G;  5EEH A;  4MFD A;  3HOX J;  3WGG A;  4W1U A;  2FUG 2;  3C1D A;  3GZ5 A;  1Z7L A;  5EYR A;  3WU1 B;  1IDY A;  2RGV A;  4GFB A;  5D8K B;  2Y75 A;  2GM4 A;  5KK1 A;  2E5N A;  3H5N A;  1D1C A;  3EPZ A;  3K4C A;  2KRH A;  3GTK J;  4G8X A;  3BWG A;  2BW3 A;  4BEH A;  4LMY A;  4EJU A;  2UWM A;  3BDD A;  1XD7 A;  2VIX A;  3BR6 A;  3GLX A;  4UV8 A;  4MHG A;  3TED A;  2B9S A;  4Y15 A;  2HU9 A;  4FAS D;  3DEU A;  3DLL F;  2QUF A;  1R1V A;  3SHF A;  4CO8 A;  1SAN A;  3DKX A;  3RI4 A;  2CJJ A;  3I64 A;  1AOY A;  4KYW A;  4LLN A;  2DMT A;  4XRF A;  4JP0 A;  2DMN A;  2K40 A;  4KT5 C;  1FOX A;  3BC8 A;  3OMY A;  3IP4 B;  3S15 J;  4BHP A;  1FOW A;  1D5V A;  2XF7 A;  3UKG A;  5CVV A;  3WTY C;  3I55 I;  1K6O A;  4A0Z A;  2VQC A;  2H8R A;  1P2F A;  5AON A;  1KQ8 A;  2ICW G;  3MZH A;  3DBL B;  4G94 A;  1BM9 A;  4YIR X;  2XHK A;  1MNM C;  1XPX A;  2CW8 A;  5E18 F;  3LA2 A;  3FF5 A;  3GZ6 A;  2GIV A;  4B43 A;  5IOZ A;  2JSC A;  3HG9 A;  2HEO A;  1WKM A;  2HR3 A;  1F36 A;  3DV8 A;  4ON0 A;  4IJA A;  3S1N J;  1R71 A;  2WAD A;  2X4H A;  5IP9 J;  4ETS A;  1IRZ A;  4GDF A;  2LF7 A;  3IRQ A;  3PNV A;  4BQN A;  3RYP A;  5M5W J;  2BOL A;  3OYE A;  4A0Y A;  1DPR A;  3QPT A;  3WG7 H;  3WTZ A;  2VT2 A;  2NS7 A;  3ZQL A;  3KFW X;  5B3S H;  5GTI C;  4DYQ A;  1IN5 A;  3F3X A;  2M0C A;  2FXA A;  1Z1D A;  2RKH A;  3PNT A;  4NQW A;  2W85 A;  1HA8 A;  3FZV A;  4S04 A;  9ANT A;  2M87 A;  2WBM A;  4M72 A;  4PJN A;  1J9I A;  2HDC A;  2P5V A;  2Z5U A;  2DT5 A;  3F8F A;  4A5M A;  1MBK A;  1RR8 C;  4AIJ A;  4G7O F;  2JPB A;  2ZME B;  3T0Y A;  1QRY A;  5KNL A;  4PZJ A;  4UV9 A;  5F1J A;  1XCB A;  2L9N A;  2NRA C;  2A6T A;  2Y0M A;  2KDO A;  4HX4 A;  1DU6 A;  4A3E J;  2X6W A;  1SFX A;  2X6O A;  1ZR2 A;  3UR3 C;  3BPX A;  4L18 B;  3CCM I;  5H6Q A;  1YO5 C;  2RNJ A;  2DOA A;  2L2O A;  3FBN B;  5JVT A;  4IOA F;  1G6N A;  3EUK L;  1F9N A;  4Y3O A;  4I0B A;  3S8P A;  5E3L A;  1X3W B;  1XN7 A;  5EGO A;  1BC7 C;  3K1N A;  4EGY A;  3WU0 A;  1DUX C;  1OIS A;  3S3O A;  1B6A A;  4YRV A;  1YW8 A;  1OCR H;  5JHF A;  2F5E A;  3JAM K;  1K78 A;  2HTJ A;  1T38 A;  4QSH A;  3KYL A;  2OF7 A;  3F8N A;  1IXC A;  1HBX G;  3HL2 A;  3HOZ J;  4RB0 A;  1T0F A;  2JJ7 A;  3EET A;  1O7L A;  1P4A A;  2A68 F;  5E1W A;  4XOR A;  1MZB A;  4IO9 F;  1YTY A;  1Z21 A;  2VJ4 A;  4M6Y A;  1FX7 A;  3DFG A;  2EFP A;  4OIP F;  3HOU J;  5E3M A;  3K69 A;  4Z2Y A;  2XPU A;  3IC7 A;  1IG7 A;  3PJR A;  5LGN A;  3HUG B;  2IA1 A;  2QA4 I;  3AL0 B;  1Q1H A;  3TDU C;  1HKS A;  3CCE I;  1MD0 A;  2JMW A;  3MMY B;  2K9S A;  2FOW A;  4B44 A;  4RDU A;  1JJ6 C;  3I56 I;  1MND A;  2IXS A;  5DM7 F;  4OIN F;  3K9T A;  2F5F A;  2H6B A;  2LH9 A;  1L3L A;  2OZ6 A;  3K70 C;  1TWF J;  4QPO A;  1K4S A;  2RV8 A;  2OA4 A;  1U0J A;  4A69 C;  3F8B A;  1RUN A;  3DWL E;  2RC4 A;  2CW7 A;  1MNE A;  2IP2 A;  3FIW A;  2VOO A;  3FXL A;  2H09 A;  2LBF A;  3KZY A;  4IOC F;  2RRE A;  3RPU D;  4V19 K;  4IRI A;  4LD5 A;  2Y9Z A;  1BW5 A;  2EIN H;  2NS8 A;  2M2E A;  3CP2 A;  2LR8 A;  4RB1 A;  1VQL I;  1IN8 A;  3IUO A;  3GTQ J;  1OR7 C;  5D4S A;  5E3N A;  2DQL A;  3R4K A;  1R4M B;  1O3Q A;  1F1Z A;  2EV0 A;  4D7M A;  4J19 A;  4J01 A;  2CQ7 A;  1R5H A;  4IZZ A;  4ESJ A;  5JI6 A;  2XB5 A;  4NNJ A;  2PMZ A;  2OC6 A;  3P5J A;  4G6Q A;  1GXQ A;  1KYW A;  2ZBK A;  5FFZ A;  3R6S A;  4BE0 A;  2O03 A;  1GHC A;  2CQN A;  3L1P A;  2ZSH B;  3J81 Z;  5K5O A;  2BYV E;  1D0Z A;  3CQZ J;  1Z7U A;  1MBH A;  1OFC X;  1MBF A;  2HOE A;  2QCO A;  5C3E J;  2DI3 A;  4UUV A;  1HQC A;  2DT7 B;  2VAS A;  4W97 A;  2YX4 A;  3LSM A;  3HKZ N;  1ZRC A;  2DT6 A;  4XLC A;  2DQR A;  2F4I A;  2GIZ A;  4I09 A;  3OYB A;  1R1T A;  2E19 A;  3DTE A;  2A5Y B;  2VPR A;  2MFZ A;  2FSW A;  1A6I A;  2PJR A;  3VDX A;  3VOD A;  2OQR A;  1I5Z A;  3K2A A;  3IAS 2;  1XGO A;  4U0W A;  4AVP A;  1OCC H;  1UG0 A;  2JTV A;  3IRR A;  4L0Z B;  3TMO A;  3ZMV A;  3GTP J;  2CV2 A;  1E3O C;  1H9T A;  5LRS A;  5HVQ C;  4CCN A;  2KZV A;  4XNF A;  5D5U B;  1RRJ A;  2LKS A;  5BNG A;  2XPW A;  2XRO A;  3BOQ A;  3GME A;  3L9F A;  3DQV C;  3M8E A;  3Q9V A;  2ELK A;  2ZXW H;  2DFF A;  4A6D A;  2W84 A;  3OS1 A;  3BPV A;  2OCC H;  3A0H C;  3HM5 A;  1MJA A;  1W0T A;  2VB6 A;  1AU7 A;  4BL0 B;  4U88 A;  1YIT I;  1IV6 A;  2KIF A;  2L9S A;  2E71 A;  1PUF A;  4LG0 B;  2IS1 A;  2F5C A;  2HNH A;  4OIR F;  3TGN A;  4BJT A;  1ON2 A;  2HZT A;  5J40 A;  1HF0 A;  1S7O A;  3V7R A;  4RAF A;  1GLN A;  2UV1 A;  3FK7 A;  3TP0 A;  4BEH B;  3M3Y J;  4G6T B;  4ZTJ A;  4ZH4 F;  4CYC A;  3PFY A;  1SMT A;  1RIO H;  2DMQ A;  3KP7 A;  1T2K A;  1X2M A;  2Y2Z A;  4IHV A;  3HB9 A;  1JGS A;  5D4R A;  2IRF G;  2DOD A;  5LLQ A;  4HF2 A;  2K9Q A;  3HSE A;  3S2W A;  2ZJQ F;  4O5V A;  4HST A;  1MH4 A;  2CRG A;  3SZT A;  4C30 A;  1R5I D;  4A3D J;  1SD5 A;  2KRC A;  3L2U A;  3OS0 A;  2WTE A;  1IRF A;  4BDZ A;  5BPI A;  3F23 A;  5E79 C;  3QWL A;  2EIL H;  2O61 A;  1YQA A;  3NEU A;  2JUC A;  5LRR A;  1UJ8 A;  3OR2 C;  1R58 A;  1O57 A;  2MLK A;  4XKC A;  4JX5 A;  4HNT A;  2Q2E B;  2STT A;  1TT0 A;  2YSR A;  4Q4Z F;  4OWR B;  2EZK A;  3HRS A;  1LPQ A;  2QM3 A;  5J1U A;  2DXI A;  1QHH D;  2KJC A;  2G7H A;  2VLA A;  4ESB A;  1K83 J;  4MEX F;  1E3P A;  1NG7 A;  1I1G A;  1HKQ A;  1WQ2 A;  2EPF A;  2LY2 A;  1S5L C;  4M9X A;  1LEB A;  3MKZ A;  3ZPL A;  5LFA A;  2EIM H;  2M45 A;  2R7S A;  2GOM A;  1B8I A;  4LG0 A;  1PUF B;  4IHW A;  3HHH A;  3M1C A;  3HOT A;  2EA2 A;  4GYG A;  5FKN A;  1G59 A;  3GEZ A;  4KNY A;  3HIF A;  3LA3 A;  2AQF A;  2BVL A;  4UXN A;  2EV5 A;  4FCY A;  1X1A A;  4HX8 A;  3PQJ A;  2DJI A;  5ICG A;  3HBL A;  3OSG A;  3V8L A;  1HDP A;  2PFB A;  3M1E A;  3OIP A;  5L3D A;  3I53 A;  3OOU A;  1YIO A;  3CP8 A;  1V5E A;  2EIK H;  4I99 C;  1QZZ A;  3ERE D;  1UFM A;  2IAI A;  1GDT A;  1RUO A;  2OTJ I;  1ETO A;  4H0E A;  3AG1 H;  3JAM Z;  2KIS A;  2QGU A;  2IS6 A;  3NAR A;  2VPL A;  3G73 A;  1X58 A;  3BRO A;  3MFK A;  3FWE A;  2RAE A;  2VBX A;  1JT0 A;  3LSH A;  4I2O A;  1WPK A;  3BZK A;  5GAH J;  5LBQ A;  5D8L B;  1JGG A;  2ZKZ A;  2TRT A;  4A3L J;  5KAI C;  1OKR A;  3OR1 C;  1FMV A;  4X1E A;  2AXL A;  4RB2 C;  4PDK A;  4HNU A;  1HC8 A;  5F64 A;  2E36 A;  2NAZ A;  2ECB A;  2NOJ B;  1QVT A;  2GBY A;  1ZRF A;  4G12 A;  2AS5 F;  3T1B A;  2YR2 A;  3BT9 A;  2E1M C;  3EUH A;  2MG4 A;  3JTH A;  1FY7 A;  4A12 A;  4BUP A;  2Q2E A;  2WAQ A;  2ZJR F;  2QKM B;  2VXZ A;  4JBA A;  3LQQ A;  3BQZ A;  3KYC B;  2L01 A;  1W36 C;  1Y6I A;  4N9H A;  2W82 A;  2V9K A;  5GPC A;  1PUE E;  4B47 A;  3OS2 A;  4FX4 A;  4AVZ A;  4PSX A;  1X4O A;  3GX4 X;  4E7L A;  2IW5 A;  3VOE A;  2W25 A;  4KT6 A;  3ZQH A;  1IF1 A;  1BIA A;  3OSF A;  2A6H F;  3SFI A;  2K9L A;  3A03 A;  5LGU A;  2WB1 N;  3FXJ A;  4XLP F;  2O8X A;  4C2T A;  1O3T A;  4YEJ A;  5LEK A;  4OIQ F;  3LFK A;  4WX9 A;  2ADU A;  2CUZ A;  2ESH A;  2LBF B;  3KZI C;  4CIC A;  1VQK I;  3W2W A;  1JUP A;  1S9H A;  2MBF A;  3QPL A;  2DCE A;  4NQW B;  3TW7 A;  3L09 A;  2M4G A;  2J5O A;  2BZT A;  3NWT A;  2ID3 A;  1B1B A;  3LAP A;  2BEO A;  1U5T B;  5J1R A;  1DU0 A;  1U5T A;  2M4K A;  2AO9 A;  2EJR A;  4PJL A;  2JA2 A;  3AFH A;  1YG2 A;  3KP4 A;  4A2U A;  3AAF A;  2LK2 A;  1JTY A;  3JSP A;  2RDP A;  1HDD C;  4BXX J;  3QRF F;  1O3S A;  3H9Q A;  1EH6 A;  4DJA A;  3FHZ A;  1VQN I;  2JT1 A;  3WGH A;  4BYY A;  4OMZ A;  2A69 F;  1WI3 A;  4LIT A;  2V9P A;  2LFB A;  5CQG A;  1H8A C;  3CUQ A;  4BHB A;  2BHY A;  3CLQ A;  2O0Y A;  5J8F A;  2L9R A;  2HKO A;  2OV7 A;  3H9J A;  3TQN A;  1SFK A;  1N78 A;  1I6H J;  3LST A;  5FKK A;  1Q1V A;  3QU3 A;  3CDL A;  2CMP A;  1X19 A;  4ABZ A;  5JVG F;  3K1M A;  3TBI A;  5JHU A;  3UNG C;  3I59 B;  3HEF A;  1VQ7 I;  4A3M J;  3S1Q J;  4HPQ A;  2R5Y B;  1TNT A;  4HW0 A;  5HLI A;  3MWM A;  1KA8 A;  2CSO A;  2PG4 A;  1K6Y A;  2W48 A;  3E97 A;  1OYW A;  1SAX A;  1B72 B;  1W5C C;  1DP3 A;  3GWZ A;  1U3E M;  3SDG A;  4IF4 A;  1VQP I;  1J0R A;  2IGO A;  5CVU A;  4ZYH A;  3NWS A;  4G9Y A;  5LHI A;  3L7W A;  1Z3X A;  3JW4 A;  4L5J A;  3KLN A;  2WY7 Q;  3FM3 A;  4TV7 A;  5FD5 A;  1PVE A;  3SZG A;  1G3T A;  1POG A;  2K27 A;  5FO5 A;  1D1A A;  4HV6 A;  3AG3 H;  2VXD A;  2WAF A;  3GCM A;  3KIO A;  2FU4 A;  3VYU B;  5FJ8 J;  2FRH A;  1I27 A;  4QWQ A;  3OL3 A;  3DP7 A;  2ISZ A;  3G4S I;  5HLH A;  3RZD J;  4U0Y A;  5IT9 K;  1FLI A;  2KP6 A;  3ECH A;  1ITY A;  2HWV A;  1BR1 A;  2VKE A;  3DU5 A;  1IN7 A;  5K7F A;  4E70 A;  1ETX A;  4XLF A;  1LVA A;  2DOF A;  3J80 Z;  4BAY A;  3ECO A;  1FBU A;  1VF9 A;  1KU3 A;  2MC3 A;  3H9G A;  3HJE A;  4NC8 A;  4D1Q A;  3TDZ C;  3L2Q A;  5GAD J;  2Y0S N;  1GXP A;  1OMI A;  3FM5 A;  4BJ6 C;  3W6V A;  4XOT A;  3K4K A;  4J00 A;  5TRD A;  2ZCW A;  1JKR C;  3OYM A;  4RLQ A;  5ICC A;  5JLX A;  2E2I J;  5DCM A;  1ZTR A;  2H1L A;  2HVQ A;  1O3R A;  4CCM A;  4RAG A;  2VJJ A;  1X3U A;  4UUT A;  2HYF A;  2PMU A;  4AU7 A;  2NVT J;  4A93 J;  1LJ9 A;  1OLT A;  2XV4 S;  4IHT A;  3FXU A;  2PEX A;  1VQO I;  3OYJ A;  1OPC A;  1YX5 A;  3KE2 A;  1XSV A;  2O8K A;  5TIS C;  1GVJ A;  1YOV B;  4LLL A;  2P6S A;  3HSR A;  3REO A;  2R7W A;  1VQ5 I;  1SVL A;  3C7J A;  5IOY A;  4KIC A;  3CCR I;  4EVI A;  2QSG X;  4NB5 A;  1WHU A;  2ZNZ A;  1WI9 A;  1PDN C;  1SFO J;  5ED4 A;  4UVC A;  3K4J A;  4HLY A;  1T95 A;  5L3F A;  2HQR A;  4YFN F;  4YIF A;  4NC7 A;  3HOV J;  1YS7 A;  1KGS A;  4Y13 A;  3GFL A;  2XGE A;  3NQO A;  1CF7 B;  1ETY A;  3RKX A;  3GTJ J;  2VBW A;  3CJT B;  1DDN A;  2VKH A;  4F55 A;  2DYS H;  3D5R C;  3BCA A;  1ON1 A;  5DCM B;  1SD4 A;  1OCP A;  1V5G A;  3I3L A;  3HOS A;  3TKY A;  2CUF A;  3IH4 A;  2XUB A;  5AIQ A;  5K7H A;  2YU3 A;  1XGN A;  1I39 A;  3BG9 A;  4AIK A;  3EYI A;  2KHM A;  4AYB A;  1JHH A;  4RAZ A;  3Q5F A;  2JA6 J;  2R7T A;  1TW3 A;  4R1H A;  1VND A;  2KL4 A;  1KZH A;  1P6R A;  3CLO A;  2EWN A;  4D7N A;  1HSJ A;  2R4G A;  2L02 A;  4KMF A;  2IS2 A;  3U2R A;  3CCU I;  3W6K B;  1MW7 A;  2F5D A;  2L4M A;  3DPL C;  3HSF A;  3T5X A;  4M3G A;  2VL8 A;  2GA2 A;  3HXL A;  2CFX A;  2B7E A;  2GOX B;  3ABL H;  1APL C;  1ETV A;  3JRA A;  3U21 A;  3HHG A;  4P9F A;  1X2N A;  2DA7 A;  4JX4 A;  5ILU A;  4LK1 F;  1YE9 A;  1IGN A;  2GA1 A;  3ELK A;  2ZSI B;  4M3D A;  3MZY A;  5FKL A;  4HA8 A;  5F0C A;  1O4X A;  3QPH A;  2IGM A;  2Y31 A;  2CV1 A;  4DW6 A;  2YUS A;  2JA8 J;  1TWA J;  4EMS A;  3S1M J;  1DP7 P;  3CD6 I;  2UXN A;  5CVJ A;  3OYH A;  2XPV A;  5DCF A;  2JRT A;  3A02 A;  4O3M A;  1IUY A;  3CMY A;  2DDA A;  5LHG A;  1SEU A;  3CF5 F;  2D2W A;  4V2G A;  2ZB9 A;  2DU9 A;  3I9V 2;  2V6E A;  2K85 A;  5FD6 A;  1WJA A;  1UEL B;  4OU0 A;  4R79 A;  1OCZ H;  3K70 D;  1FEX A;  3RPQ A;  2HVR A;  4AC0 A;  2B0L A;  2XDV A;  4KMU X;  3CO6 C;  3CCS I;  3DTI A;  4UVA A;  3N05 A;  1AA7 A;  4U7D A;  1U9O A;  3BY6 A;  1QQI A;  2LSO A;  2M9H A;  4E6K G;  3A01 B;  2M30 A;  3GYH X;  2ECC A;  1GVD A;  1MBE A;  2EQR A;  1SC7 A;  1R23 A;  1E17 A;  1WRJ A;  4DBQ A;  4BY1 J;  1KU2 A;  1LUJ B;  1UHS A;  4I7H A;  3G1O A;  2I8D A;  2X1C A;  4HQE A;  1W5T A;  1H0M A;  1V5F A;  5H6R A;  2NVX J;  4XRM A;  2K86 A;  1M1E B;  1U8R A;  1EKE A;  2JK3 A;  4QIW N;  3ABK H;  4V2F A;  3SDB A;  5EZG A;  1B4A A;  3ZN1 A;  3PSF A;  3GTO J;  3HOY J;  3WE3 A;  1BR2 A;  1YRN A;  2CGP A;  1NG6 A;  1Z6T A;  1G4D A;  1Z91 A;  2DA6 A;  3WTW C;  2GXA A;  2DDB A;  2H1K A;  1TP4 A;  2IJL A;  2FA5 A;  1J7K A;  4KA4 A;  4NBQ A;  4XOP A;  1VFC A;  3CCV I;  3HRM A;  3JSO A;  3LFU A;  1IDZ A;  1D0Y A;  1ZG5 A;  5DM6 F;  1NTC A;  2X1E A;  1IJW C;  2XRL A;  1B9N A;  3E7L A;  1S3J A;  4BY7 J;  2DA3 A;  1PP8 F;  1YLF A;  4S05 A;  2BXY A;  2W4S A;  3A01 A;  1IXR C;  4XRS G;  4Y17 A;  5M5X J;  4C2M J;  3BJO A;  4Y4R A;  1FIA A;  5IYC J;  2DFE A;  3M8J A;  1P92 A;  1E2X A;  3C3W A;  2PX9 A;  2OD5 A;  1XSD A;  4DGW B;  1X1P A;  1OYI A;  4D9J A;  1JJ8 C;  3CMM A;  3FHN A;  3KEQ A;  2V1N A;  5GAE J;  4YII A;  1J5Y A;  5HLG A;  3VFZ A;  1FZP B;  3M07 A;  3BTC A;  4MFE A;  2M0M A;  3RQ4 A;  1EF4 A;  2LMD A;  1BI0 A;  3K4M A;  4HV5 A;  1I50 J;  4M9S A;  2QYO A;  1XS9 A;  1ACI A;  3SEQ A;  2VBZ A;  2ELH A;  1HST A;  3MEX A;  2FNP A;  2K9M A;  3DBH B;  2KKO A;  4FQG A;  2E5Z A;  2CQK A;  3E6M A;  3CCQ I;  2L3D A;  1F43 A;  4MIM A;  1JTX A;  4PJ0 C;  2PI0 A;  4LB5 A;  2P7V B;  5E17 F;  4ENK A;  2K3F A;  3CJQ B;  5K7Z A;  1Z05 A;  4UHT A;  2V1D A;  2IGK A;  1QZY A;  4DZP A;  3KCC A;  4E7S A;  2V26 A;  4RA2 A;  3JRF A;  2P7C B;  2HVS A;  1TTY A;  2MA3 A;  4CXF A;  1WCM J;  3D1N I;  1LKX A;  4XIC A;  4IHX A;  1SAU A;  1ETQ A;  5L3C A;  1D8J A;  3RKW A;  3RPU A;  2UZK A;  2EK5 A;  5D6F A;  5IY5 H;  1YJ9 I;  3LSJ A;  4CHU A;  2LRD A;  4I98 B;  3H36 A;  5C4J J;  2JRM A;  4L0Y B;  4NDL A;  3IAM 2;  1BL0 A;  3JTG A;  5H2F C;  4E4H A;  1UB9 A;  4A3K J;  3MZ8 A;  4LLG F;  2MD0 A;  3CF2 A;  4BBR J;  4LOC A;  5LD2 C;  1REP C;  4ZDO A;  2ZNY A;  1LDD A;  4JQF A;  3CCL I;  2ZME A;  5KAF C;  5HDN A;  3ZMT A;  4A5N A;  3AKZ A;  3ONQ A;  4WWC A;  3I4N J;  2IEK A;  4NUB A;  1B9M A;  4AYB N;  3DLA A;  3ZMZ A;  2BY3 A;  6PAX A;  3WTX C;  3BZ6 A;  2IPQ X;  1FJL A;  2O7O A;  4KIG A;  3WTS C;  3WGI A;  4WXH A;  4U7B A;  4N9I A;  4HX7 A;  1TL8 A;  2VE9 A;  3W3C A;  3RJP A;  1YW9 A;  4DBR A;  3SZP A;  2YS9 A;  3HDD A;  3B6C A;  1JKO C;  1ZRD A;  2H27 A;  2H94 A;  2E1N A;  5ICF A;  2XAU A;  4JK1 X;  2LG4 A;  4M71 A;  1B59 A;  2ZFU A;  5J47 A;  4IVN A;  3GBG A;  1A31 A;  5IP6 A;  2K5C A;  1EH7 A;  3DEW A;  1Y1W J;  2KDZ A;  3TO7 A;  1R49 A;  1J09 A;  4XBF A;  4C3I J;  3S1R J;  2EV6 A;  3E1S A;  5J6X A;  4K2E A;  1A35 A;  2QKL B;  3BJ6 A;  1C0W A;  1ZGA A;  3KX2 A;  5IT3 A;  5K5R A;  1YJW I;  1UCR A;  4H4K C;  4DOZ A;  3TOA A;  1LE8 B;  4UNO A;  1EH8 A;  4CCO A;  1ZN2 A;  3F6V A;  4R8H A;  1X4P A;  5E8G A;  3FXR A;  2FBK A;  2RNG A;  4XLA A;  2F48 A;  4EV0 A;  2ZO4 A;  1XDU A;  4OAY A;  5FLX Z;  4MTD A;  4IRH A;  3A2K A;  2EZH A;  2LLK A;  1EA3 A;  1W7P A;  1UG2 A;  3HPH A;  3WTU C;  2COB A;  3TW6 A;  4RS8 A;  2D5V A;  3PO2 J;  4HBL A;  2JVG A;  3CDH A;  1Z6R A;  3L2V A;  4MQV A;  2L7K A;  2VOP A;  3I5U A;  4L5E A;  1K61 A;  4CH7 A;  4M3B A;  1FBS A;  3B02 A;  1UZC A;  1D8K A;  4F3Q A;  4BQO A;  1W0U A;  5J1Y A;  1IO2 A;  4AUX A;  1B72 A;  1IUF A;  4I6Z A;  3ASN H;  2Q8K A;  3JCU C;  5IP7 J;  4P5O A;  3ZMU A;  2XIG A;  1V4R A;  2WAQ N;  2ZJ2 A;  4M3F A;  4OOI A;  2E34 A;  2MGQ A;  3FX3 A;  5BPD A;  4RAY A;  4PGH A;  5H20 A;  1USS A;  3D5L A;  2D1V A;  2GZW A;  1DPU A;  4GYI A;  3IKV A;  3I54 A;  1BR4 A;  4XM3 A;  5CKT A;  3R0J A;  5EEA A;  4RMN A;  4BBS J;  1TQI A;  1F5T A;  3WG9 A;  3M4O J;  2P4W A;  1LFU P;  1LFP A;  2RN7 A;  2M7B A;  3E5Q A;  4XK4 A;  5GTH C;  1X1D A;  4EJT A;  4XLH A;  1GV5 A;  1AKH B;  2E7X A;  5FRN A;  1ZEL A;  4UUS B;  3G71 I;  4LJZ F;  1FBQ A;  1D0X A;  2E1O A;  5GAG J;  1P7I A;  4YFX F;  1MDM B;  3ABT A;  4HZF A;  3VYS B;  4E7Z A;  4U0V A;  2DOE A;  2G7U A;  2LYC A;  1ZR4 A;  2ZFW A;  4HOB A;  3COA C;  3KP5 A;  4M73 A;  2HGC A;  2QSH X;  3ZQF A;  4OAZ A;  3FMQ A;  1BA5 A;  4B3A A;  3WHB A;  1CQT A;  3RKQ A;  2EFN A;  1FTZ A;  2EFO A;  2OJE D;  3FMS A;  2Z1D A;  5B66 C;  2MSY A;  1OQY A;  3VPR A;  3DU6 A;  1MMS A;  4Q5S F;  2XF5 A;  4B8X A;  4FTH A;  1RKW A;  2CFO A;  1QGP A;  3S17 J;  2P5K A;  2K9N A;  1JUS A;  5DS9 A;  4LG3 A;  3CUO A;  1WZ2 A;  3Q0W A;  1Y0U A;  3BG7 A;  1UMQ A;  1VQ4 I;  4BQA A;  4G6D A;  2X0L A;  2ZC2 A;  5TJJ A;  5HNF A;  1H9G A;  3BCB A;  1OYY A;  1WJD A;  1JHF A;  2A61 A;  4ZYA A;  2WAE A;  4KIS A;  2VC0 A;  1PJR A;  3IWF A;  3NRV A;  1G3W A;  2AQE A;  5HS8 A;  1ONV A;  2XAS A;  4GXO A;  4X0G A;  3W2V A;  1LE8 A;  3MQ0 A;  3WHC A;  2KQR A;  3H3V K;  1R6R A;  4DYR A;  4RB3 C;  2NVU B;  1UHW A;  2RQP A;  3L2R A;  2A07 F;  3M9A A;  4E7H A;  2HXI A;  4HNV A;  1OCO H;  4IPA A;  1FYK A;  2IBD A;  4DNC A;  2YU9 J;  3KET A;  1VZ0 A;  2NXN B;  2Z9O A;  2JWT A;  1ETK A;  2BVM A;  2KFD A;  2XVC A;  1I6X A;  1E3H A;  2FE3 A;  3OYC A;  1KON A;  1IC8 A;  1VTN C;  3W6J B;  2O5R A;  3TP3 A;  4KUM A;  4BE2 A;  2WV0 A;  2GWR A;  1BI2 A;  1W4M A;  3CUQ B;  5CQE A;  4YG2 F;  2JQ7 A;  3S14 J;  2XF6 A;  3HYI A;  3HPG A;  3O2P E;  1S29 A;  4F91 B;  1Z0X A;  3KP6 A;  3MAJ A;  1SFE A;  2DK5 A;  2IA2 A;  2LDU A;  2Q1Z B;  2GLO A;  2MYS A;  2M3A A;  4I0A A;  2L7M P;  3HRT A;  2L7F P;  3E3V A;  2MH9 A;  3ZN0 A;  1TT5 B;  3FKI J;  1SFU A;  1FYM A;  3PUB A;  5J4Y A;  4C3H J;  4HF1 A;  3PIO F;  3IV5 A;  5ILV A;  4RBO A;  3QOP A;  2ETH A;  2P6T A;  1TLH B;  1XC5 A;  2CW0 F;  3MN2 A;  2DYR H;  4PGG A;  4D5C A;  3LL7 A;  1ZG1 A;  2ZJP F;  2FQ3 A;  3CCJ I;  1ERD A;  3IWZ A;  2LF8 A;  4L5I A;  4RGR A;  5EF6 A;  3CO7 C;  1U9N A;  2XAQ A;  3L00 A;  3U9G A;  1WJB A;  3HC7 A;  1RR7 A;  4HLX A;  4ZJZ A;  3SYT A;  2FEZ A;  3WE2 A;  2HPM A;  2X1D A;  5KHD A;  2CUJ A;  3K4N A;  4A3G J;  3X2Q H;  1RI7 A;  3BR1 A;  2A3S A;  1BI3 A;  1TWC J;  1D3Y A;  3V7C A;  3S3M A;  5D6E A;  4C3J J;  4EJO A;  1BOA A;  4KN4 X;  2Y48 A;  2EZI A;  2W57 A;  2F5V A;  1X1B A;  1RES A;  4E7I A;  2N8G A;  2BV6 A;  3CJR B;  1BBY A;  2XRN A;  1RKT A;  4PCQ A;  4I76 A;  3GTL J;  3ML6 A;  3ERM A;  2P8T A;  1ZQ3 P;  2CYY A;  5ICE A;  1BW6 A;  4ENN A;  4KN7 X;  2XKP A;  4L9V A;  1MMN A;  2P81 A;  2XSJ C;  2DN0 A;  3H0G J;  1GT0 C;  3FIS A;  3K2Z A;  3OWT A;  2Z3Y A;  3BR3 A;  1ZKG A;  1JI8 A;  1XGM A;  2IA0 A;  3S2H J;  1T56 A;  4PSW A;  1P7J A;  2R7F A;  5DD4 A;  4KJZ A;  3QYB A;  4GGG A;  4DQ2 A;  5M3M J;  1LEA A;  3HOW J;  1RNL A;  2H8W A;  4GRI A;  4LGW A;  5EG0 A;  2V9V A;  1FSH A;  4GO1 A;  2HQ5 A;  2A6E F;  2X6X A;  3LSG A;  3O8G A;  4QPQ A;  3RQI A;  3O8H A;  2DK8 A;  4RM3 A;  1FWZ A;  1ZH5 A;  2EH3 A;  3Q0U A;  1R22 A;  5FLX K;  2WY8 Q;  2QEX I;  3CC4 I;  1AHD P;  3DXJ F;  2OAZ A;  4AID A;  2MLG A;  5DTD A;  3LNQ A;  2JZY A;  1OJL A;  2LRE A;  4HG2 A;  1Z3Y A;  3BR0 A;  1ODD A;  3G1M A;  3I4P A;  3H5R A;  4B3X A;  3ABM H;  4CCK A;  3GZN B;  3BTJ A;  3I0T A;  2H6C A;  4KIT B;  2QQ9 A;  2HZD A;  1WJF A;  2HFH A;  4IXA A;  2VOD A;  5GP9 A;  1L0O C;  2V1X A;  1KQ9 A;  5JLW A;  5LHH A;  3CZ6 A;  1U6G A;  2FNA A;  2XB0 X;  1GV2 A;  2EBI A;  2R5Z B;  2HOS A;  5HOO A;  3SQN A;  2PQ8 A;  2A05 A;  4IQ4 A;  2Y30 A;  3G6E I;  3V8K A;  1K4T A;  2KZG A;  2K4J A;  4PFO A;  3QAH A;  3RTR A;  1XMK A;  1FPQ A;  4II2 A;  3DEE A;  5E1X A;  3V4G A;  5F1R A;  1K79 A;  3JRC A;  2KJB A;  3GW2 A;  3G1L A;  3GUD A;  4FIS A;  1J75 A;  1DQU A;  2LD5 A;  1FOK A;  5E3O A;  1P4X A;  2X51 A;  3PUF A;  1YYV A;  3CJN A;  1Y56 A;  3OOP A;  1E0E A;  2LNB A;  3VB2 A;  1QHG A;  3PFI A;  4BXF A;  5C4X J;  4WXD A;  2BY2 A;  3W2A A;  2I5U A;  3VYR B;  4UY8 I;  5AIP A;  1ZG3 A;  1DGW Y;  3OYG A;  3WTV C;  3V42 A;  2VT3 A;  1SD6 A;  3QYE A;  2D1H A;  4LB6 B;  1U8B A;  4XSZ F;  2FQ4 A;  1JT6 A;  2BGC A;  3LSI A;  5FGM A;  1H89 C;  1FP2 A;  3WU2 C;  1YW7 A;  1UHM A;  2LKX A;  3MD2 A;  2ESN A;  2QVO A;  2XAJ A;  2VUM J;  2HYJ A;  2QLZ A;  4ITV A;  4C9Y A;  4ESF A;  4U87 A;  3TO6 A;  1YHQ I;  3KP2 A;  2R92 J;  3EUA A;  4CZZ A;  4UUS A;  3P9I A;  2DPU A;  2R7U A;  2M7A A;  2IS4 A;  3GXO A;  2XSD C;  3I58 A;  4A6E A;  4ZZL A;  5BOX A;  1ZLJ A;  4FHT A;  2PJR B;  3B6A A;  1XX5 A;  3GTM J;  2ME6 A;  2A5W A;  2VI6 A;  1ZAO A;  1HW5 A;  2VQG A;  2E1M B;  1QVU A;  2EZL A;  3U1D A;  1LB2 A;  1HCR A;  4B4C A;  1T98 A;  5EJC A;  5F04 A;  4IKF A;  5A2Q Z;  5B1A H;  4IEJ A;  1XCV A;  4EM1 A;  4AM3 A;  3RYR A;  3PQK A;  3D5S C;  5FB2 A;  2CWE A;  3LAJ A;  3KEO A;  4IQJ A;  4ZZD A;  4D5F A;  2GXG A;  5M3F J;  2VKV A;  4AD9 A;  2ISY A;  3Q0V A;  5HS7 A;  5HS9 A;  3L2C A;  4MO7 A;  3Q3S A;  1HW2 A;  1V54 H;  2Q0O A;  3DKW A;  2CQX A;  1JE8 A;  4FT8 A;  2QQA A;  1T08 B;  3OIQ A;  4M6V A;  5DUI A;  1S6L A;  5L3B A;  2WC2 A;  5J3L A;  2HQN A;  1IXS B;  2KMU A;  1SVO A;  2ME0 A;  3IKT A;  4A3B J;  2Y0S A;  3CDI A;  1ZK8 A;  1IRX A;  3E6B A;  5LGT A;  3KPH A;  3OYN A;  2JA7 J;  2K7L A;  1BJA A;  2XAH A;  1Y8R B;  3ZMS A;  3K6G A;  4KDP A;  1TWH J;  1STZ A;  4Z6Y A;  2E60 A;  1RET A;  2QBY B;  2KLO A;  3V8J A;  1XGS A;  4G7Z F;  1MH3 A;  3F9K A;  4MGR A;  2HTS A;  5TGT A;  1MSF C;  2RQQ A;  2WA0 A;  1QO0 D;  4BS9 A;  4F52 A;  4CYC B;  3E6C C;  1R1U A;  3BLY A;  2AXT C;  2QEN A;  4AWX B;  1WSU A;  2CV0 A;  1Z77 A;  1LFB A;  1I3Q J;  1TNS A;  4Y7N J;  1A5J A;  1SMY F;  3R60 A;  1IW7 F;  1LQ1 A;  4BNC A;  2AHQ A;  1VQ9 I;  3U1K A;  1W7P B;  3E5X A;  2P5L C;  4Y33 A;  2OZU A;  1J59 A;  1G3Y A;  1WH7 A;  3SJM A;  1S72 I;  2L7Z A;  3ASO H;  2YPR A;  3VSK A;  1R9T J;  2ELJ A;  3ZQQ A;  4A3F J;  1W36 D;  1LDJ A;  4EM0 B;  2TDX A;  4XRS A;  1TWG J;  4F92 B;  5HOD A;  4YFK F;  2O6G E;  2CU7 A;  1P9Q C;  4HAM A;  3JRE A;  1ENH A;  3JRG A;  1X3Z B;  4QTR A;  2FJ1 A;  2UXX A;  1MBG A;  3VWB A;  1QA6 A;  2UUZ A;  2ID6 A;  2L5Q A;  3AL0 C;  4DYC A;  4DIQ A;  2ZXJ A;  1XB4 A;  4RM2 A;  3GVA A;  1YRN B;  1VQ6 I;  4BJ5 C;  3LOC A;  1OR7 A;  3KLO A;  1ZLK A;  2VQL A;  2EA4 A;  2LY1 A;  2ZME C;  2XC7 A;  3E6D A;  3RKY A;  4XSX F;  3ABU A;  2VN2 A;  4BAC A;  4XR6 A;  2DA1 A;  3GFI A;  1QU3 A;  4KFC A;  2HOA A;  4UB8 C;  2R7V A;  3P9K A;  5HLT A;  3OY9 A;  3IHU A;  2E2J J;  4M74 A;  2JVH A;  5L3E A;  1Z67 A;  3CMA I;  3IH3 A;  1FIP A;  2OU2 A;  2DTZ A;  1R4N B;  1MGT A;  2GQQ A;  2IVM A;  2XKO A;  1LNW A;  3PIP F;  4HF0 A;  4FE7 A;  5ERI A;  4WF2 A;  3FXM A;  1MJ9 A;  2Y9Y A;  5JFR A;  4M3E A;  3FXO A;  1QNT A;  2ZXI A;  3DKY A;  5DEQ A;  1FTT A;  2MD5 A;  5BQT A;  2EIJ H;  2QZ8 A;  3J7Z I;  2XGD A;  1D5Y A;  1EJ9 A;  4ZYE A;  5ILS A;  2EB7 A;  2QSF X;  5DDG A;  2VQH A;  4RGS A;  4P1W A;  1BC8 C;  2I10 A;  3EQL F;  3S3N A;  2HOT A;  2CG4 A;  4ENJ A;  2IT0 A;  4JOM A;  1SD7 A;  4BU2 A;  3J81 K;  1XDS A;  1TC3 C;  1QZE A;  4Q47 A;  2R7X A;  4XID A;  5CVI A;  5FKM A;  3PSI A;  2K3P A;  3G2B A;  1S7E A;  2DFI A;  3DCF A;  4L9J A;  1WJE A;  2FOK A;  4ZDP A;  1A6Q A;  2X85 A;  4L9N A;  4MEY F;  3R61 A;  4PFP A;  2DFH A;  2KIM A;  2Z99 A;  1Y8Q B;  2ACJ A;  3LMM A;  3CC7 I;  3HGY A;  3PL8 A;  3S16 J;  4EJW A;  4X6A J;  3ZP5 A;  3F8M A;  2HQA A;  4I01 A;  4EQQ A;  2HXO A;  2BW3 B;  1VI0 A;  2XGC A;  1FOY A;  2MAB A;  4XQF A;  3GTG J;  3J7A Y;  4WCG A;  2JN6 A;  1G3S A;  4ZYG A;  2E7W A;  3BJA A;  5D5X B;  5D5W B;  5DD8 A;  3S2D J;  1WH5 A;  3VSL A;  2V1U A;  4G7H F;  1DGR M;  2DLL A;  2DTR A;  2M8G X;  5IYB J;  3LSK A;  3EDP A;  4HDV A;  2VKD A;  1SVM A;  4HYE A;  2D45 A;  2V7F A;  3HUG A;  3K4B A;  1MSE C;  4HRI A;  1A04 A;  3I4M J;  1N75 A;  2MH2 A;  4CGZ A;  4MLO A;  4Q48 A;  3KP3 A;  5C44 J;  3N97 A;  3IH2 A;  5K5Q A;  3PM1 A;  3QQA A;  1NK3 P;  3J80 K;  3JRH A;  4XN0 A;  1Y0N A;  3K0L A;  2L9V A;  3OYA A;  4IL6 C;  1K78 B;  2DO7 A;  5F27 A;  5E1Z B;  3J7A O;  2FBH A;  1JKP C;  3F8C A;  4XKV A;  3DTK A;  1F4K A;  3H3U A;  4KIB A;  1FYL A;  2W7N A;  4XL9 A;  2KIQ A;  4A3I J;  3LWF A;  1FMW A;  5FFX A;  1ZHF A;  2MC4 A;  3HTS B;  1PYV A;  3SXY A;  2XAF A;  3TOB A;  5E20 A;  2O3F A;  3T8R A;  2EFW A;  3ZQG A;  4CYD A;  1EV7 A;  3K1P A;  1I3A A;  4HSR A;  2DBB A;  2CH0 A;  1ULY A;  3HKZ A;  5FRO A;  5FLM J;  3T8T A;  3QOD A;  2GXB A;  3QP6 A;  2OQG A;  4A0X A;  4O6J A;  4UVB A;  2LKP A;  2HI3 A;  1S7A A;  3SFZ A;  3RIR A;  4Y52 J;  4HEA 2;  2VJ5 A;  5FKO A;  1D1B A;  1YFH A;  3S93 A;  3JRB A;  1MJB A;  2VC1 A;  5KCM A;  4B1R A;  2STW A;  1HKT A;  1ZYR F;  1LDK B;  3F6O A;  3K10 A;  2MW8 A;  4LIV A;  1FNN A;  3PO3 J;  2G0E A;  3LSR A;  2FF4 A;  2LVS A;  2QF7 A;  3ZXS A;  2L0K A;  1AKH A;  4ZDL A;  4BE1 A;  4II3 A;  4F7Z A;  1YX3 A;  1BJZ A;  4P55 A;  2OTL I;  3H5A A;  3GF2 A;  1CF7 A;  3RSN A;  3OV8 A;  3ZQ7 A;  4BQQ A;  2R7Z J;  2DMU A;  3V7S A;  2CO5 A;  1WJC A;  3C2B A;  3M7G A;  3JRI A;  2OUM A;  3GFJ A;  3ZRG A;  3KYD B;  2DA4 A;  3FBI B;  4N4O B;  1T39 A;  5DUK A;  2NVQ J;  3A1Y A;  1WVR A;  3C2H A;  2XGX A;  1XSX A;  4RGX A;  1QPI A;  1R5G A;  3HZJ A;  2W00 A;  2M5W A;  3K7A J;  3VEP A;  2BY1 A;  1JUM A;  2IGN A;  3BTL A;  3PNY A;  4EAT A;  1R36 A;  3A4C A;  2R5Z A;  1KYZ A;  1V3F A;  1ZGW A;  3DPU A;  1BN5 A;  2K4B A;  4XON A;  5F6F A;  1R00 A;  2V79 A;  4S0H B;  4IX7 A;  4B09 A;  1Y39 A;  1NHA A;  1Y1V J;  5GPA A;  2KIU A;  2V4J C;  2GAU A;  5BS6 A;  2JUG A;  4CCL A;  2R5Y A;  2X9D A;  2QQB A;  4RLF A;  3IL2 A;  3FXK A;  3GLL A;  4LFU A;  3G3Z A;  2O9L A;  3F21 A;  4FET A;  4ZYD A;  1TW2 A;  3RCO A;  1BOB A;  1X1C A;  2R7D A;  5B5E C;  1HLV A;  3JRD A;  5IT9 Z;  3H35 A;  1S8N A;  1N25 A;  1XMA A;  2FBI A;  2HS5 A;  3AG2 H;  1T0F C;  3EYY A;  3MKY B;  1FSE A;  3HRU A;  2EFQ A;  3BTI A;  2Z33 A;  3I71 A;  2COM A;  2DAO A;  3O3K A;  4E7K A;  3LSP A;  2W1O A;  3F72 A;  4A3J J;  3P9C A;  3EUH C;  4XLN F;  1I1S A;  1FT9 A;  5HDG A;  1KU9 A;  2X48 A;  1MDM A;  1T8I A;  1W7P D;  1XTA A;  3ESW B;  5HNH A;  1K7A A;  4IHS A;  1QPM A;  5FRM A;  1T6S A;  2HYG D;  2XAG A;  3OYK A;  2QQ8 A;  3MKL A;  2KPM A;  2M34 A;  2WV1 A;  5CLS A;  1XG1 A;  3BG5 A;  3B73 A;  3GFM A;  2CQQ A;  4XN3 A;  2DMP A;  2NS0 A;  1UST A;  3OYD A;  4FX0 A;  1R7J A;  5F0H A;  2LY9 A;  4BDY A;  4IHY A;  3QYF A;  4L9T A;  3BP8 A;  4PK4 A;  1PP7 U;  2PJP A;  2X6Y A;  4EM2 A;  4LK0 F;  1N77 A;  4F93 B;  2NNN A;  4HDU A;  5EG0 B;  4ZTF A;  4KIF A;  1BI1 A;  1ORK A;  3GO5 A;  4CCJ A;  2L54 A;  1U2W A;  2P0W A;  3ZQI A;  1YIJ I;  5EEG A;  4BGD A;  3ULQ B;  2VJI A;  2M1B A;  2VBY A;  4D0P A;  3FKJ A;  4M9Z A;  3CCY A;  3Q9S A;  4N0B A;  1MMG A;  1IAW A;  5FLV A;  2NVY J;  3LQR A;  4WXC A;  1GUU A;  4PJJ A;  3VYT B;  2C6Y A;  3A0B C;  4JX6 A;  5J4V A;  1FP1 D;  2PLY A;  4XLE A;  1MMA A;  1RC9 A;  2BY0 A;  2KT0 A;  4OIO F;  1RZ4 A;  2W24 A;  2BHZ A;  4NC6 A;  3N4M A;  3H3Z A;  2JA5 J;  5B1B H;  4CSW A;  1XMX A;  3H92 A;  3ZGK A;  3MCZ A;  1Z9C A;  2F4O B;  3FDY A;  2R93 J;  5JR3 A;  4BHC A;  3CES A;  2TCT A;  3BZC A;  3FXQ A;  2NNY A;  1V55 H;  1W5S A;  5M5Y J;  3ZR8 X;  1HXD A;  4P96 A;  3S32 A;  5E8I A;  1CGP A;  5CVR A;  3BG3 A;  5CPR B;  2PBI A;  4XKW A;  5EZH A;  5EDN A;  2BXZ A;  5L3G A;  5D5V B;  1IRG A;  3R0A A;  1BIB A;  5A2Q K;  4NHJ A;  1T33 A;  2J5P A;  4JYK A;  4C2U A;  2LC2 A;  2HKX A;  1QBJ A; 
#chains in the Genus database with same CATH homology
 3OIO A;  2XSD C;  1F43 A;  4MIM A;  1JTX A;  3B6A A;  1MBJ A;  5K7Z A;  3JR9 A;  3GTM J;  2ME6 A;  2VI6 A;  4JX5 A;  2DA5 A;  4DZP A;  1HOM A;  3JRF A;  2NOG A;  5F0F A;  1OCT C;  1QVU A;  2EZK A;  2EZL A;  1WCM J;  3D1N I;  1HCR A;  4B4C A;  4XIC A;  2PMZ N;  2E2H J;  5F04 A;  5J1U A;  4IHX A;  1ETQ A;  4IEJ A;  1K83 J;  3LSJ A;  4D5F A;  2FD5 A;  5M3F J;  2VKV A;  3ZOB A;  3Q0V A;  5C4J J;  4NDL A;  4MO7 A;  3Q3S A;  1BL0 A;  2CQX A;  1B8I A;  4A3K J;  4M6V A;  1PUF B;  3FK6 A;  4IHW A;  3MVP A;  4BBR J;  4LOC A;  5FKN A;  5J3L A;  2ME0 A;  3QPS A;  4FCY A;  4A3B J;  1ETW A;  1G2H A;  1ZK8 A;  3HBL A;  3OSG A;  3I4N J;  3HGG A;  1HDP A;  2IEK A;  3ZQC A;  2LP0 A;  4AYB N;  2CUE A;  1TWH J;  2R0Q C;  3OOU A;  1RET A;  1FJL A;  2O7O A;  1MH3 A;  1MSF C;  1H88 C;  4CYC B;  2IAI A;  1GDT A;  1Z77 A;  1LFB A;  1I3Q J;  4Y7N J;  2YS9 A;  1ETO A;  5EGO B;  1JKQ C;  3HDD A;  5IPA A;  1A5J A;  3B6C A;  1JKO C;  2AHQ A;  3NAR A;  1X58 A;  1B8I B;  2RAE A;  1WH7 A;  5F08 A;  3SJM A;  1JT0 A;  2L7Z A;  3GBG A;  4FE4 A;  5IP6 A;  1WPK A;  3BR5 A;  3DEW A;  1Y1W J;  1R9T J;  2KDZ A;  1JGG A;  4C3I J;  2TRT A;  4A3F J;  4A3L J;  2FX0 A;  3S1R J;  3NAU A;  4XRS A;  1TWG J;  4X1E A;  5HOD A;  2CU7 A;  2ECB A;  3JRE A;  1QVT A;  2GBY A;  1ENH A;  4G12 A;  3JRG A;  1LE8 B;  3BT9 A;  4QTR A;  2FJ1 A;  1MBG A;  2MG4 A;  2DJN A;  4DZJ A;  2ID6 A;  2LTP A;  4DYC A;  1U78 A;  2DA2 A;  3BQZ A;  3RZO J;  2OPT A;  2HDD A;  3BR2 A;  5GPC A;  1NK2 P;  1YRN B;  2B63 J;  2EZH A;  2LLK A;  3LOC A;  1RPW A;  1UG2 A;  1WGX A;  2COB A;  3TW6 A;  2D5V A;  3F0C A;  3PO2 J;  3ZQH A;  2DA1 A;  3OSF A;  3SFI A;  3A03 A;  2WB1 N;  4A3C J;  2HOA A;  5IYD J;  4L5E A;  1K61 A;  2E2J J;  4M3B A;  3IH3 A;  4BKX A;  1FIP A;  3BQY A;  4EEF G;  2DTZ A;  4MFD A;  3HOX J;  1W0U A;  5J1Y A;  4AUX A;  1JUP A;  4W1U A;  1B72 A;  3QPL A;  1IUF A;  5EYR A;  3TW7 A;  4I6Z A;  4FE7 A;  1IDY A;  2ID3 A;  5IP7 J;  4GFB A;  2GM4 A;  2Y9Y A;  4M3E A;  5J1R A;  1DU0 A;  2JA7 J;  2AO9 A;  1FTT A;  3GTK J;  2LK2 A;  1JTY A;  2WAQ N;  1D5Y A;  2XGD A;  1HDD C;  4BXX J;  4M3F A;  2MGQ A;  3BR6 A;  2I10 A;  1WI3 A;  2LFB A;  3TED A;  2HOT A;  1H8A C;  2L9R A;  5EEA A;  4BBS J;  1SAN A;  1TC3 C;  3M4O J;  1LFU P;  2CJJ A;  4XID A;  5FKM A;  1I6H J;  4XK4 A;  1S7E A;  2DMT A;  3DCF A;  5FKK A;  4JP0 A;  1Q1V A;  2DMN A;  2K40 A;  3CDL A;  1AKH B;  1GV5 A;  4UUS B;  4ABZ A;  2E1O A;  1P7I A;  3S15 J;  3HEF A;  4A3M J;  3S1Q J;  3UKG A;  3HGY A;  3S16 J;  2R5Y B;  4X6A J;  1ZR4 A;  2HXO A;  2H8R A;  3ZQF A;  1VI0 A;  2W48 A;  2XGC A;  1BA5 A;  1B72 B;  3GTG J;  4B3A A;  2JN6 A;  3WHB A;  1CQT A;  3RKQ A;  1FTZ A;  3SDG A;  3S2D J;  1WH5 A;  2MSY A;  1MNM C;  3VPR A;  4FTH A;  1RKW A;  2M8G X;  5IOZ A;  5IYB J;  3S17 J;  1POG A;  2K9N A;  1JUS A;  5DS9 A;  1F36 A;  1MSE C;  5FJ8 J;  3S1N J;  3Q0W A;  1UMQ A;  3I4M J;  5IP9 J;  1IRZ A;  4MLO A;  3RZD J;  5M5W J;  5C44 J;  1ITY A;  5K7F A;  2VKE A;  2NS7 A;  3IH2 A;  3ZQL A;  1ETX A;  3PM1 A;  4DYQ A;  3QQA A;  2M0C A;  1NK3 P;  1VF9 A;  3JRH A;  5F27 A;  9ANT A;  1JKP C;  2Y0S N;  1LE8 A;  3WHC A;  3W6V A;  3H3V K;  1MBK A;  4A3I J;  4DYR A;  1JKR C;  1QRY A;  5JLX A;  2E2I J;  2HXI A;  4HNV A;  1ZTR A;  5F1J A;  4UUT A;  3ZQG A;  2IBD A;  2NVT J;  4A93 J;  2YU9 J;  5FLM J;  4A3E J;  1DU6 A;  2JWT A;  1ETK A;  2X6O A;  1ZR2 A;  2HI3 A;  1IC8 A;  2O8K A;  4Y52 J;  3TP3 A;  5E3L A;  5FKO A;  5EGO A;  3JRB A;  4B1R A;  3S14 J;  5IOY A;  4QSH A;  2MW8 A;  1SFO J;  3PO3 J;  2G0E A;  2OF7 A;  1Z0X A;  3LSR A;  2GLO A;  2LVS A;  2QF7 A;  3HOZ J;  2L0K A;  2JJ7 A;  1AKH A;  3HOV J;  2L7M P;  2L7F P;  1BJZ A;  3FKI J;  2XGE A;  4C3H J;  2R7Z J;  3IV5 A;  1ETY A;  2DMU A;  3GTJ J;  3C2B A;  4RBO A;  3HOU J;  3JRI A;  1XC5 A;  5E3M A;  3MN2 A;  2DA4 A;  2XPU A;  2NVQ J;  4D5C A;  1IG7 A;  1OCP A;  1QPI A;  2CUF A;  5EF6 A;  3IH4 A;  2JMW A;  3K7A J;  1U9N A;  1JUM A;  3BTL A;  5K7H A;  2K9S A;  3BG9 A;  4RDU A;  1JJ6 C;  2R5Z A;  1RR7 A;  1ZGW A;  2JA6 J;  1VND A;  4D7N A;  1TWF J;  4A3G J;  4S0H B;  3BR1 A;  1Y1V J;  5GPA A;  1TWC J;  4A69 C;  4C3J J;  4M3G A;  2EZI A;  2R5Y A;  2X9D A;  3FIW A;  1RES A;  2N8G A;  1APL C;  1ETV A;  3JRA A;  1RKT A;  4I76 A;  3GTL J;  2Y9Z A;  2O9L A;  1BW5 A;  1X2N A;  2DA7 A;  2NS8 A;  2M2E A;  4JX4 A;  2LR8 A;  1ZQ3 P;  1IGN A;  1BW6 A;  4M3D A;  1HLV A;  5FKL A;  3GTQ J;  3JRD A;  5E3N A;  2P81 A;  5F0C A;  1O4X A;  2DN0 A;  2Y31 A;  3H0G J;  4DW6 A;  3FIS A;  2YUS A;  4D7M A;  4J19 A;  1GT0 C;  2JA8 J;  1TWA J;  3BR3 A;  3S1M J;  1ZKG A;  3BTI A;  2XB5 A;  2XPV A;  3LSP A;  3A02 A;  1T56 A;  3S2H J;  1P7J A;  3CMY A;  4A3J J;  5M3M J;  3HOW J;  4V2G A;  2X48 A;  2ZB9 A;  5EG0 A;  3L1P A;  2HQ5 A;  3CQZ J;  1MBH A;  1OFC X;  1FEX A;  1MBF A;  5C3E J;  2QCO A;  3LSG A;  4AC0 A;  3MKL A;  3O8G A;  3RQI A;  3O8H A;  4W97 A;  3HKZ N;  1U9O A;  2M9H A;  2E19 A;  2EH3 A;  2M34 A;  2ECC A;  3Q0U A;  1GVD A;  3A01 B;  2WV1 A;  1MBE A;  2EQR A;  1XG1 A;  1AHD P;  3BG5 A;  2CQQ A;  3LNQ A;  2VPR A;  5DTD A;  2DMP A;  4BY1 J;  1OJL A;  1UHS A;  1A6I A;  3G1O A;  3BR0 A;  5F0H A;  2LY9 A;  3K2A A;  4IHY A;  3G1M A;  2NVX J;  4XRM A;  4QIW N;  2JK3 A;  3BTJ A;  3GTP J;  4V2F A;  1E3O C;  5EZG A;  5EG0 B;  3GTO J;  3HOY J;  5GP9 A;  1ORK A;  5JLW A;  1YRN A;  2XB0 X;  1GV2 A;  2EBI A;  3ZQI A;  2DA6 A;  5BNG A;  2R5Z B;  2HOS A;  2XPW A;  2H1K A;  2Y30 A;  1VFC A;  2ELK A;  3CCY A;  5FLV A;  2NVY J;  1IDZ A;  3HM5 A;  1W0T A;  1AU7 A;  1IV6 A;  1GUU A;  1PUF A;  1NTC A;  3JRC A;  1IJW C;  2XRL A;  3E7L A;  3G1L A;  4BY7 J;  4FIS A;  2DA3 A;  2LD5 A;  4JX6 A;  5E3O A;  1HF0 A;  3A01 A;  2KT0 A;  4XRS G;  3FK7 A;  3TP0 A;  4C2M J;  5M5X J;  1FIA A;  3M3Y J;  5IYC J;  2JA5 J;  5C4X J;  2R93 J;  4CYC A;  1JJ8 C;  2DMQ A;  2TCT A;  1X2M A;  5M5Y J;  2Y2Z A;  1U8B A;  4IHV A;  3BTC A;  3HB9 A;  2FQ4 A;  1JT6 A;  4MFE A;  1EF4 A;  3BG3 A;  2K9Q A;  1H89 C;  5EZH A;  1MH4 A;  5EDN A;  2LKX A;  2CRG A;  4A3D J;  2VUM J;  2HYJ A;  1T33 A;  1I50 J;  4JYK A;  1XS9 A;  2R92 J;  4UUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...