3RZOJ

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3rzoJ00
1JUSA 2R0QC 4A3GJ 5C4JJ 2VPRA 4JYKA 5FJ8J 3BTIA 4BY7J 2VKVA 2JJ7A 2X48A 4G12A 2JA5J 2HI3A 2R5ZA 1ETKA 1QPIA 1ETOA 1GV5A 1UMQA 1Y1VJ 1BA5A 1RPWA 1IUFA 1ETYA 5F04A 5GPCA 4FE7A 5IPAA 2Y9YA 3VPRA 4M3EA 5EG0B 2Y30A 3HOYJ 4JX6A 2NVTJ 1W0TA 4M3BA 3BR6A 3I4MJ 1GV2A 1NTCA 3BQZA 5C44J 2LKXA 2RAEA 5EYRA 4XRSA 3F0CA 1I3QJ 1IJWC 1JKOC 4V2GA 3G1OA 5E3NA 1APLC 3OSGA 3S14J 4V2FA 4DYQA 1WI3A 1A6IA 4MFEA 2NVYJ 2MW8A 1Q1VA 3NAUA 3JRIA 1H8AC 2LP0A 2LVSA 1B72B 1LFBA 5EZGA 5M5YJ 4DYCA 2FQ4A 1DU0A 2M8GX 4I6ZA 3LSPA 9ANTA 1AKHB 1JJ6C 1X2MA 2DA7A 1IGNA 3ZQLA 2DMNA 4IEJA 2NVXJ 3FKIJ 3FISA 4XK4A 3ZQGA 2XGDA 4DZPA 4AC0A 1UG2A 5IP6A 3PO3J 2M0CA 1OCPA 1ORKA 4NDLA 3IH4A 3K7AJ 3QQAA 1Z77A 4QSHA 1JUPA 2NS7A 5EGOB 1IG7A 2LR8A 2LTPA 1ENHA 5GP9A 1AKHA 4W97A 5M3FJ 3HOXJ 3TEDA 1ZK8A 2R7ZJ 1QVUA 2QF7A 5E3OA 3JRDA 2CUFA 1FEXA 1WCMJ 2ECCA 2ID3A 1JGGA 2JA6J 1H89C 5K7HA 2XGEA 2L9RA 3BTLA 2ME0A 3K2AA 4IHYA 1MSEC 3BR2A 2NS8A 4MO7A 2DA2A 2IEKA 1JTYA 1RR7A 2MG4A 4S0HB 1GVDA 3S17J 3QPSA 3M3YJ 3QPLA 5DS9A 2EZIA 2KDZA 2DA5A 1I50J 2WB1N 4C3JJ 1POGA 1F36A 3TW7A 1GDTA 1JTXA 1W0UA 3H3VK 2R5ZB 5IYBJ 3BG3A 1P7JA 2K9SA 5JLXA 3BR1A 1S7EA 2ELKA 3PM1A 3BG5A 1QRYA 2K9QA 1IV6A 5F0FA 1YRNA 3S1NJ 2XB0X 1XS9A 1TC3C 2X9DA 1HOMA 2O7OA 1NK3P 2G0EA 1RKWA 2XSDC 1UHSA 4EEFG 1TWCJ 3S2HJ 3S15J 2DA4A 2L7MP 2HQ5A 3HKZN 2NOGA 2EZKA 2E2IJ 2H1KA 4LOCA 2JA7J 4A93J 1R9TJ 3JREA 2K40A 3DEWA 5C4XJ 4M3GA 1FTZA 5BNGA 2Y2ZA 4D5FA 3OIOA 2TCTA 2L7FP 3D1NI 2M9HA 1MSFC 3B6CA 5DTDA 2N8GA 5M5XJ 2Y9ZA 3C2BA 3FIWA 4A3MJ 5J1YA 3MN2A 5FKOA 2YS9A 2O8KA 5M3MJ 2CU7A 5J3LA 3IH3A 5IOZA 1XC5A 2FD5A 3DCFA 2YUSA 4A3JJ 2HOTA 4X6AJ 4DW6A 1BW5A 1BJZA 2GBYA 5EDNA 1U78A 4X1EA 3LSJA 1MBKA 3HGGA 2TRTA 2Y31A 1D5YA 3BT9A 4FE4A 4AUXA 1ZR4A 1LE8A 3FK6A 1Z0XA 2W48A 2CRGA 2P81A 3BR3A 2JWTA 1MBFA 5EEAA 2X6OA 4QIWN 2JN6A 5F08A 2DA1A 3S1RJ 1ETXA 1EF4A 3ZQHA 2CQXA 3MKLA 2R5YA 3LNQA 3LOCA 5E3MA 4IHWA 2HXOA 4I76A 4A3IJ 3GTOJ 2HXIA 1IRZA 1SANA 4JX5A 3HBLA 5IYDJ 1RKTA 2DMPA 1ETVA 1FJLA 1JKPC 2HDDA 1MH3A 3Q0VA 2CQQA 5IP7J 2EZHA 4D7NA 1LFUP 2K9NA 3ZQFA 4A3KJ 1JKQC 3OOUA 1CQTA 2CUEA 4L5EA 2CJJA 1RESA 3BG9A 5IP9J 4A3LJ 2ECBA 3ZQCA 2XPWA 1G2HA 2IAIA 3BTJA 3E7LA 4Y7NJ 2B63J 2VUMJ 3A03A 2DN0A 1AU7A 3SJMA 1YRNB 2HYJA 2LFBA 4A3EJ 1HLVA 3PO2J 2XPUA 3O8HA 1IDYA 4J19A 1Y1WJ 2DTZA 1TWGJ 4A3BJ 2FJ1A 2E2JJ 2ME6A 1BL0A 3JRCA 2XPVA 3WHCA 4C2MJ 1IC8A 1B8IA 4A69C 1ZQ3P 3BQYA 1ZR2A 2DA3A 2GLOA 2COBA 4UUSA 3CQZJ 3GTLJ 4XIDA 1T33A 5EF6A 3HOUJ 2DJNA 2Y0SN 4BXXJ 2MSYA 2HOAA 2M2EA 5FLMJ 1ZKGA 3W6VA 3Q3SA 1FIAA 2AO9A 3S2DJ 2E2HJ 2DMUA 4D7MA 4MFDA 3SDGA 2R92J 2XRLA 2JK3A 1JT0A 4C3HJ 1IDZA 2QCOA 3JRHA 2ZB9A 4HNVA 1MBGA 2L7ZA 1WPKA 4B1RA 3JRAA 2E19A 3B6AA 5K7FA 4RBOA 2DA6A 1X58A 2FX0A 2VI6A 5FKLA 4FISA 1RETA 1JT6A 2OF7A 2NVQJ 1VF9A 1JJ8C 2IBDA 4FCYA 3LSGA 3G1MA 3A02A 4BY1J 3M4OJ 4JP0A 3LSRA 3JRBA 2DMQA 1LE8B 2R93J 3RZOJ 4QTRA 3HEFA 3SFIA 3TP3A 5F27A 1HDDC 4XICA 1ITYA 2LD5A 3RKQA 4B3AA 1HCRA 2OPTA 1WH5A 1U9OA 5IYCJ 2EH3A 1SFOJ 3RQIA 2R5YB 4MLOA 1P7IA 5M5WJ 3S1MJ 3Q0WA 1DU6A 4DYRA 4BBRJ 3WHBA 1GT0C 3ZQIA 5FKNA 1PUFA 1H88C 1MBHA 3CMYA 1FTTA 3H0GJ 4A3FJ 4MIMA 5HODA 2I10A 2JMWA 1T56A 3HM5A 1ETQA 2LK2A 1HDPA 3HB9A 2LY9A 4AYBN 2H8RA 4M3FA 1TWFJ 2O9LA 3L1PA 3JRFA 1XG1A 5EG0A 4JX4A 2GM4A 4M3DA 4BBSJ 1F43A 1K61A 3CDLA 1OCTC 1ZTRA 5F0CA 1TWHJ 1VNDA 4C3IJ 1AHDP 4IHVA 3TP0A 3BR0A 3HOVJ 3S1QJ 5J1UA 4B4CA 3GTJJ 3HDDA 1X2NA 5K7ZA 1HF0A 2VKEA 1ETWA 2HOSA 4CYCB 2M34A 4A3CJ 2KT0A 3BR5A 2DMTA 4XRSG 1B8IB 4BKXA 3TW6A 3FK7A 4UUSB 5C3EJ 3Q0UA 1MBEA 2D5VA 2PMZN 4A3DJ 1B72A 3MVPA 1NK2P 4Y52J 1K83J 4IHXA 2E1OA 2XB5A 2L0KA 1QVTA 3RZDJ 2EZLA 4RDUA 3GTQJ 3GBGA 1JKRC 3UKGA 2YU9J 5EZHA 3NARA 1E3OC 5JLWA 3GTKJ 2JA8J 4CYCA 1MNMC 2AHQA 4XRMA 3HOZJ 3GTGJ 1MH4A 1I6HJ 4GFBA 1OFCX 1OJLA 3A01B 5EGOA 5FKKA 3OSFA 2EQRA 3HGYA 3ZOBA 2WAQN 3S16J 1GUUA 2LLKA 5GPAA 1ZGWA 5F1JA 3O8GA 5J1RA 4D5CA 4M6VA 4UUTA 1VFCA 1WH7A 3IH2A 3JRGA 3CCYA 5FKMA 2ID6A 5E3LA 3I4NJ 1MBJA 5IOYA 3IV5A 1BW6A 3BTCA 1VI0A 1WGXA 3GTMJ 2MGQA 4W1UA 1TWAJ 1FIPA 3G1LA 1U9NA 3JR9A 1A5JA 5F0HA 4ABZA 4DZJA 3A01A 2WV1A 2XGCA 1JUMA 4FTHA 1O4XA 1U8BA 3GTPJ 3HOWJ 5FLVA 2EBIA 1PUFB
chains in the Genus database with same CATH superfamily
2ISYA 3RI4A 1VQ9I 2VXZA 4IZZA 1BJAA 3A1YA 3BTIA 4BY7J 2VKVA 1SVMA 2X48A 2QVOA 3W2VA 4RB1A 2H27A 4BACA 2HI3A 3OWTA 5BS6A 2KL4A 1ETOA 1GV5A 1QPIA 2NRAC 1RPWA 5KNLA 3FMQA 2DPDA 5F04A 5GPCA 2X6YA 1G8XA 4FE7A 5IPAA 2WWYA 2Y9YA 4OAYA 1WJ5A 2BGCA 2BY2A 4QPQA 1IO2A 1QPMA 4M9ZA 3I4MJ 3SYTA 1ZN2A 2F2EA 5C44J 1ZLKA 5EYRA 2O0YA 2GOXB 3E5XA 5JI6A 3GX4X 1CF7B 2EV6A 1JKOC 2BXZA 4I01A 3J7AY 3RYPA 1APLC 3GYHX 3S14J 4DYQA 5L3GA 3KCCA 1MJBA 1WI3A 2NVYJ 5LBQA 1Q1VA 4I2OA 4A5NA 2KFDA 2LP0A 1B72B 1J09A 4I98B 4KT5C 5LGUA 3EDPA 1IV8A 4JQFA 2YR2A 9ANTA 3CJTB 2IXSA 4TV7A 3HRTA 1JJ6C 4UB6C 3AL0B 2L9VA 1XGOA 1IRFA 5LHGA 1IGNA 1N77A 1JHHA 3ZQLA 2DMNA 5L3DA 5J8CA 1YLFA 3AG1H 1FOWA 1CGPA 5D8LB 4PGGA 4Y17A 1YW9A 3QOPA 4NDLA 4F93B 1XGMA 1JUPA 2NS7A 3F21A 3P5JA 1ENHA 2W25A 4A0YA 2BW3A 2DFIA 3KEOA 2KZGA 3DEEA 1QVUA 2QF7A 4KJZA 2L54A 1K7AA 3LSKA 1WVRA 3I55I 4LG3A 4Z2YA 2VN2A 2OTJI 1H89C 2CV0A 2E7XA 5K7HA 2Y75A 2JRMA 2L9RA 3DBRB 1YQAA 1A04A 2ME0A 3OYHA 1XSVA 1SMTA 3H1CA 2FUG2 2K3FA 3A0BC 4D1QA 4AIJA 2NS8A 2IA0A 4KNYA 1JTYA 4IVNA 2LY2A 2X51A 2MG4A 3FXRA 3RYRA 1MKMA 1A31A 2R7UA 4KIBA 1GVDA 1WJCA 3CUOA 4PZJA 2QQAA 4E6KG 1SFXA 3EUKL 2H6CA 3DLAA 2EZIA 2DA5A 1I50J 2WB1N 3SEQA 4C3JJ 1POGA 2OC6A 5JVGF 1F36A 5D4SA 4OU0A 1JTXA 2NXNB 3MD2A 1IN8A 2ZNYA 3WODF 2EA4A 2Z3YA 5JLXA 4II2A 1V54H 3PM1A 2JPCA 2Z1DA 2ELHA 2DI3A 1XS9A 4IHTA 3ZQQA 2VC1A 1V4RA 1TBXA 2M45A 3B73A 2RC4A 3CO6C 2O7OA 2QQBA 4E7HA 4PUSA 3C1DA 1UHSA 3K1MA 4EEFG 4J01A 3D5LA 4B47A 1TWCJ 1V3FA 4QPOA 3O2PE 3V7CA 1P92A 4BEHB 1X1DA 4KIGA 3DF8A 3ELKA 2HQNA 2NOGA 4B09A 4KN4X 3QAHA 4IXAA 3R6SA 4PSWA 2FSWA 1EH8A 3H9GA 3NQOA 3OYAA 3HOSA 5C4XJ 5DDGA 1UB9A 4D5FA 3KZYA 4AWXB 2MABA 2L7FP 4AD9A 2VLAA 1ZARA 5L3CA 2HKXA 2KQRA 1O57A 3ASOH 5M5XJ 5TISC 2Y9ZA 3ECHA 3C2BA 2D1HA 4HLYA 2H94A 4A3MJ 1LDDA 4N4OB 2CV2A 4A5MA 4U87A 3HXLA 3RPUD 3FM5A 4E7IA 2M87A 4LB5A 4ETSA 2FD5A 2Q2EA 4M73A 4RAYA 1H9GA 3E6BA 2ICWG 3DV8A 1Z3YA 4HPQA 4X6AJ 2NAZA 5ILUA 1BJZA 4KISA 3FZVA 1QQIA 2OJED 2Q1ZB 3DU5A 4BL0B 1SEUA 1U78A 1GHCA 1V5GA 2LKPA 4P5OA 2TRTA 1MW7A 1IAWA 2JUCA 2Y31A 4BH9A 2M5WA 4AUXA 3CP2A 1Z7LA 2H6BA 3FMSA 2XAFA 2CFXA 4BXFA 3FK6A 1L0OC 2A6TA 5DUIA 5HOOA 5H20A 2CRGA 2D1VA 3WE2A 2F5EA 3AG2H 1ZHFA 1MBFA 3FXQA 1USTA 2A07F 2X6OA 1KU2A 2JN6A 2R4GA 1ETXA 3R0AA 3CCSI 4L18B 3OYJA 1RUNA 2CW7A 3GZ6A 2BVLA 3C18A 3U9GA 3LOCA 1C0WA 3MAJA 2G9WA 5D5VB 2ZMEA 2BZTA 4A0ZA 2HR3A 4JBAA 1X3ZB 1NHAA 3HSEA 3WU1B 1MMNA 2L2OA 1IXCA 2OA4A 1RKTA 1RR8C 1TT0A 2DMPA 1ETVA 2XAHA 3ABUA 3KE2A 2DYRH 3ZMUA 2HDDA 1MH3A 4IRIA 1R00A 2HPMA 1MD0A 3ZQFA 5D4RA 1W4MA 2UWMA 2CUEA 4L5EA 1VZ0A 1K79A 2DTRA 3BG9A 3WTZA 5GTIC 2LYCA 2UXNA 4EMSA 1G2HA 2XPWA 3BROA 2IAIA 1Z1DA 2JSCA 3BTJA 4Y7NJ 3LSHA 1V5FA 2VUMJ 3UR3C 2FNAA 1I3AA 3A03A 3K69A 4FHTA 4Q47A 3LAPA 1QBJA 1YRNB 4BQOA 5E8GA 2DQLA 3E3VA 3RPUA 4XLHA 2XIGA 4IX7A 4A3EJ 1D1CA 1MMGA 2K02A 3PO2J 3W6JB 3J81Z 1IDYA 2DOAA 5AONA 1VQ7I 4L9JA 5DM6F 4A3BJ 2E2JJ 3FXOA 2PQ8A 5J4VA 4BDYA 2ME6A 1BL0A 3BP8A 4JK1X 3JRCA 4HNUA 3OYKA 4C2MJ 1IC8A 4RAZA 2VE9A 1HW2A 2GLOA 4XLCA 4Y13A 1T33A 4KT6A 2KMUA 1FMWA 4CA0A 1A36A 2NNYA 4BXXJ 3QYFA 2GZWA 3E6CC 2HOAA 4BNCA 2VJ4A 3HUGA 1DPRA 2HDCA 4Y33A 5GADJ 2AO9A 1HSJA 2XDVA 4IOAF 4KDPA 2R92J 4C3HJ 3RQ4A 2LNBA 2OQRA 4HNVA 3A0HC 1WFXA 4ZJZA 1U8RA 4B1RA 2E19A 2RVCA 3ULQB 2DA6A 1X58A 3V8JA 4B44A 4Y3OA 4ESBA 5IT9Z 1K78A 4FISA 2VOOA 1RETA 3R60A 1UAAA 1VF9A 5EJCA 2BE5F 4F52A 4ZTJA 2IBDA 4NC7A 1YTYA 4EGZA 3LSGA 3P7NA 2BYVE 4IQ4A 2ETHA 1D1BA 3G1MA 3GVAA 1ZRDA 1LE8B 2VT2A 1X4PA 2HOEA 2OCEA 2CS3A 3Q5FA 2R7TA 1B6AA 3FDYA 2XASA 5F27A 1O3QA 3CMMA 3WGGA 1O3RA 3RKQA 1SD7A 1R1TA 2OPTA 3OIQA 5IYCJ 3ESWB 2CG4A 2G7UA 3RQIA 1L3LA 3S1MJ 3K4BA 4OWRB 3KP2A 4BHCA 3RCOA 4CCOA 3KEQA 3V4GA 1H88C 4N4NB 3HOTA 2ZNZA 3ZMSA 2WADA 1IXSB 2QBYB 4A3FJ 2VONA 3MCZA 3MFKA 2F48A 1Y8RB 2Z2SB 1G3TA 2LREA 1TL8A 3X2QH 4CCJA 2A5WA 5BPDA 2LK2A 2H8RA 1QU3A 5HS8A 3DTKA 3JRFA 5EG0A 3SDBA 5AIPA 4M3DA 2E34A 3K4NA 4BBSJ 1S7OA 3CDLA 1ZTRA 3LMMA 4C2UA 1QGPA 4B4CA 2HU9A 4IOCF 3NRVA 1HF0A 2PJRA 2XAQA 2IGNA 1XDUA 2HOSA 3F8NA 3ZP5A 2KT0A 4NHJA 4HZFA 3MKYB 4BKXA 2KZVA 3HRUA 3CJRB 5GAHJ 2G7HA 3FK7A 4WF2A 5GAEJ 1H0MA 2D5VA 3IHUA 4A3DJ 3MVPA 1NK2P 3K4JA 1FC3A 2DO7A 2E1OA 1ZREA 2ZSHB 1VQOI 3GBGA 2LDUA 3UKGA 2FBIA 1HXDA 2JPBA 3NARA 2V9VA 1AWCA 2GWRA 5JLWA 1FBUA 2EFOA 1HW5A 2FBKA 2P5KA 3HZJA 5FD5A 4CGZA 4G9YA 4ON0A 3I4PA 1GLNA 2AHQA 4BE1A 1MNMC 4XRMA 3D5RC 2XC7A 3CCVI 1KQ8A 3A01B 5EGOA 5CKTA 3F6VA 2EQRA 4UNOA 2HS5A 1UG0A 3RTRA 2FMLA 1UZCA 2LLKA 3I59A 4UHTA 1ZELA 5F1JA 3O8GA 1E3HA 5J1RA 2VBXA 4UUTA 1T6SA 1D8JA 1MNDA 2RNJA 3QU3A 4ZZLA 3MMYB 3JRGA 3I4NJ 1LPQA 5IOYA 1LEAA 4I99C 1BIAA 1VI0A 4FT8A 2IP2A 2MGQA 2MLKA 1RNLA 4L5IA 3DKWA 4RGUA 1ON1A 4I02A 5F0HA 1PVEA 4KIFA 4X0GA 4Q4ZF 3A01A 2B0LA 1DGRM 4DNCA 3SEZA 1U8BA 2AS5F 2X1DA 4EJWA 5FLVA 4UV9A 1PUFB 1FPQA 2VKHA 1JUSA 2LH9A 1TZLA 3I54A 4G7HF 1U2WA 4ZZDA 4F3QA 2OQGA 3ASNH 2R7RA 3CCEI 3RDIA 1XPXA 1T98A 4FX0A 2GXGA 4ZYEA 1YFHA 1XSDA 4NNJA 1MDMA 1XMXA 2DOEA 3D5SC 4ESJA 1IW7F 3TOAA 2F5VA 4WXDA 3ZGKA 1YHQI 1IZ1A 5IY5H 5BMZA 4N9IA 3SZTA 3GZ5A 2AQFA 3P9CA 4OMZA 1X1CA 4JX6A 4BHPA 2NVTJ 1T95A 5F6FA 2F6CA 3I5UA 1BOAA 2LF7A 4HF2A 5E1WA 3OYGA 2VJIA 1YG2A 1G6NA 2X4HA 3CESA 4LJZF 4WK8F 1IUYA 1D0XA 1YJWI 1N75A 4IL6C 3CP8A 1R58A 3PFYA 4KN7X 4R8HA 1I3QJ 1SD6A 4DBQA 1Y56A 5H6RA 2QEXI 4LGWA 1KA8A 3OSGA 3ZR8X 1B9NA 1A6IA 4CO8A 2MW8A 4PSXA 4KYWA 2LVSA 5HS7A 5EZGA 1BI0A 2F5CA 5F64A 4LITA 3ECOA 4A6EA 1P2FA 5ILSA 2KJBA 3EPZA 2FE3A 1Z91A 2DA7A 1S8NA 1W7PD 3M1EA 1MMSA 3RKYA 2R7OA 3FKIJ 3IWZA 4E7LA 2M0MA 3FISA 4XK4A 2XGDA 3GXOA 4HA8A 4AC0A 4DZPA 5IP6A 1LQ1A 2M0CA 2VPLA 1OCPA 1FLIA 3PIPF 3R4KA 4BXUA 5J40A 3F22A 4XL9A 2LR8A 3LFKA 5B66C 2JTVA 2NS0A 3FBIB 3RPQA 5K1YA 1YIOA 4N0BA 1WJBA 5LFAA 5M3FJ 2R7ZJ 2M30A 4UVCA 5B1AH 4EGYA 3BDDA 1ZG5A 1WCMJ 2CFOA 2ECCA 4XLEA 3QRFF 2RNGA 2BHYA 5E1XA 1FP1D 4HQMA 2JA6J 2L4AA 3TGNA 3B02A 3ML6A 1E0EA 3J7ZI 2XGEA 2EA2A 2YX7A 1D0ZA 3HRMA 3BTLA 3MWMA 4NUBA 1E17A 3K2AA 4IHYA 4Y15A 4IJAA 3GEZA 2ZFUA 2ZMEC 3BR2A 1OYWA 4MTEA 2DA2A 4UVAA 4HLXA 2ZO4A 5J8FA 4ITVA 1J2XA 4PCQA 2CQKA 2WC2A 1WI9A 3U2RA 3S17J 3FHNA 2PJPA 2X1EA 3M3YJ 3GZNB 3CMAI 3CLQA 3QPLA 2JQ7A 2KDZA 1I27A 2EFPA 4HV6A 3ZMTA 2KIUA 2H8WA 1LB2A 1EA3A 2F4MB 3KP4A 5IYBJ 1FMVA 4KICA 3BZCA 4M9XA 4Z6YA 2A69F 2MLGA 3RKXA 2KISA 1R1VA 3KETA 1W7PA 2K9QA 2VBWA 3H3ZA 5F0FA 2XB0X 4XQFA 4XSXF 2P4WA 1FSEA 2R7DA 4OINF 3V7RA 1SD4A 5ICCA 2X9DA 2QSHX 5JFRA 1G59A 1NK3P 3PNTA 4LK1F 2O5RA 4XNFA 4UUVA 4D9JA 3ZMDA 5LLQA 1IF1A 1NH3A 2M7AA 1U5TA 2DA4A 3DKXA 1QZEA 3CUQA 4CZCA 1LJ9A 1TLHB 3KYDB 3CCRI 3I58A 2E5NA 3AAFA 4G94A 2H1KA 2JA7J 3JREA 1B59A 3DEWA 4HBLA 2DAOA 2ZJ2A 4XM3A 2Y2ZA 3I0TA 5DEQA 3OIOA 5DTDA 4MHGA 1QA6A 1FT9A 3H36A 1VQMI 1R1UA 2Z16A 4ZDPA 2ZJPF 1SFUA 5FKOA 5K5QA 3CMEI 5M3MJ 1YOVB 5IOZA 3K6GA 4OIOF 1XC5A 1KU3A 4F91B 3OYFA 1A6QA 1FSHA 3GLXA 3OL3A 4RAFA 4DW6A 4EQQA 1BW5A 1F9NA 4RGSA 2EV5A 3M1CA 3LSJA 1MBKA 2DT7B 2MD5A 3CDHA 3ABLH 3DPTA 2IGMA 4L5JA 3BT9A 4FE4A 1VQPI 5L3EA 2BW3B 4EJVA 2O8XA 3DP7A 3DTEA 3BCAA 3L2RA 1UCRA 5HDNA 1UHMA 1E2XA 2P6TA 5EEAA 1PJRA 3FXLA 4QIWN 1G4DA 4P9FA 1OQYA 2RDPA 1OCOH 3TO7A 1SC7A 3MKLA 5E18F 2R5YA 3G4SI 4IHWA 4A3IJ 1D0YA 4LD5A 1IRZA 3IKVA 3M8EA 5TJJA 2AQEA 5HDKA 2KP6A 4HF1A 3VFZA 1FJLA 1J75A 1IN5A 3I53A 3OL4A 3OR1C 1R22A 2KPMA 4D7NA 1LFUP 2X85A 3GO5A 1BR1A 5JHUA 2A68F 5D5XB 4FQGA 3TL4X 1CQTA 2XUBA 1TQIA 1ONVA 1RESA 4AIHA 3CO7C 2A6EF 2ZKZA 3C7JA 2ECBA 4KMFA 3T0YA 4ZC3A 3COAC 3ZN0A 2PI0A 3KFWX 3H9QA 2ZBKA 2HYGD 3FXJA 5H2FC 1I39A 2K4JA 2HNHA 5D6FA 2BY3A 2LFBA 1X1PA 4XKWA 3OS2A 3MKZA 1HW1A 2XF6A 3O8HA 1Y1WJ 1R4NB 5E20A 3J7AO 5IT3A 3J80K 3H3UA 4AVPA 4E7SA 3S8PA 4OOIA 1B9MA 1WJAA 5KAIC 3WHCA 2PMUA 3E6DA 2COBA 4UUSA 3GTLJ 5E1ZB 4XIDA 5EF6A 5E8IA 3ABKH 2K7LA 3HOUJ 5B5EC 2CW0F 4I0AA 2DJNA 4RGRA 3QOEA 4GGGA 3VWBA 4UXNA 3WTXC 3DLLF 4ENKA 2MSYA 4ZH4F 2M2EA 1BR4A 1EJ9A 4RM2A 5DCMB 6PAXA 1J9IA 2DMUA 2BVMA 1XMAA 3CCQI 4D7MA 1J5YA 1S6LA 2XRLA 1YE9A 3QPHA 1BIBA 1QHGA 4MQVA 1JT0A 3JRHA 1S3JA 4HDVA 1MBGA 2E71A 3CCJI 3CDIA 3F23A 2ZXWH 3B6AA 4RBOA 2COMA 4GDFA 2OV7A 1FWZA 2Q2EB 2V1NA 2CWEA 3VOEA 2XVCA 4PFOA 3KP7A 4ASNA 1JJ8C 3MQ0A 4FCYA 4PJJA 1SAXA 4IHSA 4YIRX 2JVHA 5D5UB 3BWGA 3M4OJ 5DCMA 3RKWA 3LSRA 2J5OA 2DMQA 3JRBA 3N4MA 2QUFA 1JE8A 2R93J 4QTRA 2QKLB 3GUDA 1G3SA 3H5RA 1UJ8A 1PUEE 1EH7A 3LA3A 3F6OA 4B3AA 4I09A 5LRRA 3WTVC 2OCCH 3CD6I 1YS7A 2EH3A 2PLYA 2L9SA 1OYIA 3RJPA 4FETA 4NQWB 4RMNA 3L09A 5A2QK 3TOBA 1P7IA 4CCLA 4U7BA 4DYRA 1OR7A 4EVIA 1DU6A 2LY1A 2ZMEB 3WHBA 3QP5A 2QLZA 1GT0C 2IGOA 5FKNA 3L2UA 2CO5A 4YRVA 5LD2C 2UZKA 1MBHA 3BPVA 1N25A 2GA1A 3WTWC 1XSXA 1HKTA 3H0GJ 2VC0A 4MIMA 3VODA 2GA2A 3L00A 1DPUA 4V19K 4XLAA 2ZJRF 2AXTC 1FYLA 3W2AA 2RKHA 1HKQA 2QENA 3HM5A 1J0RA 2LY9A 4NQWA 4XKBA 1XTAA 4M3FA 3L2VA 1ZYRF 4S05A 4O3MA 1ZGAA 1BOBA 4XOTA 2MH9A 1XG1A 3LA7A 1FZPB 1LEBA 4JX4A 2GM4A 1XCBA 1FP2A 2EFWA 3JSOA 2ISZA 4C3IJ 1TWHJ 3MZYA 1AHDP 4IHVA 5LGTA 2V7FA 3BR0A 2AXLA 5FB2A 1WRJA 2P7VB 3TKYA 3MKWB 2XV4S 5CQEA 1B4AA 2VBYA 4CYCB 4E4HA 2M34A 1ZH5A 4A3CJ 1OCCH 3BR5A 2XF7A 4UB8C 3I71A 1PP7U 2DMTA 2J5PA 2LRDA 2VIXA 3TW6A 1KGSA 4H0EA 3DBLB 3IWFA 3QYBA 1K83J 2V4JC 2XROA 2RQQA 2XB5A 2HZDA 1O3TA 4I7HA 1M1EB 4A0XA 2BY0A 1JKRC 3HUGB 2VQGA 2YU9J 3G6EI 3HKZA 1E3OC 2NVUB 1X4OA 3VEPA 3JW4A 2P7CB 3H0DA 1FOYA 4CYCA 4BQNA 3G3ZA 2P5LC 1YX5A 5HS9A 1DUXC 3QWLA 3LQQA 2M4KA 1YIJI 5D8KB 1K78B 1OFCX 3QP6A 2E1CA 4MEYF 4UV8A 1RZ4A 5FKKA 3OSFA 2ADUA 4IF4A 5DUKA 4HEA2 3SQNA 3BCBA 3ZOBA 5GPAA 5TGTA 4B43A 2LOOA 3FF5A 4EM1A 2ESHA 4M72A 5HLHA 1VFCA 2LKSA 1WH7A 3IKTA 4YIFA 3HL2A 3IH2A 5LEKA 4DBRA 5FKMA 1MBJA 3IV5A 2H1LA 5KAFC 2GIVA 3VYTB 5GTHC 3GTMJ 2WA0A 5FO5A 1BN5A 1YI2I 2VODA 2HWVA 4ABZA 2L4MA 3A4CA 4DZJA 2W84A 1JUMA 1T08B 3GTPJ 1AOYA 1LVAA 1D5VA 5HDGA 3KP5A 4WWCA 4B48A 2R7WA 4A3GJ 3S32A 5C4JJ 5H6QA 2M1BA 2XAJA 4PJNA 4JYKA 4F7ZA 2ESNA 3OYIA 2QSFX 4BJ5C 1R4MB 2D45A 5K5RA 4D0PA 3H5AA 4GYIA 2OBPA 4G12A 3CLOA 2R5ZA 2NNNA 3HHHA 2JUGA 1ETKA 2LSOA 3CJNA 1BA5A 4H4KC 2IGKA 5EG0B 2Y30A 3HOYJ 3L2CA 2DFEA 1D8KA 3JAMK 4KMUX 4M3BA 4CH7A 3FXKA 5D5WB 4XRFA 3JTGA 1DGWY 2PJRB 5J4YA 1S7AA 2PMHA 2LKXA 1I1SA 5CVVA 4XRSA 1MZBA 1XGNA 2QSGX 1U5TC 2FA5A 1GVJA 3CUQC 1IJWC 3DBHB 3TMOA 3G1OA 5E3NA 3Q9VA 4L9VA 2M4GA 3UNGC 1RIOH 1Z6TA 2M3AA 4Y4RA 2OZUA 3MZ8A 1H8AC 1LFBA 5KHDA 3A2KA 2FQ4A 2L02A 2M8GX 5K5OA 1AKHB 1TW3A 4ESFA 1BR2A 5J6XA 2YU3A 1X2MA 1W5SA 4GYGA 4E70A 1YW7A 2YPRA 3ZMVA 3AFHA 1SAUA 5ED4A 4IEJA 2Y0SA 1J59A 3ERED 1J7KA 1I5ZA 4BUPA 3HHGA 4M9SA 1IN6A 1P6RA 2IS4A 3I3LA 1F5TA 1UG2A 1YJ9I 1DDNA 3PO3J 4FX4A 1JXSA 1ORKA 4AVZA 3IH4A 3QQAA 1Z77A 3P9IA 5EGOB 1LVKA 1UELB 3U1DA 5DD8A 1XGSA 3PQJA 3I59B 3WG7H 3H9JA 2VJ5A 4RB2C 4WXCA 4W97A 4F92B 1AKHA 3TEDA 4XR6A 1VQKI 4RB3C 5DM7F 1SFEA 3FX3A 2Z5UA 2PN6A 4A12A 1UHWA 3NWSA 2CUFA 1Z21A 3CC7I 4OIRF 1ZLJA 5EEHA 5FRNA 3BOQA 4HX8A 2LMDA 2XSJC 3WGIA 2I8DA 1BI1A 2CSOA 2ZXHA 2DOFA 5HNFA 4O5VA 3D0SA 1MSEC 4MO7A 1KZHA 3G71I 2QWWA 4AIKA 2P8TA 4LFUA 1RR7A 4C2TA 4DGWB 4IO9F 2ZXJA 1FYKA 3QPSA 4GRIA 2JSPA 1TNTA 2ZJQF 2FEZA 5DS9A 4E7ZA 2L5QA 3JCUC 4EATA 5BOXA 1W0UA 3H3VK 1MDMB 3OMYA 5KK1A 4G7ZF 2MD0A 3PUBA 2V9PA 4CCNA 2DXIA 3BG3A 1P7JA 2V26A 2K9SA 3KP3A 2ELKA 2X0LA 3BG5A 1QRYA 2EFQA 1S5LC 1IV6A 4BU2A 3KIOA 4OIPF 1TC3C 1T8IA 4XN3A 1KYWA 2XSDC 3OS0A 4AYBA 1SMYF 4NB5A 5CJ9A 4YFKF 2CYYA 2PEXA 3F8FA 3S15J 1FX7A 4HOBA 3SZPA 1BC8C 2BEOA 3LL7A 1A35A 2EB7A 2IJLA 2LF8A 4A2UA 2L7MP 2Y69H 2IA2A 5J47A 1ZAOA 4A6DA 3HKZN 3F3XA 4XORA 1D1AA 3F9KA 4A93J 2HTSA 3PFIA 3K70D 2DJIA 1KQ0A 4M3GA 1FTZA 2TDXA 1O7FA 1QZZA 3VYRB 4EJOA 4PDKA 3D1NI 3PSFA 4WXHA 4GO1A 3OV8A 3B6CA 3JTHA 4LB6B 2F5DA 1GXQA 2N8GA 3DFGA 2DT5A 3GLLA 3FIWA 3U1KA 2HTJA 3MN2A 2O8KA 1V5EA 2CU7A 2EIJH 3SZGA 1HC8A 5J3LA 1S29A 1XD7A 1B1BA 2QA4I 4HQEA 3MEXA 3DCFA 1BBYA 2A61A 2YUSA 3KLNA 1I6XA 2GBYA 3KZZA 1HQCA 2OU2A 5HLIA 1S9HA 3BJAA 3OR2C 1D5YA 4BE0A 3V8KA 4G6QA 4HF0A 4U0WA 4UVBA 1Z0XA 3KPHA 1G3WA 2P81A 1V55H 3KP6A 4ZYGA 1ON2A 1ZG3A 5D6EA 3WTYC 5E79C 2DK5A 2WAQA 5F08A 3GFIA 2DA1A 2F4OB 2JVGA 3GF2A 1ZGJA 3K2ZA 3ZQHA 1EF4A 1Z67A 2BY1A 2HQAA 2DLLA 3LNQA 4CICA 2HXOA 4I76A 2DT6A 3P9KA 4U0VA 1OR7C 4R79A 1RI7A 4RLFA 1DP3A 3F8BA 4JX5A 2FXAA 4RGXA 2BV6A 1MIJA 3ZXSA 5L3FA 3LSTA 5FLXK 1FYMA 4DQ2A 1MMAA 4EJTA 1TT5B 3PSIA 3Q0VA 3EYIA 2CQQA 4NC8A 2EZHA 2DCEA 1W36D 3OYMA 1JKQC 4WCGA 2M8EA 2CJJA 2X1CA 1ULYA 2MFZA 1IRXA 4XKVA 3K1NA 2K27A 3E7LA 3LQRA 1PP8F 1OMIA 3OYBA 1W7PB 1AU7A 3SJMA 2RN7A 4CHUA 3FWEA 5TRDA 3EUHA 3DEUA 1HLVA 1KU9A 2FF4A 5FROA 4J19A 3EETA 2DTZA 1VQ6I 5HLTA 2E1NA 2M7BA 4LG0A 4BQQA 3W6KB 3OYDA 1RUOA 3F8MA 4BAYA 1U5TB 3VSKA 1B8IA 4A69C 3F8CA 3CUQB 2DBBA 3BQYA 3HG9A 1ZR2A 1ZQ3P 2DA3A 4EJUA 4CCKA 1LDKB 2ZCWA 1N78A 3GCMA 4CYDA 2HDWA 3AKZA 2Y0SN 4L9NA 2DK8A 4WX9A 2KLOA 2GOMA 1SVLA 4ZDLA 2FBHA 2VOPA 2CGPA 5FFZA 3IAM2 3F72A 2OD5A 3S2DJ 2E2HJ 2RREA 2A5YB 2EFNA 4MFDA 3OYEA 4MEXF 2QCOA 4ZYHA 2E1MC 2L7ZA 1WPKA 2MC4A 3ZN1A 4LK0F 5K7FA 5CVUA 2WV0A 2LBFA 3ONQA 5FKLA 2BXYA 2VASA 2OF7A 1LFPA 3HJEA 4PJ0C 4YG2F 3PJRA 1OYYA 4HX7A 2O6GE 3BC8A 5ILVA 2GAUA 2FRHA 1Q1HA 2XKOA 2KRCA 4JP0A 3RZOJ 2D2WA 2VKDA 3HEFA 4YFNF 3TP3A 3QPTA 1HDDC 5CQGA 3CCLI 3HRSA 3QU6A 2LD5A 1WWXA 1BI3A 2OAZA 3SFZA 3G73A 2W7NA 2KDOA 3CZ6A 2XRNA 1SFOJ 2R5YB 4BJ6C 5M5WJ 3Q0WA 2VB6A 2EIMH 1VQ4I 2DPUA 4YEJA 1WKMA 2VQCA 1QHHD 3J80Z 1KONA 3E0JB 4CSWA 5LHIA 4PFPA 3WU0A 3PNVA 1TQPA 4II3A 2RGVA 2EIKH 3OYCA 2MA3A 5HODA 2I10A 3E1SA 1T56A 2Z9OA 4BE2A 1QO0D 4AYBN 1TWFJ 4XLPF 2B7EA 1U0JA 4M6YA 1K61A 3OY9A 4P55A 1LKXA 1GXPA 1OCTC 2JZYA 1VNDA 4OAZA 1R36A 4XKCA 1ACIA 1TQMA 1X3UA 3PIOF 1RRJA 1K4SA 3HOVJ 3QODA 3IRRA 2CUJA 5J1UA 3S1QJ 3GTJJ 3HDDA 1X2NA 5K7ZA 1W5TA 1ODDA 2VKEA 1ETWA 4HV5A 4HNTA 3HYIA 3LFUA 1CF7A 3PUFA 3LA2A 4N9HA 4RAGA 3DWLE 3TO6A 4XRSG 5CYVA 4UUSB 5C3EJ 2IVMA 3Q0UA 2MH2A 1XDSA 2F5FA 1B72A 4ENMA 3ZPLA 2L0KA 1R49A 3R0JA 2KIQA 1LNWA 2WAEA 3GFJA 2W82A 2EZLA 4BDZA 3GTQJ 1PYVA 1X1AA 2XHKA 3FM3A 3GWZA 2V1DA 3BLYA 5HVQC 2GIZA 3GTKJ 1R5GA 1O3SA 2HVQA 5ICFA 3CCMI 5A2QZ 2R7SA 4RB0A 3T8TA 3GTGJ 4L9TA 4HDUA 1I6HJ 3BG6A 2CUZA 4GFBA 2VQHA 2HEOA 1VQ8I 3HGYA 2WAQN 3ABTA 1OKRA 1GUUA 1U6GA 4I0BA 4RS8A 4NC6A 3TO9A 3S16J 3EUAA 3FBNB 4D5CA 2EK5A 3K0LA 4M6VA 3WTSC 4BYYA 4LLNA 3BPXA 2BBYA 3CCYA 5E3LA 1XB4A 2XGXA 1BW6A 3L9FA 3BTCA 1WGXA 2K9MA 2GXBA 3G1LA 1F1ZA 1U9NA 1F4KA 1W5CC 2ACJA 3I9V2 2P6SA 5CPRB 1A5JA 1HBXG 5JR3A 2WV1A 2XGCA 1R5HA 3HC7A 3I64A 3BG7A 1BC7C 1YW8A 2IT0A 1K6YA 1MNEA 2XAUA 1MGTA 2V9KA 3H92A 2R0QC 1QNTA 1YITI 1Z9CA 2Y0MA 4CDGA 1MMDA 2VPRA 4E7JA 5FJ8J 1STZA 3VDXA 2C6YA 3DTIA 1HKSA 2JJ7A 3K4KA 2JA5J 1WJDA 2VQLA 1UMQA 1Y1VJ 3M8JA 1WSUA 3HPGA 1IUFA 1ETYA 1TP4A 4EM0B 3VPRA 4M3EA 2OTLI 1S72I 2VXDA 3L7WA 3V42A 1T0FA 1P4WA 4L0YB 1IRGA 5DV5A 1W0TA 4J00A 3BR6A 3K1PA 1GV2A 1NTCA 3TBIA 4XSZF 3S3MA 3BQZA 1G3YA 4ANJA 2HFHA 2WY8Q 2RAEA 2CQ7A 4F55A 2Q0OA 4DJAA 1XCVA 3F0CA 4BEHA 1BI2A 4V2GA 3WTTC 4V2FA 2QM3A 1FBSA 4MFEA 2CW8A 3NAUA 3JRIA 2L3DA 3CJQB 5M5YJ 4DYCA 1MJAA 1X3WB 2DFHA 1DU0A 4I6ZA 1H9TA 3OYLA 3LSPA 3TDZC 2WY7Q 3E97A 1USSA 1W1WE 3HIFA 3C2GA 3J7YJ 4GXOA 2WBMA 4IQJA 3LWFA 3WG9A 4GCVA 4ZTFA 3SHFA 2V79A 3HSFA 2NVXJ 4E7KA 2E1MB 2Z33A 3K10A 3ZQGA 4LLGF 3IP4B 4U88A 2DW4A 3AG4H 4LMYA 3IAS2 1R5ID 2K85A 3K7AJ 3KYCB 3OYNA 2EJRA 4QSHA 1ZRFA 1IG7A 2K3PA 4Q48A 4EM2A 3CTAA 1SVOA 2LTPA 4DOZA 5ERIA 3ZQ7A 3K9TA 5GP9A 1OCRH 5KCMA 2IA1A 1P9QC 3GW2A 3HOXJ 1ZK8A 5LRSA 3IRQA 5E3OA 1Y0NA 2VE8A 3JRDA 3CC2I 4U0YA 4PGHA 2FNPA 1FEXA 4LLLA 4OMYA 3LAJA 3M8FA 1R71A 3OIPA 2ID3A 3VB2A 1JGGA 2O61A 2Z99A 2ZSIB 3LSIA 2IRFG 3JAMZ 3N05A 4RA2A 4HAMA 2V1XA 4PJMA 3LSMA 2OUMA 2OZ6A 5F1RA 2IEKA 2EINH 2V6CA 3H35A 2IPQX 1TTYA 2K86A 4NBQA 4S0HB 1LDJA 3EYYA 2O3FA 4ZYAA 4ENJA 1YX3A 3WE3A 3K70C 1T2KA 3OS1A 3HSRA 1JHFA 2DQRA 1OCZH 1Y8QB 2DDBA 2W24A 3DKYA 3TW7A 1GDTA 1Z7UA 4HG2A 2R5ZB 1Z05A 2A05A 4JOMA 4CCMA 2EILH 1Z6RA 3BR1A 1S7EA 3O3KA 4P1WA 1QZYA 1EKEA 3S1NJ 4G6TB 1YRNA 1ERDA 4KA4A 3ZMZA 2MYSA 3IL2A 4YELA 3EUHC 2QQ8A 1HOMA 2PG4A 2G0EA 1RKWA 2K5CA 4R1HA 1IXRC 4QWQA 3QYEA 1Y0UA 3KLOA 3S2HJ 1VQ5I 2K4BA 3Q9SA 2HQ5A 5FGMA 2CMPA 4XLNF 1Y39A 4YIIA 3DXJF 2XF5A 3HPHA 5FFXA 2EZKA 2E2IJ 4LOCA 5JVTA 4HSTA 1R9TJ 1BM9A 1XX5A 2K40A 2X6XA 3BJOA 4AIDA 2F4IA 3TQNA 3KEYA 5BNGA 2QQ9A 4HYEA 3C2HA 2TCTA 2M9HA 1MSFC 3N97A 2H09A 2L01A 4HSRA 2DODA 1NG7A 2MC3A 2VL8A 2W1OA 2PMZA 5J1YA 2YS9A 3J81K 2STWA 3IH3A 3KYLA 2KJCA 1YJNI 4Q5SF 3ZRGA 4A3JJ 3M7GA 2HOTA 3FXUA 2X6WA 3PNYA 5EDNA 1TW2A 4X1EA 4S04A 3HGGA 5ICGA 5EEGA 4CUGA 2L9NA 1W36C 4RM3A 1ZR4A 1LE8A 1KQ9A 2ELJA 2XKPA 2EWNA 2HYFA 2WAFA 2W48A 4XOPA 2A6HF 2MBFA 3BR3A 1K6OA 2JWTA 3BZKA 3ERMA 3NWTA 3OOPA 4XONA 4L0ZB 2HQRA 2UXXA 2W00A 3S1RJ 1YO5C 2HZTA 3CCUI 1FY7A 3HTSB 2CQXA 2B9SA 2NOJB 3BZ6A 5E3MA 5IT9K 1WJFA 4U7DA 3GTOJ 2HXIA 1SANA 1WJEA 2VT3A 3TDUC 2W57A 3ZCOA 3HBLA 1DQUA 5IYDJ 3K4LA 1JI8A 4BS9A 1KU7A 3R61A 1AA7A 1SD5A 3FMRA 1JKPC 4IRGA 2FU4A 2YSRA 3HTUA 5DCFA 2QBYA 4LIVA 5BPIA 5JHFA 2R3SA 5HNHA 1U3EM 2E7WA 3PL8A 5LHHA 4MTDA 5IP7J 2K9NA 4RLQA 4A3KJ 2NYXA 3OOUA 1ZRCA 1ZG1A 3BY6A 5IP9J 3AG3H 3GMEA 4A3LJ 1D3YA 3ZQCA 2K9LA 2UV1A 3IUOA 2B63J 1EH6A 1Z3XA 2DN0A 2YX4A 2UUZA 2HYJA 2GXAA 2KIMA 2KIFA 3ROUA 1FBQA 2XPUA 4AM3A 3L2WA 4P9UA 1HSTA 1TWGJ 2FJ1A 2I5UA 2RQPA 2E36A 2ZC2A 3JSPA 2XPVA 2DYSH 3W3CA 5HLGA 2QZ8A 1JGSA 3CQZJ 4G7OF 3SXYA 3DPUA 2WTEA 3CC4I 2IW5A 4C30A 5FLMJ 2CH0A 4P96A 3T5XA 1ZKGA 2CV1A 5ICEA 3W6VA 3Q3SA 5KVRA 1FIAA 3AL0C 3VSLA 1R6RA 3SDGA 3M9AA 2JK3A 3DU6A 4ZDOA 1IDZA 2P5VA 2V1UA 2ZB9A 5DD4A 4ZYDA 3ABMH 1R23A 3WGHA 3H5NA 2R7VA 3U21A 4BQAA 3JRAA 4KITB 4YFXF 3VYUB 2FX0A 2VI6A 4MNUA 4OIQF 4B3XA 3REOA 2NVQJ 1JT6A 4BJTA 4MQ9F 3C3WA 4C9YA 2E60A 1HA8A 4IKFA 3K4MA 3I56I 4XBFA 5FLXZ 4M6XA 1OPCA 2PBIA 3FKJA 3A02A 5CVIA 4BY1J 5BQTA 2DU9A 2O03A 4EV0A 5FD6A 3RSNA 1X19A 2KRFA 2EV0A 2PX9A 3L2QA 1T39A 2HVSA 3SFIA 2DDAA 2LC2A 2A3SA 2Q8KA 3WTUC 2E5ZA 4G6DA 4XICA 1ITYA 1HCRA 2HKOA 1WH5A 1U9OA 3E6MA 1K4TA 3M07A 2IS6A 2STTA 4HX4A 1YS6A 5CVJA 4MLOA 4FASD 3FXMA 3S93A 3VYSB 1X1BA 4BBRJ 4O6JA 4K2EA 2KKOA 3ZQIA 2FOWA 2Y48A 3KZIC 1PUFA 2VBZA 4G8XA 4B8XA 3CMYA 1VQNI 1I1GA 3S3OA 1FTTA 4UY8I 3E5UA 4QLCU 4IPAA 2BHZA 5CLSA 1UFMA 3RIRA 3BJ6A 5FRMA 3NEUA 1OLTA 2W85A 1PDNC 2IS2A 2JMWA 4HRIA 1ETQA 2HVRA 1HDPA 2HPIA 2ZFWA 3HB9A 4XLFA 2O9LA 3L1PA 2JT1A 1FNNA 2L7KA 1T38A 5E17F 5DYMA 1T0FC 1F43A 5AIQA 5CVRA 5F0CA 2WB1A 3TP0A 3S3NA 1DP7P 2KRHA 2R7XA 5GAGJ 1P4XA 2IS1A 3V7SA 2P0WA 4IRHA 4BHBA 1NG6A 4LG0B 1LUJB 1IN7A 1MJ9A 3GFMA 4HW0A 4LIUA 1B8IB 4BGDA 4XN0A 2ZXIA 1FOKA 3G2BA 3V8LA 1SFKA 2PFBA 1MBEA 3CF2A 3W2WA 2PMZN 4Y52J 4IHXA 2KHMA 4M71A 2BOLA 2FQ3A 1QVTA 4MGRA 2VJJA 3RZDJ 4XMYA 2V6EA 1E3PA 3S2WA 4RDUA 1WHUA 4AU7A 1RC9A 5B3SH 2GQQA 5EZHA 2XAGA 3CF5F 2RV8A 3T8RA 5LGNA 4CXFA 2QYOA 2JA8J 2LG4A 4PK4A 5B1BH 4KUMA 1P4AA 3HOZJ 4KFCA 1MH4A 1IN4A 3DQVC 2LBFB 2QKMB 1OJLA 2EPFA 2FOKA 1WQ2A 1XMKA 1VTNC 1OISA 1Y6IA 2W4SA 3PQKA 1ZGWA 3DPLC 3FHZA 1REPC 3GFLA 4DIQA 4M74A 3T1BA 2E35A 4ENNA 3WU2C 1FOXA 2DFFA 2ID6A 3IC7A 1EV7A 3KX2A 3MZHA 2FMYA 1TNSA 4PJLA 4W1UA 1TWAJ 1FIPA 5L3BA 3JR9A 3K4CA 3ISPA 1YYVA 2R7QA 4CZZA 2QGUA 1KYZA 1O7LA 2CQNA 2R7FA 1R7JA 5LEJA 4FTHA 1VQLI 1XN7A 3EQLF 3O6BB 1O4XA 3HOWJ 2JA2A 2JRTA 2HGCA 2EBIA 1WZ2A 3E5QA
chains in the Genus database with same CATH topology
1JUSA 2R0QC 4A3GJ 5C4JJ 2VPRA 4JYKA 5FJ8J 3BTIA 4BY7J 2VKVA 2JJ7A 2X48A 4G12A 2JA5J 2HI3A 2R5ZA 1ETKA 1QPIA 1ETOA 1GV5A 1UMQA 1Y1VJ 1BA5A 1RPWA 1IUFA 1ETYA 5F04A 5GPCA 4FE7A 5IPAA 2Y9YA 3VPRA 4M3EA 5EG0B 2Y30A 3HOYJ 4JX6A 2NVTJ 1W0TA 4M3BA 3BR6A 3I4MJ 1GV2A 1NTCA 3BQZA 5C44J 2LKXA 2RAEA 5EYRA 4XRSA 3F0CA 1I3QJ 1IJWC 1JKOC 4V2GA 3G1OA 5E3NA 1APLC 3OSGA 3S14J 4V2FA 4DYQA 1WI3A 1A6IA 4MFEA 2NVYJ 2MW8A 1Q1VA 3NAUA 3JRIA 1H8AC 2LP0A 2LVSA 1B72B 1LFBA 5EZGA 5M5YJ 4DYCA 2FQ4A 1DU0A 2M8GX 4I6ZA 3LSPA 9ANTA 1AKHB 1JJ6C 1X2MA 2DA7A 1IGNA 3ZQLA 2DMNA 4IEJA 2NVXJ 3FKIJ 3FISA 4XK4A 3ZQGA 2XGDA 4DZPA 4AC0A 1UG2A 5IP6A 3PO3J 2M0CA 1OCPA 1ORKA 4NDLA 3IH4A 3K7AJ 3QQAA 1Z77A 4QSHA 1JUPA 2NS7A 5EGOB 1IG7A 2LR8A 2LTPA 1ENHA 5GP9A 1AKHA 4W97A 5M3FJ 3HOXJ 3TEDA 1ZK8A 2R7ZJ 1QVUA 2QF7A 5E3OA 3JRDA 2CUFA 1FEXA 1WCMJ 2ECCA 2ID3A 1JGGA 2JA6J 1H89C 5K7HA 2XGEA 2L9RA 3BTLA 2ME0A 3K2AA 4IHYA 1MSEC 3BR2A 2NS8A 4MO7A 2DA2A 2IEKA 1JTYA 1RR7A 2MG4A 4S0HB 1GVDA 3S17J 3QPSA 3M3YJ 3QPLA 5DS9A 2EZIA 2KDZA 2DA5A 1I50J 2WB1N 4C3JJ 1POGA 1F36A 3TW7A 1GDTA 1JTXA 1W0UA 3H3VK 2R5ZB 5IYBJ 3BG3A 1P7JA 2K9SA 5JLXA 3BR1A 1S7EA 2ELKA 3PM1A 3BG5A 1QRYA 2K9QA 1IV6A 5F0FA 1YRNA 3S1NJ 2XB0X 1XS9A 1TC3C 2X9DA 1HOMA 2O7OA 1NK3P 2G0EA 1RKWA 2XSDC 1UHSA 4EEFG 1TWCJ 3S2HJ 3S15J 2DA4A 2L7MP 2HQ5A 3HKZN 2NOGA 2EZKA 2E2IJ 2H1KA 4LOCA 2JA7J 4A93J 1R9TJ 3JREA 2K40A 3DEWA 5C4XJ 4M3GA 1FTZA 5BNGA 2Y2ZA 4D5FA 3OIOA 2TCTA 2L7FP 3D1NI 2M9HA 1MSFC 3B6CA 5DTDA 2N8GA 5M5XJ 2Y9ZA 3C2BA 3FIWA 4A3MJ 5J1YA 3MN2A 5FKOA 2YS9A 2O8KA 5M3MJ 2CU7A 5J3LA 3IH3A 5IOZA 1XC5A 2FD5A 3DCFA 2YUSA 4A3JJ 2HOTA 4X6AJ 4DW6A 1BW5A 1BJZA 2GBYA 5EDNA 1U78A 4X1EA 3LSJA 1MBKA 3HGGA 2TRTA 2Y31A 1D5YA 3BT9A 4FE4A 4AUXA 1ZR4A 1LE8A 3FK6A 1Z0XA 2W48A 2CRGA 2P81A 3BR3A 2JWTA 1MBFA 5EEAA 2X6OA 4QIWN 2JN6A 5F08A 2DA1A 3S1RJ 1ETXA 1EF4A 3ZQHA 2CQXA 3MKLA 2R5YA 3LNQA 3LOCA 5E3MA 4IHWA 2HXOA 4I76A 4A3IJ 3GTOJ 2HXIA 1IRZA 1SANA 4JX5A 3HBLA 5IYDJ 1RKTA 2DMPA 1ETVA 1FJLA 1JKPC 2HDDA 1MH3A 3Q0VA 2CQQA 5IP7J 2EZHA 4D7NA 1LFUP 2K9NA 3ZQFA 4A3KJ 1JKQC 3OOUA 1CQTA 2CUEA 4L5EA 2CJJA 1RESA 3BG9A 5IP9J 4A3LJ 2ECBA 3ZQCA 2XPWA 1G2HA 2IAIA 3BTJA 3E7LA 4Y7NJ 2B63J 2VUMJ 3A03A 2DN0A 1AU7A 3SJMA 1YRNB 2HYJA 2LFBA 4A3EJ 1HLVA 3PO2J 2XPUA 3O8HA 1IDYA 4J19A 1Y1WJ 2DTZA 1TWGJ 4A3BJ 2FJ1A 2E2JJ 2ME6A 1BL0A 3JRCA 2XPVA 3WHCA 4C2MJ 1IC8A 1B8IA 4A69C 1ZQ3P 3BQYA 1ZR2A 2DA3A 2GLOA 2COBA 4UUSA 3CQZJ 3GTLJ 4XIDA 1T33A 5EF6A 3HOUJ 2DJNA 2Y0SN 4BXXJ 2MSYA 2HOAA 2M2EA 5FLMJ 1ZKGA 3W6VA 3Q3SA 1FIAA 2AO9A 3S2DJ 2E2HJ 2DMUA 4D7MA 4MFDA 3SDGA 2R92J 2XRLA 2JK3A 1JT0A 4C3HJ 1IDZA 2QCOA 3JRHA 2ZB9A 4HNVA 1MBGA 2L7ZA 1WPKA 4B1RA 3JRAA 2E19A 3B6AA 5K7FA 4RBOA 2DA6A 1X58A 2FX0A 2VI6A 5FKLA 4FISA 1RETA 1JT6A 2OF7A 2NVQJ 1VF9A 1JJ8C 2IBDA 4FCYA 3LSGA 3G1MA 3A02A 4BY1J 3M4OJ 4JP0A 3LSRA 3JRBA 2DMQA 1LE8B 2R93J 3RZOJ 4QTRA 3HEFA 3SFIA 3TP3A 5F27A 1HDDC 4XICA 1ITYA 2LD5A 3RKQA 4B3AA 1HCRA 2OPTA 1WH5A 1U9OA 5IYCJ 2EH3A 1SFOJ 3RQIA 2R5YB 4MLOA 1P7IA 5M5WJ 3S1MJ 3Q0WA 1DU6A 4DYRA 4BBRJ 3WHBA 1GT0C 3ZQIA 5FKNA 1PUFA 1H88C 1MBHA 3CMYA 1FTTA 3H0GJ 4A3FJ 4MIMA 5HODA 2I10A 2JMWA 1T56A 3HM5A 1ETQA 2LK2A 1HDPA 3HB9A 2LY9A 4AYBN 2H8RA 4M3FA 1TWFJ 2O9LA 3L1PA 3JRFA 1XG1A 5EG0A 4JX4A 2GM4A 4M3DA 4BBSJ 1F43A 1K61A 3CDLA 1OCTC 1ZTRA 5F0CA 1TWHJ 1VNDA 4C3IJ 1AHDP 4IHVA 3TP0A 3BR0A 3HOVJ 3S1QJ 5J1UA 4B4CA 3GTJJ 3HDDA 1X2NA 5K7ZA 1HF0A 2VKEA 1ETWA 2HOSA 4CYCB 2M34A 4A3CJ 2KT0A 3BR5A 2DMTA 4XRSG 1B8IB 4BKXA 3TW6A 3FK7A 4UUSB 5C3EJ 3Q0UA 1MBEA 2D5VA 2PMZN 4A3DJ 1B72A 3MVPA 1NK2P 4Y52J 1K83J 4IHXA 2E1OA 2XB5A 2L0KA 1QVTA 3RZDJ 2EZLA 4RDUA 3GTQJ 3GBGA 1JKRC 3UKGA 2YU9J 5EZHA 3NARA 1E3OC 5JLWA 3GTKJ 2JA8J 4CYCA 1MNMC 2AHQA 4XRMA 3HOZJ 3GTGJ 1MH4A 1I6HJ 4GFBA 1OFCX 1OJLA 3A01B 5EGOA 5FKKA 3OSFA 2EQRA 3HGYA 3ZOBA 2WAQN 3S16J 1GUUA 2LLKA 5GPAA 1ZGWA 5F1JA 3O8GA 5J1RA 4D5CA 4M6VA 4UUTA 1VFCA 1WH7A 3IH2A 3JRGA 3CCYA 5FKMA 2ID6A 5E3LA 3I4NJ 1MBJA 5IOYA 3IV5A 1BW6A 3BTCA 1VI0A 1WGXA 3GTMJ 2MGQA 4W1UA 1TWAJ 1FIPA 3G1LA 1U9NA 3JR9A 1A5JA 5F0HA 4ABZA 4DZJA 3A01A 2WV1A 2XGCA 1JUMA 4FTHA 1O4XA 1U8BA 3GTPJ 3HOWJ 5FLVA 2EBIA 1PUFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUS A;  2R0Q C;  4A3G J;  5C4J J;  2VPR A;  4JYK A;  5FJ8 J;  3BTI A;  4BY7 J;  2VKV A;  2JJ7 A;  2X48 A;  4G12 A;  2JA5 J;  2HI3 A;  2R5Z A;  1ETK A;  1QPI A;  1ETO A;  1GV5 A;  1UMQ A;  1Y1V J;  1BA5 A;  1RPW A;  1IUF A;  1ETY A;  5F04 A;  5GPC A;  4FE7 A;  5IPA A;  2Y9Y A;  3VPR A;  4M3E A;  5EG0 B;  2Y30 A;  3HOY J;  4JX6 A;  2NVT J;  1W0T A;  4M3B A;  3BR6 A;  3I4M J;  1GV2 A;  1NTC A;  3BQZ A;  5C44 J;  2LKX A;  2RAE A;  5EYR A;  4XRS A;  3F0C A;  1I3Q J;  1IJW C;  1JKO C;  4V2G A;  3G1O A;  5E3N A;  1APL C;  3OSG A;  3S14 J;  4V2F A;  4DYQ A;  1WI3 A;  1A6I A;  4MFE A;  2NVY J;  2MW8 A;  1Q1V A;  3NAU A;  3JRI A;  1H8A C;  2LP0 A;  2LVS A;  1B72 B;  1LFB A;  5EZG A;  5M5Y J;  4DYC A;  2FQ4 A;  1DU0 A;  2M8G X;  4I6Z A;  3LSP A;  9ANT A;  1AKH B;  1JJ6 C;  1X2M A;  2DA7 A;  1IGN A;  3ZQL A;  2DMN A;  4IEJ A;  2NVX J;  3FKI J;  3FIS A;  4XK4 A;  3ZQG A;  2XGD A;  4DZP A;  4AC0 A;  1UG2 A;  5IP6 A;  3PO3 J;  2M0C A;  1OCP A;  1ORK A;  4NDL A;  3IH4 A;  3K7A J;  3QQA A;  1Z77 A;  4QSH A;  1JUP A;  2NS7 A;  5EGO B;  1IG7 A;  2LR8 A;  2LTP A;  1ENH A;  5GP9 A;  1AKH A;  4W97 A;  5M3F J;  3HOX J;  3TED A;  1ZK8 A;  2R7Z J;  1QVU A;  2QF7 A;  5E3O A;  3JRD A;  2CUF A;  1FEX A;  1WCM J;  2ECC A;  2ID3 A;  1JGG A;  2JA6 J;  1H89 C;  5K7H A;  2XGE A;  2L9R A;  3BTL A;  2ME0 A;  3K2A A;  4IHY A;  1MSE C;  3BR2 A;  2NS8 A;  4MO7 A;  2DA2 A;  2IEK A;  1JTY A;  1RR7 A;  2MG4 A;  4S0H B;  1GVD A;  3S17 J;  3QPS A;  3M3Y J;  3QPL A;  5DS9 A;  2EZI A;  2KDZ A;  2DA5 A;  1I50 J;  2WB1 N;  4C3J J;  1POG A;  1F36 A;  3TW7 A;  1GDT A;  1JTX A;  1W0U A;  3H3V K;  2R5Z B;  5IYB J;  3BG3 A;  1P7J A;  2K9S A;  5JLX A;  3BR1 A;  1S7E A;  2ELK A;  3PM1 A;  3BG5 A;  1QRY A;  2K9Q A;  1IV6 A;  5F0F A;  1YRN A;  3S1N J;  2XB0 X;  1XS9 A;  1TC3 C;  2X9D A;  1HOM A;  2O7O A;  1NK3 P;  2G0E A;  1RKW A;  2XSD C;  1UHS A;  4EEF G;  1TWC J;  3S2H J;  3S15 J;  2DA4 A;  2L7M P;  2HQ5 A;  3HKZ N;  2NOG A;  2EZK A;  2E2I J;  2H1K A;  4LOC A;  2JA7 J;  4A93 J;  1R9T J;  3JRE A;  2K40 A;  3DEW A;  5C4X J;  4M3G A;  1FTZ A;  5BNG A;  2Y2Z A;  4D5F A;  3OIO A;  2TCT A;  2L7F P;  3D1N I;  2M9H A;  1MSF C;  3B6C A;  5DTD A;  2N8G A;  5M5X J;  2Y9Z A;  3C2B A;  3FIW A;  4A3M J;  5J1Y A;  3MN2 A;  5FKO A;  2YS9 A;  2O8K A;  5M3M J;  2CU7 A;  5J3L A;  3IH3 A;  5IOZ A;  1XC5 A;  2FD5 A;  3DCF A;  2YUS A;  4A3J J;  2HOT A;  4X6A J;  4DW6 A;  1BW5 A;  1BJZ A;  2GBY A;  5EDN A;  1U78 A;  4X1E A;  3LSJ A;  1MBK A;  3HGG A;  2TRT A;  2Y31 A;  1D5Y A;  3BT9 A;  4FE4 A;  4AUX A;  1ZR4 A;  1LE8 A;  3FK6 A;  1Z0X A;  2W48 A;  2CRG A;  2P81 A;  3BR3 A;  2JWT A;  1MBF A;  5EEA A;  2X6O A;  4QIW N;  2JN6 A;  5F08 A;  2DA1 A;  3S1R J;  1ETX A;  1EF4 A;  3ZQH A;  2CQX A;  3MKL A;  2R5Y A;  3LNQ A;  3LOC A;  5E3M A;  4IHW A;  2HXO A;  4I76 A;  4A3I J;  3GTO J;  2HXI A;  1IRZ A;  1SAN A;  4JX5 A;  3HBL A;  5IYD J;  1RKT A;  2DMP A;  1ETV A;  1FJL A;  1JKP C;  2HDD A;  1MH3 A;  3Q0V A;  2CQQ A;  5IP7 J;  2EZH A;  4D7N A;  1LFU P;  2K9N A;  3ZQF A;  4A3K J;  1JKQ C;  3OOU A;  1CQT A;  2CUE A;  4L5E A;  2CJJ A;  1RES A;  3BG9 A;  5IP9 J;  4A3L J;  2ECB A;  3ZQC A;  2XPW A;  1G2H A;  2IAI A;  3BTJ A;  3E7L A;  4Y7N J;  2B63 J;  2VUM J;  3A03 A;  2DN0 A;  1AU7 A;  3SJM A;  1YRN B;  2HYJ A;  2LFB A;  4A3E J;  1HLV A;  3PO2 J;  2XPU A;  3O8H A;  1IDY A;  4J19 A;  1Y1W J;  2DTZ A;  1TWG J;  4A3B J;  2FJ1 A;  2E2J J;  2ME6 A;  1BL0 A;  3JRC A;  2XPV A;  3WHC A;  4C2M J;  1IC8 A;  1B8I A;  4A69 C;  1ZQ3 P;  3BQY A;  1ZR2 A;  2DA3 A;  2GLO A;  2COB A;  4UUS A;  3CQZ J;  3GTL J;  4XID A;  1T33 A;  5EF6 A;  3HOU J;  2DJN A;  2Y0S N;  4BXX J;  2MSY A;  2HOA A;  2M2E A;  5FLM J;  1ZKG A;  3W6V A;  3Q3S A;  1FIA A;  2AO9 A;  3S2D J;  2E2H J;  2DMU A;  4D7M A;  4MFD A;  3SDG A;  2R92 J;  2XRL A;  2JK3 A;  1JT0 A;  4C3H J;  1IDZ A;  2QCO A;  3JRH A;  2ZB9 A;  4HNV A;  1MBG A;  2L7Z A;  1WPK A;  4B1R A;  3JRA A;  2E19 A;  3B6A A;  5K7F A;  4RBO A;  2DA6 A;  1X58 A;  2FX0 A;  2VI6 A;  5FKL A;  4FIS A;  1RET A;  1JT6 A;  2OF7 A;  2NVQ J;  1VF9 A;  1JJ8 C;  2IBD A;  4FCY A;  3LSG A;  3G1M A;  3A02 A;  4BY1 J;  3M4O J;  4JP0 A;  3LSR A;  3JRB A;  2DMQ A;  1LE8 B;  2R93 J;  3RZO J;  4QTR A;  3HEF A;  3SFI A;  3TP3 A;  5F27 A;  1HDD C;  4XIC A;  1ITY A;  2LD5 A;  3RKQ A;  4B3A A;  1HCR A;  2OPT A;  1WH5 A;  1U9O A;  5IYC J;  2EH3 A;  1SFO J;  3RQI A;  2R5Y B;  4MLO A;  1P7I A;  5M5W J;  3S1M J;  3Q0W A;  1DU6 A;  4DYR A;  4BBR J;  3WHB A;  1GT0 C;  3ZQI A;  5FKN A;  1PUF A;  1H88 C;  1MBH A;  3CMY A;  1FTT A;  3H0G J;  4A3F J;  4MIM A;  5HOD A;  2I10 A;  2JMW A;  1T56 A;  3HM5 A;  1ETQ A;  2LK2 A;  1HDP A;  3HB9 A;  2LY9 A;  4AYB N;  2H8R A;  4M3F A;  1TWF J;  2O9L A;  3L1P A;  3JRF A;  1XG1 A;  5EG0 A;  4JX4 A;  2GM4 A;  4M3D A;  4BBS J;  1F43 A;  1K61 A;  3CDL A;  1OCT C;  1ZTR A;  5F0C A;  1TWH J;  1VND A;  4C3I J;  1AHD P;  4IHV A;  3TP0 A;  3BR0 A;  3HOV J;  3S1Q J;  5J1U A;  4B4C A;  3GTJ J;  3HDD A;  1X2N A;  5K7Z A;  1HF0 A;  2VKE A;  1ETW A;  2HOS A;  4CYC B;  2M34 A;  4A3C J;  2KT0 A;  3BR5 A;  2DMT A;  4XRS G;  1B8I B;  4BKX A;  3TW6 A;  3FK7 A;  4UUS B;  5C3E J;  3Q0U A;  1MBE A;  2D5V A;  2PMZ N;  4A3D J;  1B72 A;  3MVP A;  1NK2 P;  4Y52 J;  1K83 J;  4IHX A;  2E1O A;  2XB5 A;  2L0K A;  1QVT A;  3RZD J;  2EZL A;  4RDU A;  3GTQ J;  3GBG A;  1JKR C;  3UKG A;  2YU9 J;  5EZH A;  3NAR A;  1E3O C;  5JLW A;  3GTK J;  2JA8 J;  4CYC A;  1MNM C;  2AHQ A;  4XRM A;  3HOZ J;  3GTG J;  1MH4 A;  1I6H J;  4GFB A;  1OFC X;  1OJL A;  3A01 B;  5EGO A;  5FKK A;  3OSF A;  2EQR A;  3HGY A;  3ZOB A;  2WAQ N;  3S16 J;  1GUU A;  2LLK A;  5GPA A;  1ZGW A;  5F1J A;  3O8G A;  5J1R A;  4D5C A;  4M6V A;  4UUT A;  1VFC A;  1WH7 A;  3IH2 A;  3JRG A;  3CCY A;  5FKM A;  2ID6 A;  5E3L A;  3I4N J;  1MBJ A;  5IOY A;  3IV5 A;  1BW6 A;  3BTC A;  1VI0 A;  1WGX A;  3GTM J;  2MGQ A;  4W1U A;  1TWA J;  1FIP A;  3G1L A;  1U9N A;  3JR9 A;  1A5J A;  5F0H A;  4ABZ A;  4DZJ A;  3A01 A;  2WV1 A;  2XGC A;  1JUM A;  4FTH A;  1O4X A;  1U8B A;  3GTP J;  3HOW J;  5FLV A;  2EBI A;  1PUF B; 
#chains in the Genus database with same CATH topology
 2ISY A;  3RI4 A;  1VQ9 I;  2VXZ A;  4IZZ A;  1BJA A;  3A1Y A;  3BTI A;  4BY7 J;  2VKV A;  1SVM A;  2X48 A;  2QVO A;  3W2V A;  4RB1 A;  2H27 A;  4BAC A;  2HI3 A;  3OWT A;  5BS6 A;  2KL4 A;  1ETO A;  1GV5 A;  1QPI A;  2NRA C;  1RPW A;  5KNL A;  3FMQ A;  2DPD A;  5F04 A;  5GPC A;  2X6Y A;  1G8X A;  4FE7 A;  5IPA A;  2WWY A;  2Y9Y A;  4OAY A;  1WJ5 A;  2BGC A;  2BY2 A;  4QPQ A;  1IO2 A;  1QPM A;  4M9Z A;  3I4M J;  3SYT A;  1ZN2 A;  2F2E A;  5C44 J;  1ZLK A;  5EYR A;  2O0Y A;  2GOX B;  3E5X A;  5JI6 A;  3GX4 X;  1CF7 B;  2EV6 A;  1JKO C;  2BXZ A;  4I01 A;  3J7A Y;  3RYP A;  1APL C;  3GYH X;  3S14 J;  4DYQ A;  5L3G A;  3KCC A;  1MJB A;  1WI3 A;  2NVY J;  5LBQ A;  1Q1V A;  4I2O A;  4A5N A;  2KFD A;  2LP0 A;  1B72 B;  1J09 A;  4I98 B;  4KT5 C;  5LGU A;  3EDP A;  1IV8 A;  4JQF A;  2YR2 A;  9ANT A;  3CJT B;  2IXS A;  4TV7 A;  3HRT A;  1JJ6 C;  4UB6 C;  3AL0 B;  2L9V A;  1XGO A;  1IRF A;  5LHG A;  1IGN A;  1N77 A;  1JHH A;  3ZQL A;  2DMN A;  5L3D A;  5J8C A;  1YLF A;  3AG1 H;  1FOW A;  1CGP A;  5D8L B;  4PGG A;  4Y17 A;  1YW9 A;  3QOP A;  4NDL A;  4F93 B;  1XGM A;  1JUP A;  2NS7 A;  3F21 A;  3P5J A;  1ENH A;  2W25 A;  4A0Y A;  2BW3 A;  2DFI A;  3KEO A;  2KZG A;  3DEE A;  1QVU A;  2QF7 A;  4KJZ A;  2L54 A;  1K7A A;  3LSK A;  1WVR A;  3I55 I;  4LG3 A;  4Z2Y A;  2VN2 A;  2OTJ I;  1H89 C;  2CV0 A;  2E7X A;  5K7H A;  2Y75 A;  2JRM A;  2L9R A;  3DBR B;  1YQA A;  1A04 A;  2ME0 A;  3OYH A;  1XSV A;  1SMT A;  3H1C A;  2FUG 2;  2K3F A;  3A0B C;  4D1Q A;  4AIJ A;  2NS8 A;  2IA0 A;  4KNY A;  1JTY A;  4IVN A;  2LY2 A;  2X51 A;  2MG4 A;  3FXR A;  3RYR A;  1MKM A;  1A31 A;  2R7U A;  4KIB A;  1GVD A;  1WJC A;  3CUO A;  4PZJ A;  2QQA A;  4E6K G;  1SFX A;  3EUK L;  2H6C A;  3DLA A;  2EZI A;  2DA5 A;  1I50 J;  2WB1 N;  3SEQ A;  4C3J J;  1POG A;  2OC6 A;  5JVG F;  1F36 A;  5D4S A;  4OU0 A;  1JTX A;  2NXN B;  3MD2 A;  1IN8 A;  2ZNY A;  3WOD F;  2EA4 A;  2Z3Y A;  5JLX A;  4II2 A;  1V54 H;  3PM1 A;  2JPC A;  2Z1D A;  2ELH A;  2DI3 A;  1XS9 A;  4IHT A;  3ZQQ A;  2VC1 A;  1V4R A;  1TBX A;  2M45 A;  3B73 A;  2RC4 A;  3CO6 C;  2O7O A;  2QQB A;  4E7H A;  4PUS A;  3C1D A;  1UHS A;  3K1M A;  4EEF G;  4J01 A;  3D5L A;  4B47 A;  1TWC J;  1V3F A;  4QPO A;  3O2P E;  3V7C A;  1P92 A;  4BEH B;  1X1D A;  4KIG A;  3DF8 A;  3ELK A;  2HQN A;  2NOG A;  4B09 A;  4KN4 X;  3QAH A;  4IXA A;  3R6S A;  4PSW A;  2FSW A;  1EH8 A;  3H9G A;  3NQO A;  3OYA A;  3HOS A;  5C4X J;  5DDG A;  1UB9 A;  4D5F A;  3KZY A;  4AWX B;  2MAB A;  2L7F P;  4AD9 A;  2VLA A;  1ZAR A;  5L3C A;  2HKX A;  2KQR A;  1O57 A;  3ASO H;  5M5X J;  5TIS C;  2Y9Z A;  3ECH A;  3C2B A;  2D1H A;  4HLY A;  2H94 A;  4A3M J;  1LDD A;  4N4O B;  2CV2 A;  4A5M A;  4U87 A;  3HXL A;  3RPU D;  3FM5 A;  4E7I A;  2M87 A;  4LB5 A;  4ETS A;  2FD5 A;  2Q2E A;  4M73 A;  4RAY A;  1H9G A;  3E6B A;  2ICW G;  3DV8 A;  1Z3Y A;  4HPQ A;  4X6A J;  2NAZ A;  5ILU A;  1BJZ A;  4KIS A;  3FZV A;  1QQI A;  2OJE D;  2Q1Z B;  3DU5 A;  4BL0 B;  1SEU A;  1U78 A;  1GHC A;  1V5G A;  2LKP A;  4P5O A;  2TRT A;  1MW7 A;  1IAW A;  2JUC A;  2Y31 A;  4BH9 A;  2M5W A;  4AUX A;  3CP2 A;  1Z7L A;  2H6B A;  3FMS A;  2XAF A;  2CFX A;  4BXF A;  3FK6 A;  1L0O C;  2A6T A;  5DUI A;  5HOO A;  5H20 A;  2CRG A;  2D1V A;  3WE2 A;  2F5E A;  3AG2 H;  1ZHF A;  1MBF A;  3FXQ A;  1UST A;  2A07 F;  2X6O A;  1KU2 A;  2JN6 A;  2R4G A;  1ETX A;  3R0A A;  3CCS I;  4L18 B;  3OYJ A;  1RUN A;  2CW7 A;  3GZ6 A;  2BVL A;  3C18 A;  3U9G A;  3LOC A;  1C0W A;  3MAJ A;  2G9W A;  5D5V B;  2ZME A;  2BZT A;  4A0Z A;  2HR3 A;  4JBA A;  1X3Z B;  1NHA A;  3HSE A;  3WU1 B;  1MMN A;  2L2O A;  1IXC A;  2OA4 A;  1RKT A;  1RR8 C;  1TT0 A;  2DMP A;  1ETV A;  2XAH A;  3ABU A;  3KE2 A;  2DYR H;  3ZMU A;  2HDD A;  1MH3 A;  4IRI A;  1R00 A;  2HPM A;  1MD0 A;  3ZQF A;  5D4R A;  1W4M A;  2UWM A;  2CUE A;  4L5E A;  1VZ0 A;  1K79 A;  2DTR A;  3BG9 A;  3WTZ A;  5GTI C;  2LYC A;  2UXN A;  4EMS A;  1G2H A;  2XPW A;  3BRO A;  2IAI A;  1Z1D A;  2JSC A;  3BTJ A;  4Y7N J;  3LSH A;  1V5F A;  2VUM J;  3UR3 C;  2FNA A;  1I3A A;  3A03 A;  3K69 A;  4FHT A;  4Q47 A;  3LAP A;  1QBJ A;  1YRN B;  4BQO A;  5E8G A;  2DQL A;  3E3V A;  3RPU A;  4XLH A;  2XIG A;  4IX7 A;  4A3E J;  1D1C A;  1MMG A;  2K02 A;  3PO2 J;  3W6J B;  3J81 Z;  1IDY A;  2DOA A;  5AON A;  1VQ7 I;  4L9J A;  5DM6 F;  4A3B J;  2E2J J;  3FXO A;  2PQ8 A;  5J4V A;  4BDY A;  2ME6 A;  1BL0 A;  3BP8 A;  4JK1 X;  3JRC A;  4HNU A;  3OYK A;  4C2M J;  1IC8 A;  4RAZ A;  2VE9 A;  1HW2 A;  2GLO A;  4XLC A;  4Y13 A;  1T33 A;  4KT6 A;  2KMU A;  1FMW A;  4CA0 A;  1A36 A;  2NNY A;  4BXX J;  3QYF A;  2GZW A;  3E6C C;  2HOA A;  4BNC A;  2VJ4 A;  3HUG A;  1DPR A;  2HDC A;  4Y33 A;  5GAD J;  2AO9 A;  1HSJ A;  2XDV A;  4IOA F;  4KDP A;  2R92 J;  4C3H J;  3RQ4 A;  2LNB A;  2OQR A;  4HNV A;  3A0H C;  1WFX A;  4ZJZ A;  1U8R A;  4B1R A;  2E19 A;  2RVC A;  3ULQ B;  2DA6 A;  1X58 A;  3V8J A;  4B44 A;  4Y3O A;  4ESB A;  5IT9 Z;  1K78 A;  4FIS A;  2VOO A;  1RET A;  3R60 A;  1UAA A;  1VF9 A;  5EJC A;  2BE5 F;  4F52 A;  4ZTJ A;  2IBD A;  4NC7 A;  1YTY A;  4EGZ A;  3LSG A;  3P7N A;  2BYV E;  4IQ4 A;  2ETH A;  1D1B A;  3G1M A;  3GVA A;  1ZRD A;  1LE8 B;  2VT2 A;  1X4P A;  2HOE A;  2OCE A;  2CS3 A;  3Q5F A;  2R7T A;  1B6A A;  3FDY A;  2XAS A;  5F27 A;  1O3Q A;  3CMM A;  3WGG A;  1O3R A;  3RKQ A;  1SD7 A;  1R1T A;  2OPT A;  3OIQ A;  5IYC J;  3ESW B;  2CG4 A;  2G7U A;  3RQI A;  1L3L A;  3S1M J;  3K4B A;  4OWR B;  3KP2 A;  4BHC A;  3RCO A;  4CCO A;  3KEQ A;  3V4G A;  1H88 C;  4N4N B;  3HOT A;  2ZNZ A;  3ZMS A;  2WAD A;  1IXS B;  2QBY B;  4A3F J;  2VON A;  3MCZ A;  3MFK A;  2F48 A;  1Y8R B;  2Z2S B;  1G3T A;  2LRE A;  1TL8 A;  3X2Q H;  4CCJ A;  2A5W A;  5BPD A;  2LK2 A;  2H8R A;  1QU3 A;  5HS8 A;  3DTK A;  3JRF A;  5EG0 A;  3SDB A;  5AIP A;  4M3D A;  2E34 A;  3K4N A;  4BBS J;  1S7O A;  3CDL A;  1ZTR A;  3LMM A;  4C2U A;  1QGP A;  4B4C A;  2HU9 A;  4IOC F;  3NRV A;  1HF0 A;  2PJR A;  2XAQ A;  2IGN A;  1XDU A;  2HOS A;  3F8N A;  3ZP5 A;  2KT0 A;  4NHJ A;  4HZF A;  3MKY B;  4BKX A;  2KZV A;  3HRU A;  3CJR B;  5GAH J;  2G7H A;  3FK7 A;  4WF2 A;  5GAE J;  1H0M A;  2D5V A;  3IHU A;  4A3D J;  3MVP A;  1NK2 P;  3K4J A;  1FC3 A;  2DO7 A;  2E1O A;  1ZRE A;  2ZSH B;  1VQO I;  3GBG A;  2LDU A;  3UKG A;  2FBI A;  1HXD A;  2JPB A;  3NAR A;  2V9V A;  1AWC A;  2GWR A;  5JLW A;  1FBU A;  2EFO A;  1HW5 A;  2FBK A;  2P5K A;  3HZJ A;  5FD5 A;  4CGZ A;  4G9Y A;  4ON0 A;  3I4P A;  1GLN A;  2AHQ A;  4BE1 A;  1MNM C;  4XRM A;  3D5R C;  2XC7 A;  3CCV I;  1KQ8 A;  3A01 B;  5EGO A;  5CKT A;  3F6V A;  2EQR A;  4UNO A;  2HS5 A;  1UG0 A;  3RTR A;  2FML A;  1UZC A;  2LLK A;  3I59 A;  4UHT A;  1ZEL A;  5F1J A;  3O8G A;  1E3H A;  5J1R A;  2VBX A;  4UUT A;  1T6S A;  1D8J A;  1MND A;  2RNJ A;  3QU3 A;  4ZZL A;  3MMY B;  3JRG A;  3I4N J;  1LPQ A;  5IOY A;  1LEA A;  4I99 C;  1BIA A;  1VI0 A;  4FT8 A;  2IP2 A;  2MGQ A;  2MLK A;  1RNL A;  4L5I A;  3DKW A;  4RGU A;  1ON1 A;  4I02 A;  5F0H A;  1PVE A;  4KIF A;  4X0G A;  4Q4Z F;  3A01 A;  2B0L A;  1DGR M;  4DNC A;  3SEZ A;  1U8B A;  2AS5 F;  2X1D A;  4EJW A;  5FLV A;  4UV9 A;  1PUF B;  1FPQ A;  2VKH A;  1JUS A;  2LH9 A;  1TZL A;  3I54 A;  4G7H F;  1U2W A;  4ZZD A;  4F3Q A;  2OQG A;  3ASN H;  2R7R A;  3CCE I;  3RDI A;  1XPX A;  1T98 A;  4FX0 A;  2GXG A;  4ZYE A;  1YFH A;  1XSD A;  4NNJ A;  1MDM A;  1XMX A;  2DOE A;  3D5S C;  4ESJ A;  1IW7 F;  3TOA A;  2F5V A;  4WXD A;  3ZGK A;  1YHQ I;  1IZ1 A;  5IY5 H;  5BMZ A;  4N9I A;  3SZT A;  3GZ5 A;  2AQF A;  3P9C A;  4OMZ A;  1X1C A;  4JX6 A;  4BHP A;  2NVT J;  1T95 A;  5F6F A;  2F6C A;  3I5U A;  1BOA A;  2LF7 A;  4HF2 A;  5E1W A;  3OYG A;  2VJI A;  1YG2 A;  1G6N A;  2X4H A;  3CES A;  4LJZ F;  4WK8 F;  1IUY A;  1D0X A;  1YJW I;  1N75 A;  4IL6 C;  3CP8 A;  1R58 A;  3PFY A;  4KN7 X;  4R8H A;  1I3Q J;  1SD6 A;  4DBQ A;  1Y56 A;  5H6R A;  2QEX I;  4LGW A;  1KA8 A;  3OSG A;  3ZR8 X;  1B9N A;  1A6I A;  4CO8 A;  2MW8 A;  4PSX A;  4KYW A;  2LVS A;  5HS7 A;  5EZG A;  1BI0 A;  2F5C A;  5F64 A;  4LIT A;  3ECO A;  4A6E A;  1P2F A;  5ILS A;  2KJB A;  3EPZ A;  2FE3 A;  1Z91 A;  2DA7 A;  1S8N A;  1W7P D;  3M1E A;  1MMS A;  3RKY A;  2R7O A;  3FKI J;  3IWZ A;  4E7L A;  2M0M A;  3FIS A;  4XK4 A;  2XGD A;  3GXO A;  4HA8 A;  4AC0 A;  4DZP A;  5IP6 A;  1LQ1 A;  2M0C A;  2VPL A;  1OCP A;  1FLI A;  3PIP F;  3R4K A;  4BXU A;  5J40 A;  3F22 A;  4XL9 A;  2LR8 A;  3LFK A;  5B66 C;  2JTV A;  2NS0 A;  3FBI B;  3RPQ A;  5K1Y A;  1YIO A;  4N0B A;  1WJB A;  5LFA A;  5M3F J;  2R7Z J;  2M30 A;  4UVC A;  5B1A H;  4EGY A;  3BDD A;  1ZG5 A;  1WCM J;  2CFO A;  2ECC A;  4XLE A;  3QRF F;  2RNG A;  2BHY A;  5E1X A;  1FP1 D;  4HQM A;  2JA6 J;  2L4A A;  3TGN A;  3B02 A;  3ML6 A;  1E0E A;  3J7Z I;  2XGE A;  2EA2 A;  2YX7 A;  1D0Z A;  3HRM A;  3BTL A;  3MWM A;  4NUB A;  1E17 A;  3K2A A;  4IHY A;  4Y15 A;  4IJA A;  3GEZ A;  2ZFU A;  2ZME C;  3BR2 A;  1OYW A;  4MTE A;  2DA2 A;  4UVA A;  4HLX A;  2ZO4 A;  5J8F A;  4ITV A;  1J2X A;  4PCQ A;  2CQK A;  2WC2 A;  1WI9 A;  3U2R A;  3S17 J;  3FHN A;  2PJP A;  2X1E A;  3M3Y J;  3GZN B;  3CMA I;  3CLQ A;  3QPL A;  2JQ7 A;  2KDZ A;  1I27 A;  2EFP A;  4HV6 A;  3ZMT A;  2KIU A;  2H8W A;  1LB2 A;  1EA3 A;  2F4M B;  3KP4 A;  5IYB J;  1FMV A;  4KIC A;  3BZC A;  4M9X A;  4Z6Y A;  2A69 F;  2MLG A;  3RKX A;  2KIS A;  1R1V A;  3KET A;  1W7P A;  2K9Q A;  2VBW A;  3H3Z A;  5F0F A;  2XB0 X;  4XQF A;  4XSX F;  2P4W A;  1FSE A;  2R7D A;  4OIN F;  3V7R A;  1SD4 A;  5ICC A;  2X9D A;  2QSH X;  5JFR A;  1G59 A;  1NK3 P;  3PNT A;  4LK1 F;  2O5R A;  4XNF A;  4UUV A;  4D9J A;  3ZMD A;  5LLQ A;  1IF1 A;  1NH3 A;  2M7A A;  1U5T A;  2DA4 A;  3DKX A;  1QZE A;  3CUQ A;  4CZC A;  1LJ9 A;  1TLH B;  3KYD B;  3CCR I;  3I58 A;  2E5N A;  3AAF A;  4G94 A;  2H1K A;  2JA7 J;  3JRE A;  1B59 A;  3DEW A;  4HBL A;  2DAO A;  2ZJ2 A;  4XM3 A;  2Y2Z A;  3I0T A;  5DEQ A;  3OIO A;  5DTD A;  4MHG A;  1QA6 A;  1FT9 A;  3H36 A;  1VQM I;  1R1U A;  2Z16 A;  4ZDP A;  2ZJP F;  1SFU A;  5FKO A;  5K5Q A;  3CME I;  5M3M J;  1YOV B;  5IOZ A;  3K6G A;  4OIO F;  1XC5 A;  1KU3 A;  4F91 B;  3OYF A;  1A6Q A;  1FSH A;  3GLX A;  3OL3 A;  4RAF A;  4DW6 A;  4EQQ A;  1BW5 A;  1F9N A;  4RGS A;  2EV5 A;  3M1C A;  3LSJ A;  1MBK A;  2DT7 B;  2MD5 A;  3CDH A;  3ABL H;  3DPT A;  2IGM A;  4L5J A;  3BT9 A;  4FE4 A;  1VQP I;  5L3E A;  2BW3 B;  4EJV A;  2O8X A;  3DP7 A;  3DTE A;  3BCA A;  3L2R A;  1UCR A;  5HDN A;  1UHM A;  1E2X A;  2P6T A;  5EEA A;  1PJR A;  3FXL A;  4QIW N;  1G4D A;  4P9F A;  1OQY A;  2RDP A;  1OCO H;  3TO7 A;  1SC7 A;  3MKL A;  5E18 F;  2R5Y A;  3G4S I;  4IHW A;  4A3I J;  1D0Y A;  4LD5 A;  1IRZ A;  3IKV A;  3M8E A;  5TJJ A;  2AQE A;  5HDK A;  2KP6 A;  4HF1 A;  3VFZ A;  1FJL A;  1J75 A;  1IN5 A;  3I53 A;  3OL4 A;  3OR1 C;  1R22 A;  2KPM A;  4D7N A;  1LFU P;  2X85 A;  3GO5 A;  1BR1 A;  5JHU A;  2A68 F;  5D5X B;  4FQG A;  3TL4 X;  1CQT A;  2XUB A;  1TQI A;  1ONV A;  1RES A;  4AIH A;  3CO7 C;  2A6E F;  2ZKZ A;  3C7J A;  2ECB A;  4KMF A;  3T0Y A;  4ZC3 A;  3COA C;  3ZN0 A;  2PI0 A;  3KFW X;  3H9Q A;  2ZBK A;  2HYG D;  3FXJ A;  5H2F C;  1I39 A;  2K4J A;  2HNH A;  5D6F A;  2BY3 A;  2LFB A;  1X1P A;  4XKW A;  3OS2 A;  3MKZ A;  1HW1 A;  2XF6 A;  3O8H A;  1Y1W J;  1R4N B;  5E20 A;  3J7A O;  5IT3 A;  3J80 K;  3H3U A;  4AVP A;  4E7S A;  3S8P A;  4OOI A;  1B9M A;  1WJA A;  5KAI C;  3WHC A;  2PMU A;  3E6D A;  2COB A;  4UUS A;  3GTL J;  5E1Z B;  4XID A;  5EF6 A;  5E8I A;  3ABK H;  2K7L A;  3HOU J;  5B5E C;  2CW0 F;  4I0A A;  2DJN A;  4RGR A;  3QOE A;  4GGG A;  3VWB A;  4UXN A;  3WTX C;  3DLL F;  4ENK A;  2MSY A;  4ZH4 F;  2M2E A;  1BR4 A;  1EJ9 A;  4RM2 A;  5DCM B;  6PAX A;  1J9I A;  2DMU A;  2BVM A;  1XMA A;  3CCQ I;  4D7M A;  1J5Y A;  1S6L A;  2XRL A;  1YE9 A;  3QPH A;  1BIB A;  1QHG A;  4MQV A;  1JT0 A;  3JRH A;  1S3J A;  4HDV A;  1MBG A;  2E71 A;  3CCJ I;  3CDI A;  3F23 A;  2ZXW H;  3B6A A;  4RBO A;  2COM A;  4GDF A;  2OV7 A;  1FWZ A;  2Q2E B;  2V1N A;  2CWE A;  3VOE A;  2XVC A;  4PFO A;  3KP7 A;  4ASN A;  1JJ8 C;  3MQ0 A;  4FCY A;  4PJJ A;  1SAX A;  4IHS A;  4YIR X;  2JVH A;  5D5U B;  3BWG A;  3M4O J;  5DCM A;  3RKW A;  3LSR A;  2J5O A;  2DMQ A;  3JRB A;  3N4M A;  2QUF A;  1JE8 A;  2R93 J;  4QTR A;  2QKL B;  3GUD A;  1G3S A;  3H5R A;  1UJ8 A;  1PUE E;  1EH7 A;  3LA3 A;  3F6O A;  4B3A A;  4I09 A;  5LRR A;  3WTV C;  2OCC H;  3CD6 I;  1YS7 A;  2EH3 A;  2PLY A;  2L9S A;  1OYI A;  3RJP A;  4FET A;  4NQW B;  4RMN A;  3L09 A;  5A2Q K;  3TOB A;  1P7I A;  4CCL A;  4U7B A;  4DYR A;  1OR7 A;  4EVI A;  1DU6 A;  2LY1 A;  2ZME B;  3WHB A;  3QP5 A;  2QLZ A;  1GT0 C;  2IGO A;  5FKN A;  3L2U A;  2CO5 A;  4YRV A;  5LD2 C;  2UZK A;  1MBH A;  3BPV A;  1N25 A;  2GA1 A;  3WTW C;  1XSX A;  1HKT A;  3H0G J;  2VC0 A;  4MIM A;  3VOD A;  2GA2 A;  3L00 A;  1DPU A;  4V19 K;  4XLA A;  2ZJR F;  2AXT C;  1FYL A;  3W2A A;  2RKH A;  1HKQ A;  2QEN A;  3HM5 A;  1J0R A;  2LY9 A;  4NQW A;  4XKB A;  1XTA A;  4M3F A;  3L2V A;  1ZYR F;  4S05 A;  4O3M A;  1ZGA A;  1BOB A;  4XOT A;  2MH9 A;  1XG1 A;  3LA7 A;  1FZP B;  1LEB A;  4JX4 A;  2GM4 A;  1XCB A;  1FP2 A;  2EFW A;  3JSO A;  2ISZ A;  4C3I J;  1TWH J;  3MZY A;  1AHD P;  4IHV A;  5LGT A;  2V7F A;  3BR0 A;  2AXL A;  5FB2 A;  1WRJ A;  2P7V B;  3TKY A;  3MKW B;  2XV4 S;  5CQE A;  1B4A A;  2VBY A;  4CYC B;  4E4H A;  2M34 A;  1ZH5 A;  4A3C J;  1OCC H;  3BR5 A;  2XF7 A;  4UB8 C;  3I71 A;  1PP7 U;  2DMT A;  2J5P A;  2LRD A;  2VIX A;  3TW6 A;  1KGS A;  4H0E A;  3DBL B;  3IWF A;  3QYB A;  1K83 J;  2V4J C;  2XRO A;  2RQQ A;  2XB5 A;  2HZD A;  1O3T A;  4I7H A;  1M1E B;  4A0X A;  2BY0 A;  1JKR C;  3HUG B;  2VQG A;  2YU9 J;  3G6E I;  3HKZ A;  1E3O C;  2NVU B;  1X4O A;  3VEP A;  3JW4 A;  2P7C B;  3H0D A;  1FOY A;  4CYC A;  4BQN A;  3G3Z A;  2P5L C;  1YX5 A;  5HS9 A;  1DUX C;  3QWL A;  3LQQ A;  2M4K A;  1YIJ I;  5D8K B;  1K78 B;  1OFC X;  3QP6 A;  2E1C A;  4MEY F;  4UV8 A;  1RZ4 A;  5FKK A;  3OSF A;  2ADU A;  4IF4 A;  5DUK A;  4HEA 2;  3SQN A;  3BCB A;  3ZOB A;  5GPA A;  5TGT A;  4B43 A;  2LOO A;  3FF5 A;  4EM1 A;  2ESH A;  4M72 A;  5HLH A;  1VFC A;  2LKS A;  1WH7 A;  3IKT A;  4YIF A;  3HL2 A;  3IH2 A;  5LEK A;  4DBR A;  5FKM A;  1MBJ A;  3IV5 A;  2H1L A;  5KAF C;  2GIV A;  3VYT B;  5GTH C;  3GTM J;  2WA0 A;  5FO5 A;  1BN5 A;  1YI2 I;  2VOD A;  2HWV A;  4ABZ A;  2L4M A;  3A4C A;  4DZJ A;  2W84 A;  1JUM A;  1T08 B;  3GTP J;  1AOY A;  1LVA A;  1D5V A;  5HDG A;  3KP5 A;  4WWC A;  4B48 A;  2R7W A;  4A3G J;  3S32 A;  5C4J J;  5H6Q A;  2M1B A;  2XAJ A;  4PJN A;  4JYK A;  4F7Z A;  2ESN A;  3OYI A;  2QSF X;  4BJ5 C;  1R4M B;  2D45 A;  5K5R A;  4D0P A;  3H5A A;  4GYI A;  2OBP A;  4G12 A;  3CLO A;  2R5Z A;  2NNN A;  3HHH A;  2JUG A;  1ETK A;  2LSO A;  3CJN A;  1BA5 A;  4H4K C;  2IGK A;  5EG0 B;  2Y30 A;  3HOY J;  3L2C A;  2DFE A;  1D8K A;  3JAM K;  4KMU X;  4M3B A;  4CH7 A;  3FXK A;  5D5W B;  4XRF A;  3JTG A;  1DGW Y;  2PJR B;  5J4Y A;  1S7A A;  2PMH A;  2LKX A;  1I1S A;  5CVV A;  4XRS A;  1MZB A;  1XGN A;  2QSG X;  1U5T C;  2FA5 A;  1GVJ A;  3CUQ C;  1IJW C;  3DBH B;  3TMO A;  3G1O A;  5E3N A;  3Q9V A;  4L9V A;  2M4G A;  3UNG C;  1RIO H;  1Z6T A;  2M3A A;  4Y4R A;  2OZU A;  3MZ8 A;  1H8A C;  1LFB A;  5KHD A;  3A2K A;  2FQ4 A;  2L02 A;  2M8G X;  5K5O A;  1AKH B;  1TW3 A;  4ESF A;  1BR2 A;  5J6X A;  2YU3 A;  1X2M A;  1W5S A;  4GYG A;  4E70 A;  1YW7 A;  2YPR A;  3ZMV A;  3AFH A;  1SAU A;  5ED4 A;  4IEJ A;  2Y0S A;  1J59 A;  3ERE D;  1J7K A;  1I5Z A;  4BUP A;  3HHG A;  4M9S A;  1IN6 A;  1P6R A;  2IS4 A;  3I3L A;  1F5T A;  1UG2 A;  1YJ9 I;  1DDN A;  3PO3 J;  4FX4 A;  1JXS A;  1ORK A;  4AVZ A;  3IH4 A;  3QQA A;  1Z77 A;  3P9I A;  5EGO B;  1LVK A;  1UEL B;  3U1D A;  5DD8 A;  1XGS A;  3PQJ A;  3I59 B;  3WG7 H;  3H9J A;  2VJ5 A;  4RB2 C;  4WXC A;  4W97 A;  4F92 B;  1AKH A;  3TED A;  4XR6 A;  1VQK I;  4RB3 C;  5DM7 F;  1SFE A;  3FX3 A;  2Z5U A;  2PN6 A;  4A12 A;  1UHW A;  3NWS A;  2CUF A;  1Z21 A;  3CC7 I;  4OIR F;  1ZLJ A;  5EEH A;  5FRN A;  3BOQ A;  4HX8 A;  2LMD A;  2XSJ C;  3WGI A;  2I8D A;  1BI1 A;  2CSO A;  2ZXH A;  2DOF A;  5HNF A;  4O5V A;  3D0S A;  1MSE C;  4MO7 A;  1KZH A;  3G71 I;  2QWW A;  4AIK A;  2P8T A;  4LFU A;  1RR7 A;  4C2T A;  4DGW B;  4IO9 F;  2ZXJ A;  1FYK A;  3QPS A;  4GRI A;  2JSP A;  1TNT A;  2ZJQ F;  2FEZ A;  5DS9 A;  4E7Z A;  2L5Q A;  3JCU C;  4EAT A;  5BOX A;  1W0U A;  3H3V K;  1MDM B;  3OMY A;  5KK1 A;  4G7Z F;  2MD0 A;  3PUB A;  2V9P A;  4CCN A;  2DXI A;  3BG3 A;  1P7J A;  2V26 A;  2K9S A;  3KP3 A;  2ELK A;  2X0L A;  3BG5 A;  1QRY A;  2EFQ A;  1S5L C;  1IV6 A;  4BU2 A;  3KIO A;  4OIP F;  1TC3 C;  1T8I A;  4XN3 A;  1KYW A;  2XSD C;  3OS0 A;  4AYB A;  1SMY F;  4NB5 A;  5CJ9 A;  4YFK F;  2CYY A;  2PEX A;  3F8F A;  3S15 J;  1FX7 A;  4HOB A;  3SZP A;  1BC8 C;  2BEO A;  3LL7 A;  1A35 A;  2EB7 A;  2IJL A;  2LF8 A;  4A2U A;  2L7M P;  2Y69 H;  2IA2 A;  5J47 A;  1ZAO A;  4A6D A;  3HKZ N;  3F3X A;  4XOR A;  1D1A A;  3F9K A;  4A93 J;  2HTS A;  3PFI A;  3K70 D;  2DJI A;  1KQ0 A;  4M3G A;  1FTZ A;  2TDX A;  1O7F A;  1QZZ A;  3VYR B;  4EJO A;  4PDK A;  3D1N I;  3PSF A;  4WXH A;  4GO1 A;  3OV8 A;  3B6C A;  3JTH A;  4LB6 B;  2F5D A;  1GXQ A;  2N8G A;  3DFG A;  2DT5 A;  3GLL A;  3FIW A;  3U1K A;  2HTJ A;  3MN2 A;  2O8K A;  1V5E A;  2CU7 A;  2EIJ H;  3SZG A;  1HC8 A;  5J3L A;  1S29 A;  1XD7 A;  1B1B A;  2QA4 I;  4HQE A;  3MEX A;  3DCF A;  1BBY A;  2A61 A;  2YUS A;  3KLN A;  1I6X A;  2GBY A;  3KZZ A;  1HQC A;  2OU2 A;  5HLI A;  1S9H A;  3BJA A;  3OR2 C;  1D5Y A;  4BE0 A;  3V8K A;  4G6Q A;  4HF0 A;  4U0W A;  4UVB A;  1Z0X A;  3KPH A;  1G3W A;  2P81 A;  1V55 H;  3KP6 A;  4ZYG A;  1ON2 A;  1ZG3 A;  5D6E A;  3WTY C;  5E79 C;  2DK5 A;  2WAQ A;  5F08 A;  3GFI A;  2DA1 A;  2F4O B;  2JVG A;  3GF2 A;  1ZGJ A;  3K2Z A;  3ZQH A;  1EF4 A;  1Z67 A;  2BY1 A;  2HQA A;  2DLL A;  3LNQ A;  4CIC A;  2HXO A;  4I76 A;  2DT6 A;  3P9K A;  4U0V A;  1OR7 C;  4R79 A;  1RI7 A;  4RLF A;  1DP3 A;  3F8B A;  4JX5 A;  2FXA A;  4RGX A;  2BV6 A;  1MIJ A;  3ZXS A;  5L3F A;  3LST A;  5FLX K;  1FYM A;  4DQ2 A;  1MMA A;  4EJT A;  1TT5 B;  3PSI A;  3Q0V A;  3EYI A;  2CQQ A;  4NC8 A;  2EZH A;  2DCE A;  1W36 D;  3OYM A;  1JKQ C;  4WCG A;  2M8E A;  2CJJ A;  2X1C A;  1ULY A;  2MFZ A;  1IRX A;  4XKV A;  3K1N A;  2K27 A;  3E7L A;  3LQR A;  1PP8 F;  1OMI A;  3OYB A;  1W7P B;  1AU7 A;  3SJM A;  2RN7 A;  4CHU A;  3FWE A;  5TRD A;  3EUH A;  3DEU A;  1HLV A;  1KU9 A;  2FF4 A;  5FRO A;  4J19 A;  3EET A;  2DTZ A;  1VQ6 I;  5HLT A;  2E1N A;  2M7B A;  4LG0 A;  4BQQ A;  3W6K B;  3OYD A;  1RUO A;  3F8M A;  4BAY A;  1U5T B;  3VSK A;  1B8I A;  4A69 C;  3F8C A;  3CUQ B;  2DBB A;  3BQY A;  3HG9 A;  1ZR2 A;  1ZQ3 P;  2DA3 A;  4EJU A;  4CCK A;  1LDK B;  2ZCW A;  1N78 A;  3GCM A;  4CYD A;  2HDW A;  3AKZ A;  2Y0S N;  4L9N A;  2DK8 A;  4WX9 A;  2KLO A;  2GOM A;  1SVL A;  4ZDL A;  2FBH A;  2VOP A;  2CGP A;  5FFZ A;  3IAM 2;  3F72 A;  2OD5 A;  3S2D J;  2E2H J;  2RRE A;  2A5Y B;  2EFN A;  4MFD A;  3OYE A;  4MEX F;  2QCO A;  4ZYH A;  2E1M C;  2L7Z A;  1WPK A;  2MC4 A;  3ZN1 A;  4LK0 F;  5K7F A;  5CVU A;  2WV0 A;  2LBF A;  3ONQ A;  5FKL A;  2BXY A;  2VAS A;  2OF7 A;  1LFP A;  3HJE A;  4PJ0 C;  4YG2 F;  3PJR A;  1OYY A;  4HX7 A;  2O6G E;  3BC8 A;  5ILV A;  2GAU A;  2FRH A;  1Q1H A;  2XKO A;  2KRC A;  4JP0 A;  3RZO J;  2D2W A;  2VKD A;  3HEF A;  4YFN F;  3TP3 A;  3QPT A;  1HDD C;  5CQG A;  3CCL I;  3HRS A;  3QU6 A;  2LD5 A;  1WWX A;  1BI3 A;  2OAZ A;  3SFZ A;  3G73 A;  2W7N A;  2KDO A;  3CZ6 A;  2XRN A;  1SFO J;  2R5Y B;  4BJ6 C;  5M5W J;  3Q0W A;  2VB6 A;  2EIM H;  1VQ4 I;  2DPU A;  4YEJ A;  1WKM A;  2VQC A;  1QHH D;  3J80 Z;  1KON A;  3E0J B;  4CSW A;  5LHI A;  4PFP A;  3WU0 A;  3PNV A;  1TQP A;  4II3 A;  2RGV A;  2EIK H;  3OYC A;  2MA3 A;  5HOD A;  2I10 A;  3E1S A;  1T56 A;  2Z9O A;  4BE2 A;  1QO0 D;  4AYB N;  1TWF J;  4XLP F;  2B7E A;  1U0J A;  4M6Y A;  1K61 A;  3OY9 A;  4P55 A;  1LKX A;  1GXP A;  1OCT C;  2JZY A;  1VND A;  4OAZ A;  1R36 A;  4XKC A;  1ACI A;  1TQM A;  1X3U A;  3PIO F;  1RRJ A;  1K4S A;  3HOV J;  3QOD A;  3IRR A;  2CUJ A;  5J1U A;  3S1Q J;  3GTJ J;  3HDD A;  1X2N A;  5K7Z A;  1W5T A;  1ODD A;  2VKE A;  1ETW A;  4HV5 A;  4HNT A;  3HYI A;  3LFU A;  1CF7 A;  3PUF A;  3LA2 A;  4N9H A;  4RAG A;  3DWL E;  3TO6 A;  4XRS G;  5CYV A;  4UUS B;  5C3E J;  2IVM A;  3Q0U A;  2MH2 A;  1XDS A;  2F5F A;  1B72 A;  4ENM A;  3ZPL A;  2L0K A;  1R49 A;  3R0J A;  2KIQ A;  1LNW A;  2WAE A;  3GFJ A;  2W82 A;  2EZL A;  4BDZ A;  3GTQ J;  1PYV A;  1X1A A;  2XHK A;  3FM3 A;  3GWZ A;  2V1D A;  3BLY A;  5HVQ C;  2GIZ A;  3GTK J;  1R5G A;  1O3S A;  2HVQ A;  5ICF A;  3CCM I;  5A2Q Z;  2R7S A;  4RB0 A;  3T8T A;  3GTG J;  4L9T A;  4HDU A;  1I6H J;  3BG6 A;  2CUZ A;  4GFB A;  2VQH A;  2HEO A;  1VQ8 I;  3HGY A;  2WAQ N;  3ABT A;  1OKR A;  1GUU A;  1U6G A;  4I0B A;  4RS8 A;  4NC6 A;  3TO9 A;  3S16 J;  3EUA A;  3FBN B;  4D5C A;  2EK5 A;  3K0L A;  4M6V A;  3WTS C;  4BYY A;  4LLN A;  3BPX A;  2BBY A;  3CCY A;  5E3L A;  1XB4 A;  2XGX A;  1BW6 A;  3L9F A;  3BTC A;  1WGX A;  2K9M A;  2GXB A;  3G1L A;  1F1Z A;  1U9N A;  1F4K A;  1W5C C;  2ACJ A;  3I9V 2;  2P6S A;  5CPR B;  1A5J A;  1HBX G;  5JR3 A;  2WV1 A;  2XGC A;  1R5H A;  3HC7 A;  3I64 A;  3BG7 A;  1BC7 C;  1YW8 A;  2IT0 A;  1K6Y A;  1MNE A;  2XAU A;  1MGT A;  2V9K A;  3H92 A;  2R0Q C;  1QNT A;  1YIT I;  1Z9C A;  2Y0M A;  4CDG A;  1MMD A;  2VPR A;  4E7J A;  5FJ8 J;  1STZ A;  3VDX A;  2C6Y A;  3DTI A;  1HKS A;  2JJ7 A;  3K4K A;  2JA5 J;  1WJD A;  2VQL A;  1UMQ A;  1Y1V J;  3M8J A;  1WSU A;  3HPG A;  1IUF A;  1ETY A;  1TP4 A;  4EM0 B;  3VPR A;  4M3E A;  2OTL I;  1S72 I;  2VXD A;  3L7W A;  3V42 A;  1T0F A;  1P4W A;  4L0Y B;  1IRG A;  5DV5 A;  1W0T A;  4J00 A;  3BR6 A;  3K1P A;  1GV2 A;  1NTC A;  3TBI A;  4XSZ F;  3S3M A;  3BQZ A;  1G3Y A;  4ANJ A;  2HFH A;  2WY8 Q;  2RAE A;  2CQ7 A;  4F55 A;  2Q0O A;  4DJA A;  1XCV A;  3F0C A;  4BEH A;  1BI2 A;  4V2G A;  3WTT C;  4V2F A;  2QM3 A;  1FBS A;  4MFE A;  2CW8 A;  3NAU A;  3JRI A;  2L3D A;  3CJQ B;  5M5Y J;  4DYC A;  1MJA A;  1X3W B;  2DFH A;  1DU0 A;  4I6Z A;  1H9T A;  3OYL A;  3LSP A;  3TDZ C;  2WY7 Q;  3E97 A;  1USS A;  1W1W E;  3HIF A;  3C2G A;  3J7Y J;  4GXO A;  2WBM A;  4IQJ A;  3LWF A;  3WG9 A;  4GCV A;  4ZTF A;  3SHF A;  2V79 A;  3HSF A;  2NVX J;  4E7K A;  2E1M B;  2Z33 A;  3K10 A;  3ZQG A;  4LLG F;  3IP4 B;  4U88 A;  2DW4 A;  3AG4 H;  4LMY A;  3IAS 2;  1R5I D;  2K85 A;  3K7A J;  3KYC B;  3OYN A;  2EJR A;  4QSH A;  1ZRF A;  1IG7 A;  2K3P A;  4Q48 A;  4EM2 A;  3CTA A;  1SVO A;  2LTP A;  4DOZ A;  5ERI A;  3ZQ7 A;  3K9T A;  5GP9 A;  1OCR H;  5KCM A;  2IA1 A;  1P9Q C;  3GW2 A;  3HOX J;  1ZK8 A;  5LRS A;  3IRQ A;  5E3O A;  1Y0N A;  2VE8 A;  3JRD A;  3CC2 I;  4U0Y A;  4PGH A;  2FNP A;  1FEX A;  4LLL A;  4OMY A;  3LAJ A;  3M8F A;  1R71 A;  3OIP A;  2ID3 A;  3VB2 A;  1JGG A;  2O61 A;  2Z99 A;  2ZSI B;  3LSI A;  2IRF G;  3JAM Z;  3N05 A;  4RA2 A;  4HAM A;  2V1X A;  4PJM A;  3LSM A;  2OUM A;  2OZ6 A;  5F1R A;  2IEK A;  2EIN H;  2V6C A;  3H35 A;  2IPQ X;  1TTY A;  2K86 A;  4NBQ A;  4S0H B;  1LDJ A;  3EYY A;  2O3F A;  4ZYA A;  4ENJ A;  1YX3 A;  3WE3 A;  3K70 C;  1T2K A;  3OS1 A;  3HSR A;  1JHF A;  2DQR A;  1OCZ H;  1Y8Q B;  2DDB A;  2W24 A;  3DKY A;  3TW7 A;  1GDT A;  1Z7U A;  4HG2 A;  2R5Z B;  1Z05 A;  2A05 A;  4JOM A;  4CCM A;  2EIL H;  1Z6R A;  3BR1 A;  1S7E A;  3O3K A;  4P1W A;  1QZY A;  1EKE A;  3S1N J;  4G6T B;  1YRN A;  1ERD A;  4KA4 A;  3ZMZ A;  2MYS A;  3IL2 A;  4YEL A;  3EUH C;  2QQ8 A;  1HOM A;  2PG4 A;  2G0E A;  1RKW A;  2K5C A;  4R1H A;  1IXR C;  4QWQ A;  3QYE A;  1Y0U A;  3KLO A;  3S2H J;  1VQ5 I;  2K4B A;  3Q9S A;  2HQ5 A;  5FGM A;  2CMP A;  4XLN F;  1Y39 A;  4YII A;  3DXJ F;  2XF5 A;  3HPH A;  5FFX A;  2EZK A;  2E2I J;  4LOC A;  5JVT A;  4HST A;  1R9T J;  1BM9 A;  1XX5 A;  2K40 A;  2X6X A;  3BJO A;  4AID A;  2F4I A;  3TQN A;  3KEY A;  5BNG A;  2QQ9 A;  4HYE A;  3C2H A;  2TCT A;  2M9H A;  1MSF C;  3N97 A;  2H09 A;  2L01 A;  4HSR A;  2DOD A;  1NG7 A;  2MC3 A;  2VL8 A;  2W1O A;  2PMZ A;  5J1Y A;  2YS9 A;  3J81 K;  2STW A;  3IH3 A;  3KYL A;  2KJC A;  1YJN I;  4Q5S F;  3ZRG A;  4A3J J;  3M7G A;  2HOT A;  3FXU A;  2X6W A;  3PNY A;  5EDN A;  1TW2 A;  4X1E A;  4S04 A;  3HGG A;  5ICG A;  5EEG A;  4CUG A;  2L9N A;  1W36 C;  4RM3 A;  1ZR4 A;  1LE8 A;  1KQ9 A;  2ELJ A;  2XKP A;  2EWN A;  2HYF A;  2WAF A;  2W48 A;  4XOP A;  2A6H F;  2MBF A;  3BR3 A;  1K6O A;  2JWT A;  3BZK A;  3ERM A;  3NWT A;  3OOP A;  4XON A;  4L0Z B;  2HQR A;  2UXX A;  2W00 A;  3S1R J;  1YO5 C;  2HZT A;  3CCU I;  1FY7 A;  3HTS B;  2CQX A;  2B9S A;  2NOJ B;  3BZ6 A;  5E3M A;  5IT9 K;  1WJF A;  4U7D A;  3GTO J;  2HXI A;  1SAN A;  1WJE A;  2VT3 A;  3TDU C;  2W57 A;  3ZCO A;  3HBL A;  1DQU A;  5IYD J;  3K4L A;  1JI8 A;  4BS9 A;  1KU7 A;  3R61 A;  1AA7 A;  1SD5 A;  3FMR A;  1JKP C;  4IRG A;  2FU4 A;  2YSR A;  3HTU A;  5DCF A;  2QBY A;  4LIV A;  5BPI A;  5JHF A;  2R3S A;  5HNH A;  1U3E M;  2E7W A;  3PL8 A;  5LHH A;  4MTD A;  5IP7 J;  2K9N A;  4RLQ A;  4A3K J;  2NYX A;  3OOU A;  1ZRC A;  1ZG1 A;  3BY6 A;  5IP9 J;  3AG3 H;  3GME A;  4A3L J;  1D3Y A;  3ZQC A;  2K9L A;  2UV1 A;  3IUO A;  2B63 J;  1EH6 A;  1Z3X A;  2DN0 A;  2YX4 A;  2UUZ A;  2HYJ A;  2GXA A;  2KIM A;  2KIF A;  3ROU A;  1FBQ A;  2XPU A;  4AM3 A;  3L2W A;  4P9U A;  1HST A;  1TWG J;  2FJ1 A;  2I5U A;  2RQP A;  2E36 A;  2ZC2 A;  3JSP A;  2XPV A;  2DYS H;  3W3C A;  5HLG A;  2QZ8 A;  1JGS A;  3CQZ J;  4G7O F;  3SXY A;  3DPU A;  2WTE A;  3CC4 I;  2IW5 A;  4C30 A;  5FLM J;  2CH0 A;  4P96 A;  3T5X A;  1ZKG A;  2CV1 A;  5ICE A;  3W6V A;  3Q3S A;  5KVR A;  1FIA A;  3AL0 C;  3VSL A;  1R6R A;  3SDG A;  3M9A A;  2JK3 A;  3DU6 A;  4ZDO A;  1IDZ A;  2P5V A;  2V1U A;  2ZB9 A;  5DD4 A;  4ZYD A;  3ABM H;  1R23 A;  3WGH A;  3H5N A;  2R7V A;  3U21 A;  4BQA A;  3JRA A;  4KIT B;  4YFX F;  3VYU B;  2FX0 A;  2VI6 A;  4MNU A;  4OIQ F;  4B3X A;  3REO A;  2NVQ J;  1JT6 A;  4BJT A;  4MQ9 F;  3C3W A;  4C9Y A;  2E60 A;  1HA8 A;  4IKF A;  3K4M A;  3I56 I;  4XBF A;  5FLX Z;  4M6X A;  1OPC A;  2PBI A;  3FKJ A;  3A02 A;  5CVI A;  4BY1 J;  5BQT A;  2DU9 A;  2O03 A;  4EV0 A;  5FD6 A;  3RSN A;  1X19 A;  2KRF A;  2EV0 A;  2PX9 A;  3L2Q A;  1T39 A;  2HVS A;  3SFI A;  2DDA A;  2LC2 A;  2A3S A;  2Q8K A;  3WTU C;  2E5Z A;  4G6D A;  4XIC A;  1ITY A;  1HCR A;  2HKO A;  1WH5 A;  1U9O A;  3E6M A;  1K4T A;  3M07 A;  2IS6 A;  2STT A;  4HX4 A;  1YS6 A;  5CVJ A;  4MLO A;  4FAS D;  3FXM A;  3S93 A;  3VYS B;  1X1B A;  4BBR J;  4O6J A;  4K2E A;  2KKO A;  3ZQI A;  2FOW A;  2Y48 A;  3KZI C;  1PUF A;  2VBZ A;  4G8X A;  4B8X A;  3CMY A;  1VQN I;  1I1G A;  3S3O A;  1FTT A;  4UY8 I;  3E5U A;  4QLC U;  4IPA A;  2BHZ A;  5CLS A;  1UFM A;  3RIR A;  3BJ6 A;  5FRM A;  3NEU A;  1OLT A;  2W85 A;  1PDN C;  2IS2 A;  2JMW A;  4HRI A;  1ETQ A;  2HVR A;  1HDP A;  2HPI A;  2ZFW A;  3HB9 A;  4XLF A;  2O9L A;  3L1P A;  2JT1 A;  1FNN A;  2L7K A;  1T38 A;  5E17 F;  5DYM A;  1T0F C;  1F43 A;  5AIQ A;  5CVR A;  5F0C A;  2WB1 A;  3TP0 A;  3S3N A;  1DP7 P;  2KRH A;  2R7X A;  5GAG J;  1P4X A;  2IS1 A;  3V7S A;  2P0W A;  4IRH A;  4BHB A;  1NG6 A;  4LG0 B;  1LUJ B;  1IN7 A;  1MJ9 A;  3GFM A;  4HW0 A;  4LIU A;  1B8I B;  4BGD A;  4XN0 A;  2ZXI A;  1FOK A;  3G2B A;  3V8L A;  1SFK A;  2PFB A;  1MBE A;  3CF2 A;  3W2W A;  2PMZ N;  4Y52 J;  4IHX A;  2KHM A;  4M71 A;  2BOL A;  2FQ3 A;  1QVT A;  4MGR A;  2VJJ A;  3RZD J;  4XMY A;  2V6E A;  1E3P A;  3S2W A;  4RDU A;  1WHU A;  4AU7 A;  1RC9 A;  5B3S H;  2GQQ A;  5EZH A;  2XAG A;  3CF5 F;  2RV8 A;  3T8R A;  5LGN A;  4CXF A;  2QYO A;  2JA8 J;  2LG4 A;  4PK4 A;  5B1B H;  4KUM A;  1P4A A;  3HOZ J;  4KFC A;  1MH4 A;  1IN4 A;  3DQV C;  2LBF B;  2QKM B;  1OJL A;  2EPF A;  2FOK A;  1WQ2 A;  1XMK A;  1VTN C;  1OIS A;  1Y6I A;  2W4S A;  3PQK A;  1ZGW A;  3DPL C;  3FHZ A;  1REP C;  3GFL A;  4DIQ A;  4M74 A;  3T1B A;  2E35 A;  4ENN A;  3WU2 C;  1FOX A;  2DFF A;  2ID6 A;  3IC7 A;  1EV7 A;  3KX2 A;  3MZH A;  2FMY A;  1TNS A;  4PJL A;  4W1U A;  1TWA J;  1FIP A;  5L3B A;  3JR9 A;  3K4C A;  3ISP A;  1YYV A;  2R7Q A;  4CZZ A;  2QGU A;  1KYZ A;  1O7L A;  2CQN A;  2R7F A;  1R7J A;  5LEJ A;  4FTH A;  1VQL I;  1XN7 A;  3EQL F;  3O6B B;  1O4X A;  3HOW J;  2JA2 A;  2JRT A;  2HGC A;  2EBI A;  1WZ2 A;  3E5Q A; 
#chains in the Genus database with same CATH homology
 1JUS A;  2R0Q C;  4A3G J;  5C4J J;  2VPR A;  4JYK A;  5FJ8 J;  3BTI A;  4BY7 J;  2VKV A;  2JJ7 A;  2X48 A;  4G12 A;  2JA5 J;  2HI3 A;  2R5Z A;  1ETK A;  1QPI A;  1ETO A;  1GV5 A;  1UMQ A;  1Y1V J;  1BA5 A;  1RPW A;  1IUF A;  1ETY A;  5F04 A;  5GPC A;  4FE7 A;  5IPA A;  2Y9Y A;  3VPR A;  4M3E A;  5EG0 B;  2Y30 A;  3HOY J;  4JX6 A;  2NVT J;  1W0T A;  4M3B A;  3BR6 A;  3I4M J;  1GV2 A;  1NTC A;  3BQZ A;  5C44 J;  2LKX A;  2RAE A;  5EYR A;  4XRS A;  3F0C A;  1I3Q J;  1IJW C;  1JKO C;  4V2G A;  3G1O A;  5E3N A;  1APL C;  3OSG A;  3S14 J;  4V2F A;  4DYQ A;  1WI3 A;  1A6I A;  4MFE A;  2NVY J;  2MW8 A;  1Q1V A;  3NAU A;  3JRI A;  1H8A C;  2LP0 A;  2LVS A;  1B72 B;  1LFB A;  5EZG A;  5M5Y J;  4DYC A;  2FQ4 A;  1DU0 A;  2M8G X;  4I6Z A;  3LSP A;  9ANT A;  1AKH B;  1JJ6 C;  1X2M A;  2DA7 A;  1IGN A;  3ZQL A;  2DMN A;  4IEJ A;  2NVX J;  3FKI J;  3FIS A;  4XK4 A;  3ZQG A;  2XGD A;  4DZP A;  4AC0 A;  1UG2 A;  5IP6 A;  3PO3 J;  2M0C A;  1OCP A;  1ORK A;  4NDL A;  3IH4 A;  3K7A J;  3QQA A;  1Z77 A;  4QSH A;  1JUP A;  2NS7 A;  5EGO B;  1IG7 A;  2LR8 A;  2LTP A;  1ENH A;  5GP9 A;  1AKH A;  4W97 A;  5M3F J;  3HOX J;  3TED A;  1ZK8 A;  2R7Z J;  1QVU A;  2QF7 A;  5E3O A;  3JRD A;  2CUF A;  1FEX A;  1WCM J;  2ECC A;  2ID3 A;  1JGG A;  2JA6 J;  1H89 C;  5K7H A;  2XGE A;  2L9R A;  3BTL A;  2ME0 A;  3K2A A;  4IHY A;  1MSE C;  3BR2 A;  2NS8 A;  4MO7 A;  2DA2 A;  2IEK A;  1JTY A;  1RR7 A;  2MG4 A;  4S0H B;  1GVD A;  3S17 J;  3QPS A;  3M3Y J;  3QPL A;  5DS9 A;  2EZI A;  2KDZ A;  2DA5 A;  1I50 J;  2WB1 N;  4C3J J;  1POG A;  1F36 A;  3TW7 A;  1GDT A;  1JTX A;  1W0U A;  3H3V K;  2R5Z B;  5IYB J;  3BG3 A;  1P7J A;  2K9S A;  5JLX A;  3BR1 A;  1S7E A;  2ELK A;  3PM1 A;  3BG5 A;  1QRY A;  2K9Q A;  1IV6 A;  5F0F A;  1YRN A;  3S1N J;  2XB0 X;  1XS9 A;  1TC3 C;  2X9D A;  1HOM A;  2O7O A;  1NK3 P;  2G0E A;  1RKW A;  2XSD C;  1UHS A;  4EEF G;  1TWC J;  3S2H J;  3S15 J;  2DA4 A;  2L7M P;  2HQ5 A;  3HKZ N;  2NOG A;  2EZK A;  2E2I J;  2H1K A;  4LOC A;  2JA7 J;  4A93 J;  1R9T J;  3JRE A;  2K40 A;  3DEW A;  5C4X J;  4M3G A;  1FTZ A;  5BNG A;  2Y2Z A;  4D5F A;  3OIO A;  2TCT A;  2L7F P;  3D1N I;  2M9H A;  1MSF C;  3B6C A;  5DTD A;  2N8G A;  5M5X J;  2Y9Z A;  3C2B A;  3FIW A;  4A3M J;  5J1Y A;  3MN2 A;  5FKO A;  2YS9 A;  2O8K A;  5M3M J;  2CU7 A;  5J3L A;  3IH3 A;  5IOZ A;  1XC5 A;  2FD5 A;  3DCF A;  2YUS A;  4A3J J;  2HOT A;  4X6A J;  4DW6 A;  1BW5 A;  1BJZ A;  2GBY A;  5EDN A;  1U78 A;  4X1E A;  3LSJ A;  1MBK A;  3HGG A;  2TRT A;  2Y31 A;  1D5Y A;  3BT9 A;  4FE4 A;  4AUX A;  1ZR4 A;  1LE8 A;  3FK6 A;  1Z0X A;  2W48 A;  2CRG A;  2P81 A;  3BR3 A;  2JWT A;  1MBF A;  5EEA A;  2X6O A;  4QIW N;  2JN6 A;  5F08 A;  2DA1 A;  3S1R J;  1ETX A;  1EF4 A;  3ZQH A;  2CQX A;  3MKL A;  2R5Y A;  3LNQ A;  3LOC A;  5E3M A;  4IHW A;  2HXO A;  4I76 A;  4A3I J;  3GTO J;  2HXI A;  1IRZ A;  1SAN A;  4JX5 A;  3HBL A;  5IYD J;  1RKT A;  2DMP A;  1ETV A;  1FJL A;  1JKP C;  2HDD A;  1MH3 A;  3Q0V A;  2CQQ A;  5IP7 J;  2EZH A;  4D7N A;  1LFU P;  2K9N A;  3ZQF A;  4A3K J;  1JKQ C;  3OOU A;  1CQT A;  2CUE A;  4L5E A;  2CJJ A;  1RES A;  3BG9 A;  5IP9 J;  4A3L J;  2ECB A;  3ZQC A;  2XPW A;  1G2H A;  2IAI A;  3BTJ A;  3E7L A;  4Y7N J;  2B63 J;  2VUM J;  3A03 A;  2DN0 A;  1AU7 A;  3SJM A;  1YRN B;  2HYJ A;  2LFB A;  4A3E J;  1HLV A;  3PO2 J;  2XPU A;  3O8H A;  1IDY A;  4J19 A;  1Y1W J;  2DTZ A;  1TWG J;  4A3B J;  2FJ1 A;  2E2J J;  2ME6 A;  1BL0 A;  3JRC A;  2XPV A;  3WHC A;  4C2M J;  1IC8 A;  1B8I A;  4A69 C;  1ZQ3 P;  3BQY A;  1ZR2 A;  2DA3 A;  2GLO A;  2COB A;  4UUS A;  3CQZ J;  3GTL J;  4XID A;  1T33 A;  5EF6 A;  3HOU J;  2DJN A;  2Y0S N;  4BXX J;  2MSY A;  2HOA A;  2M2E A;  5FLM J;  1ZKG A;  3W6V A;  3Q3S A;  1FIA A;  2AO9 A;  3S2D J;  2E2H J;  2DMU A;  4D7M A;  4MFD A;  3SDG A;  2R92 J;  2XRL A;  2JK3 A;  1JT0 A;  4C3H J;  1IDZ A;  2QCO A;  3JRH A;  2ZB9 A;  4HNV A;  1MBG A;  2L7Z A;  1WPK A;  4B1R A;  3JRA A;  2E19 A;  3B6A A;  5K7F A;  4RBO A;  2DA6 A;  1X58 A;  2FX0 A;  2VI6 A;  5FKL A;  4FIS A;  1RET A;  1JT6 A;  2OF7 A;  2NVQ J;  1VF9 A;  1JJ8 C;  2IBD A;  4FCY A;  3LSG A;  3G1M A;  3A02 A;  4BY1 J;  3M4O J;  4JP0 A;  3LSR A;  3JRB A;  2DMQ A;  1LE8 B;  2R93 J;  3RZO J;  4QTR A;  3HEF A;  3SFI A;  3TP3 A;  5F27 A;  1HDD C;  4XIC A;  1ITY A;  2LD5 A;  3RKQ A;  4B3A A;  1HCR A;  2OPT A;  1WH5 A;  1U9O A;  5IYC J;  2EH3 A;  1SFO J;  3RQI A;  2R5Y B;  4MLO A;  1P7I A;  5M5W J;  3S1M J;  3Q0W A;  1DU6 A;  4DYR A;  4BBR J;  3WHB A;  1GT0 C;  3ZQI A;  5FKN A;  1PUF A;  1H88 C;  1MBH A;  3CMY A;  1FTT A;  3H0G J;  4A3F J;  4MIM A;  5HOD A;  2I10 A;  2JMW A;  1T56 A;  3HM5 A;  1ETQ A;  2LK2 A;  1HDP A;  3HB9 A;  2LY9 A;  4AYB N;  2H8R A;  4M3F A;  1TWF J;  2O9L A;  3L1P A;  3JRF A;  1XG1 A;  5EG0 A;  4JX4 A;  2GM4 A;  4M3D A;  4BBS J;  1F43 A;  1K61 A;  3CDL A;  1OCT C;  1ZTR A;  5F0C A;  1TWH J;  1VND A;  4C3I J;  1AHD P;  4IHV A;  3TP0 A;  3BR0 A;  3HOV J;  3S1Q J;  5J1U A;  4B4C A;  3GTJ J;  3HDD A;  1X2N A;  5K7Z A;  1HF0 A;  2VKE A;  1ETW A;  2HOS A;  4CYC B;  2M34 A;  4A3C J;  2KT0 A;  3BR5 A;  2DMT A;  4XRS G;  1B8I B;  4BKX A;  3TW6 A;  3FK7 A;  4UUS B;  5C3E J;  3Q0U A;  1MBE A;  2D5V A;  2PMZ N;  4A3D J;  1B72 A;  3MVP A;  1NK2 P;  4Y52 J;  1K83 J;  4IHX A;  2E1O A;  2XB5 A;  2L0K A;  1QVT A;  3RZD J;  2EZL A;  4RDU A;  3GTQ J;  3GBG A;  1JKR C;  3UKG A;  2YU9 J;  5EZH A;  3NAR A;  1E3O C;  5JLW A;  3GTK J;  2JA8 J;  4CYC A;  1MNM C;  2AHQ A;  4XRM A;  3HOZ J;  3GTG J;  1MH4 A;  1I6H J;  4GFB A;  1OFC X;  1OJL A;  3A01 B;  5EGO A;  5FKK A;  3OSF A;  2EQR A;  3HGY A;  3ZOB A;  2WAQ N;  3S16 J;  1GUU A;  2LLK A;  5GPA A;  1ZGW A;  5F1J A;  3O8G A;  5J1R A;  4D5C A;  4M6V A;  4UUT A;  1VFC A;  1WH7 A;  3IH2 A;  3JRG A;  3CCY A;  5FKM A;  2ID6 A;  5E3L A;  3I4N J;  1MBJ A;  5IOY A;  3IV5 A;  1BW6 A;  3BTC A;  1VI0 A;  1WGX A;  3GTM J;  2MGQ A;  4W1U A;  1TWA J;  1FIP A;  3G1L A;  1U9N A;  3JR9 A;  1A5J A;  5F0H A;  4ABZ A;  4DZJ A;  3A01 A;  2WV1 A;  2XGC A;  1JUM A;  4FTH A;  1O4X A;  1U8B A;  3GTP J;  3HOW J;  5FLV A;  2EBI A;  1PUF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...