3RZTA

Neutron structure of perdeuterated rubredoxin using rapid (14 hours) data
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
51
structure length
51
Chain Sequence
b'AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Rapid visualization of hydrogen positions in protein neutron crystallographic structures.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Electron transport
total genus 10
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3rztA00
2PVEA 1VCXA 1BQ8A 1R0GA 3RYGA 1BE7A 1SMWA 4POFA 5RXNA 1RDGA 2MS3A 1FHMA 3MPSA 3KYYA 1T9PA 3RZTA 2HR5A 3PZAA 1RDVA 5IY0A 1E8JA 5AI2A 1B13A 4AR6A 1LKOA 1BFYA 3KYWA 2PYAA 1DVBA 1IU5A 1LKPA 1S30A 2PVXA 2GMGA 5AI3A 2LCQA 2VL6A 3KYUA 6RXNA 1QYBA 2V3BB 1DX8A 1S24A 1SMMA 3QVDA 1FHHA 4POGA 3A44A 1LTLA 1H7VA 1IU6A 4YWLA 1B2JA 1LKMA 4YWMA 4TPUA 1IRNA 1B71A 1RWDA 1ZRPA 1C09A 1QCVA 1YV1A 4K9FA 3RZ6A 1B2OA 7RXNA 3PWFA 1JYBA 1S2ZA 8RXNA 2KKDA 2M4YA 1T9OA 1IROA 1R0HA 1YUZA 3KYXA 4AR3A 4AR5A 2QL0A 1CADA 1BQ9A 4RXNA 1BRFA 1YK5A 1CAAA 2KN9A 1NNQA 1RYTA 2K2DA 1T9QA 1YUXA 1RB9A 1R0IA 2RDVA 3KYVA 1SMUA 1R0JA 1R0FA 1YK4A 3SS2A 4AR4A 4ME3A 2DSXA
chains in the Genus database with same CATH superfamily
1BQ8A 4ZN3B 2C6BA 2V0FA 3K35A 3GTOL 2NVQL 2B5ID 4C3IL 2MS3A 3FKIL 3MPSA 3KYYA 1F4LA 3RZTA 1TWHL 1VZIA 3PZAA 2PMZP 1BFYA 2A6HD 4E6YA 4JAFA 1IU5A 1S30A 2PVXA 5FLML 1P7PA 3H9CA 3K7AL 6RXNA 3H97A 2Z3QB 3WWNB 2PSMC 1QYBA 3PKJA 3PO3L 5C44L 4U671 2J9UB 1FHHA 5MFZA 1VZHA 5MLC3 3GTQL 3S16L 4V196 5C4XL 4Y7NL 3GTLL 4YWMA 4TPUA 4B8CD 1B71A 1NXGA 4BXXL 1QCVA 3LWOB 3RZ6A 7RXNA 4A3LL 3PWFA 2NYDA 4AHZA 1T9OA 1IROA 2JA7L 3J7Y1 4JAGA 2NVYL 1BRFA 3MSUA 3LWPB 1YK5A 2ERJA 2A68D 2KN9A 3VPBE 1NNQA 1RYTA 1T9QA 1R0IA 5MGNA 1SMUA 3S2DL 1R0JA 1R0FA 3HAXC 3S17L 2R7ZL 1Y1VL 4ME3A 4JAEA 5M3ML 2XJTA 3P8BA 2R93L 2A6ED 1K83L 4UY81 3S1RL 5RXNA 2H12A 3M4OL 1PFUA 4XGHA 5M3FL 2VUML 4AYBP 4G6BA 5MFPA 2NVXL 4A3KL 3S1QL 5IY0A 1PFYA 3KYWA 2R92L 3S1ML 2JA8L 3LPEB 2B63L 2XJUA 2E2JL 5M5XL 2VL6A 2V3BB 1DX8A 5JVG1 1SMMA 4A3DL 3A44A 1H7VA 3HOVL 1B2JA 2EY4E 4ZN1B 4BBRL 4BY1L 2HVYC 3HJWB 3PO2L 1RWDA 3I4NL 1R9TL 1TWFL 4K9FA 1RYQA 1B2OA 3HKZP 4TVMA 4X6AL 5IYBL 4A3ML 3S15L 2KKDA 2M4YA 4QIWP 1R0HA 1YUZA 3ZG6A 1BQ9A 4RXNA 3JR7A 1TWCL 1PZXA 5FJ8L 2O5JD 3PIP1 5H1Sc 3IU3I 1YUXA 2RDVA 4AI0A 1YK4A 5IYDL 3PIO1 3SS2A 5EINC 2DSXA 5DM71 2PVEA 1WCML 5DM61 4WFN1 5GAGc 1BE7A 1SMWA 5K2ME 3J7Z1 3B08B 1FHMA 2Y0SP 3HOYL 1T9PA 3S14L 2JA5L 2HR5A 1Y1WL 3GTGL 5C4JL 2JA6L 2XJPA 1WJVA 4AR6A 3MQKB 2WAQP 1LKOA 5AN9H 1DVBA 1LKPA 2LCQA 3KYUA 2A69D 4XXBB 4AI1A 1ODHA 1S24A 2C6AA 3QVDA 3HJYB 3P2AA 4A3FL 4POGA 2Z3RB 4Y52L 3S2HL 1IU6A 4AI2A 4YWLA 2AQCA 2JI2A 4AHWA 2BE5D 4A3GL 4GS7D 4AI3A 1PFVA 2M6PA 1ZRPA 1YV1A 5M5YL 1NXEA 4A3JL 2RFKB 1I3QL 2XJQA 3RZDL 4LHLA 2QL0A 5IYCL 1CADA 2XJSA 1SFOL 3I4ML 2E2HL 3PL5A 4AHXA 2K2DA 2M6OA 1RB9A 3KYVA 3GTML 1OWBA 2L0ZA 3H9BA 2JI1A 5IP7L 4AR4A 2WB1P 4A3EL 5EIOC 1VCXA 1I6HL 1R0GA 3RYGA 4A3CL 4POFA 3HOWL 3LWRB 3PKIA 1TWAL 1RDGA 3HOZL 3LWVB 1Z92B 1I50L 1RDVA 5IP9L 1E8JA 5AI2A 1B13A 2PYAA 4LHNA 1PFWA 2GMGA 5AI3A 2NVTL 4C3HL 2APOB 2ERSA 5GAEc 4A3IL 3M3YL 1OWCA 4C2M1 4JADA 4A93L 1IW7D 3LNLA 1VZGA 2V0EA 3RZOL 2M4VA 2AYJA 3CQZL 2AUSB 3H3VM 2XJRA 2CR8A 2E2IL 1LTLA 2YU9L 4C3JL 3FDJA 1TWGL 5M5WL 1LKMA 4BBSL 3NFPI 1IRNA 3H0GL 2ZIXA 1C09A 3S1NL 2CKCA 5MF6A 5GADc 1JYBA 1S2ZA 3GTKL 4A3BL 8RXNA 3WWLA 3HOXL 3KYXA 4AR3A 4AR5A 5GAHc 5C3EL 3HOUL 2PPTA 4AHYA 3GTPL 3QQCE 3H99A 1CAAA 2JI3A 2XJVA 1QQTA 3B0AB 3GTJL 2CKAA 4BY7L 3LWQB 5JVH1
chains in the Genus database with same CATH topology
2PVEA 1VCXA 1BQ8A 2XJTA 3P8BA 1R0GA 4ZN3B 5DM61 4WFN1 3RYGA 5GAGc 1BE7A 2C6BA 2A6ED 1SMWA 2V0FA 3K35A 4POFA 4UY81 5RXNA 2H12A 5K2ME 3J7Z1 3PKIA 2B5ID 3B08B 1RDGA 2MS3A 1FHMA 4XGHA 3MPSA 3KYYA 1T9PA 1Z92B 3RZTA 5JVH1 2HR5A 1VZIA 4G6BA 5MFPA 3PZAA 1RDVA 5IY0A 1E8JA 5AI2A 1B13A 2XJPA 1WJVA 4AR6A 1LKOA 1BFYA 3KYWA 5AN9H 2PYAA 2A6HD 4E6YA 4LHNA 1DVBA 4JAFA 1IU5A 1LKPA 3LPEB 1S30A 2PVXA 2GMGA 5AI3A 2LCQA 2XJUA 5EIOC 2VL6A 3KYUA 2ERSA 6RXNA 2Z3QB 2A69D 4XXBB 2PSMC 3WWNB 4AI1A 1QYBA 2V3BB 3PKJA 5GAEc 1ODHA 1DX8A 1S24A 5JVG1 1SMMA 1OWCA 2C6AA 3QVDA 4U671 4JADA 2J9UB 1IW7D 3LNLA 1FHHA 1VZGA 2V0EA 2M4VA 2AYJA 5MFZA 3P2AA 1VZHA 5MLC3 2XJRA 4POGA 4V196 2CR8A 2Z3RB 3A44A 1LTLA 1H7VA 1IU6A 4AI2A 4YWLA 2JI2A 4AHWA 2BE5D 1B2JA 1LKMA 4ZN1B 4GS7D 4YWMA 4TPUA 4AI3A 4B8CD 3NFPI 1IRNA 2M6PA 1B71A 1NXGA 1RWDA 1ZRPA 2ZIXA 1C09A 1QCVA 1YV1A 2CKCA 5MF6A 4K9FA 1RYQA 1NXEA 3RZ6A 1B2OA 7RXNA 3PWFA 4TVMA 5GADc 1JYBA 1S2ZA 2NYDA 4AHZA 8RXNA 2KKDA 3WWLA 2M4YA 1T9OA 1IROA 2XJQA 1YUZA 1R0HA 3KYXA 4AR3A 4JAGA 4AR5A 4LHLA 2QL0A 5GAHc 1CADA 2XJSA 3J7Y1 3ZG6A 2PPTA 1BQ9A 4AHYA 4RXNA 1BRFA 3MSUA 3QQCE 1YK5A 1CAAA 2ERJA 4AHXA 2A68D 2KN9A 2JI3A 2O5JD 3VPBE 1NNQA 1RYTA 2K2DA 2XJVA 5H1Sc 3PIP1 1T9QA 3B0AB 3IU3I 2M6OA 1YUXA 1RB9A 1R0IA 2CKAA 2RDVA 5MGNA 3KYVA 1OWBA 1SMUA 2L0ZA 2JI1A 1R0JA 1R0FA 1YK4A 4AI0A 3PIO1 3SS2A 4AR4A 4ME3A 4JAEA 5EINC 2DSXA 5DM71
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVE A;  1VCX A;  1BQ8 A;  1R0G A;  3RYG A;  1BE7 A;  1SMW A;  4POF A;  5RXN A;  1RDG A;  2MS3 A;  1FHM A;  3MPS A;  3KYY A;  1T9P A;  3RZT A;  2HR5 A;  3PZA A;  1RDV A;  5IY0 A;  1E8J A;  5AI2 A;  1B13 A;  4AR6 A;  1LKO A;  1BFY A;  3KYW A;  2PYA A;  1DVB A;  1IU5 A;  1LKP A;  1S30 A;  2PVX A;  2GMG A;  5AI3 A;  2LCQ A;  2VL6 A;  3KYU A;  6RXN A;  1QYB A;  2V3B B;  1DX8 A;  1S24 A;  1SMM A;  3QVD A;  1FHH A;  4POG A;  3A44 A;  1LTL A;  1H7V A;  1IU6 A;  4YWL A;  1B2J A;  1LKM A;  4YWM A;  4TPU A;  1IRN A;  1B71 A;  1RWD A;  1ZRP A;  1C09 A;  1QCV A;  1YV1 A;  4K9F A;  3RZ6 A;  1B2O A;  7RXN A;  3PWF A;  1JYB A;  1S2Z A;  8RXN A;  2KKD A;  2M4Y A;  1T9O A;  1IRO A;  1R0H A;  1YUZ A;  3KYX A;  4AR3 A;  4AR5 A;  2QL0 A;  1CAD A;  1BQ9 A;  4RXN A;  1BRF A;  1YK5 A;  1CAA A;  2KN9 A;  1NNQ A;  1RYT A;  2K2D A;  1T9Q A;  1YUX A;  1RB9 A;  1R0I A;  2RDV A;  3KYV A;  1SMU A;  1R0J A;  1R0F A;  1YK4 A;  3SS2 A;  4AR4 A;  4ME3 A;  2DSX A; 
#chains in the Genus database with same CATH topology
 1BQ8 A;  4ZN3 B;  2C6B A;  2V0F A;  3K35 A;  3GTO L;  2NVQ L;  2B5I D;  4C3I L;  2MS3 A;  3FKI L;  3MPS A;  3KYY A;  1F4L A;  3RZT A;  1TWH L;  1VZI A;  3PZA A;  2PMZ P;  1BFY A;  2A6H D;  4E6Y A;  4JAF A;  1IU5 A;  1S30 A;  2PVX A;  5FLM L;  1P7P A;  3H9C A;  3K7A L;  6RXN A;  3H97 A;  2Z3Q B;  3WWN B;  2PSM C;  1QYB A;  3PKJ A;  3PO3 L;  5C44 L;  4U67 1;  2J9U B;  1FHH A;  5MFZ A;  1VZH A;  5MLC 3;  3GTQ L;  3S16 L;  4V19 6;  5C4X L;  4Y7N L;  3GTL L;  4YWM A;  4TPU A;  4B8C D;  1B71 A;  1NXG A;  4BXX L;  1QCV A;  3LWO B;  3RZ6 A;  7RXN A;  4A3L L;  3PWF A;  2NYD A;  4AHZ A;  1T9O A;  1IRO A;  2JA7 L;  3J7Y 1;  4JAG A;  2NVY L;  1BRF A;  3MSU A;  3LWP B;  1YK5 A;  2ERJ A;  2A68 D;  2KN9 A;  3VPB E;  1NNQ A;  1RYT A;  1T9Q A;  1R0I A;  5MGN A;  1SMU A;  3S2D L;  1R0J A;  1R0F A;  3HAX C;  3S17 L;  2R7Z L;  1Y1V L;  4ME3 A;  4JAE A;  5M3M L;  2XJT A;  3P8B A;  2R93 L;  2A6E D;  1K83 L;  4UY8 1;  3S1R L;  5RXN A;  2H12 A;  3M4O L;  1PFU A;  4XGH A;  5M3F L;  2VUM L;  4AYB P;  4G6B A;  5MFP A;  2NVX L;  4A3K L;  3S1Q L;  5IY0 A;  1PFY A;  3KYW A;  2R92 L;  3S1M L;  2JA8 L;  3LPE B;  2B63 L;  2XJU A;  2E2J L;  5M5X L;  2VL6 A;  2V3B B;  1DX8 A;  5JVG 1;  1SMM A;  4A3D L;  3A44 A;  1H7V A;  3HOV L;  1B2J A;  2EY4 E;  4ZN1 B;  4BBR L;  4BY1 L;  2HVY C;  3HJW B;  3PO2 L;  1RWD A;  3I4N L;  1R9T L;  1TWF L;  4K9F A;  1RYQ A;  1B2O A;  3HKZ P;  4TVM A;  4X6A L;  5IYB L;  4A3M L;  3S15 L;  2KKD A;  2M4Y A;  4QIW P;  1R0H A;  1YUZ A;  3ZG6 A;  1BQ9 A;  4RXN A;  3JR7 A;  1TWC L;  1PZX A;  5FJ8 L;  2O5J D;  3PIP 1;  5H1S c;  3IU3 I;  1YUX A;  2RDV A;  4AI0 A;  1YK4 A;  5IYD L;  3PIO 1;  3SS2 A;  5EIN C;  2DSX A;  5DM7 1;  2PVE A;  1WCM L;  5DM6 1;  4WFN 1;  5GAG c;  1BE7 A;  1SMW A;  5K2M E;  3J7Z 1;  3B08 B;  1FHM A;  2Y0S P;  3HOY L;  1T9P A;  3S14 L;  2JA5 L;  2HR5 A;  1Y1W L;  3GTG L;  5C4J L;  2JA6 L;  2XJP A;  1WJV A;  4AR6 A;  3MQK B;  2WAQ P;  1LKO A;  5AN9 H;  1DVB A;  1LKP A;  2LCQ A;  3KYU A;  2A69 D;  4XXB B;  4AI1 A;  1ODH A;  1S24 A;  2C6A A;  3QVD A;  3HJY B;  3P2A A;  4A3F L;  4POG A;  2Z3R B;  4Y52 L;  3S2H L;  1IU6 A;  4AI2 A;  4YWL A;  2AQC A;  2JI2 A;  4AHW A;  2BE5 D;  4A3G L;  4GS7 D;  4AI3 A;  1PFV A;  2M6P A;  1ZRP A;  1YV1 A;  5M5Y L;  1NXE A;  4A3J L;  2RFK B;  1I3Q L;  2XJQ A;  3RZD L;  4LHL A;  2QL0 A;  5IYC L;  1CAD A;  2XJS A;  1SFO L;  3I4M L;  2E2H L;  3PL5 A;  4AHX A;  2K2D A;  2M6O A;  1RB9 A;  3KYV A;  3GTM L;  1OWB A;  2L0Z A;  3H9B A;  2JI1 A;  5IP7 L;  4AR4 A;  2WB1 P;  4A3E L;  5EIO C;  1VCX A;  1I6H L;  1R0G A;  3RYG A;  4A3C L;  4POF A;  3HOW L;  3LWR B;  3PKI A;  1TWA L;  1RDG A;  3HOZ L;  3LWV B;  1Z92 B;  1I50 L;  1RDV A;  5IP9 L;  1E8J A;  5AI2 A;  1B13 A;  2PYA A;  4LHN A;  1PFW A;  2GMG A;  5AI3 A;  2NVT L;  4C3H L;  2APO B;  2ERS A;  5GAE c;  4A3I L;  3M3Y L;  1OWC A;  4C2M 1;  4JAD A;  4A93 L;  1IW7 D;  3LNL A;  1VZG A;  2V0E A;  3RZO L;  2M4V A;  2AYJ A;  3CQZ L;  2AUS B;  3H3V M;  2XJR A;  2CR8 A;  2E2I L;  1LTL A;  2YU9 L;  4C3J L;  3FDJ A;  1TWG L;  5M5W L;  1LKM A;  4BBS L;  3NFP I;  1IRN A;  3H0G L;  2ZIX A;  1C09 A;  3S1N L;  2CKC A;  5MF6 A;  5GAD c;  1JYB A;  1S2Z A;  3GTK L;  4A3B L;  8RXN A;  3WWL A;  3HOX L;  3KYX A;  4AR3 A;  4AR5 A;  5GAH c;  5C3E L;  3HOU L;  2PPT A;  4AHY A;  3GTP L;  3QQC E;  3H99 A;  1CAA A;  2JI3 A;  2XJV A;  1QQT A;  3B0A B;  3GTJ L;  2CKA A;  4BY7 L;  3LWQ B;  5JVH 1; 
#chains in the Genus database with same CATH homology
 2PVE A;  1VCX A;  1BQ8 A;  2XJT A;  3P8B A;  1R0G A;  4ZN3 B;  5DM6 1;  4WFN 1;  3RYG A;  5GAG c;  1BE7 A;  2C6B A;  2A6E D;  1SMW A;  2V0F A;  3K35 A;  4POF A;  4UY8 1;  5RXN A;  2H12 A;  5K2M E;  3J7Z 1;  3PKI A;  2B5I D;  3B08 B;  1RDG A;  2MS3 A;  1FHM A;  4XGH A;  3MPS A;  3KYY A;  1T9P A;  1Z92 B;  3RZT A;  5JVH 1;  2HR5 A;  1VZI A;  4G6B A;  5MFP A;  3PZA A;  1RDV A;  5IY0 A;  1E8J A;  5AI2 A;  1B13 A;  2XJP A;  1WJV A;  4AR6 A;  1LKO A;  1BFY A;  3KYW A;  5AN9 H;  2PYA A;  2A6H D;  4E6Y A;  4LHN A;  1DVB A;  4JAF A;  1IU5 A;  1LKP A;  3LPE B;  1S30 A;  2PVX A;  2GMG A;  5AI3 A;  2LCQ A;  2XJU A;  5EIO C;  2VL6 A;  3KYU A;  2ERS A;  6RXN A;  2Z3Q B;  2A69 D;  4XXB B;  2PSM C;  3WWN B;  4AI1 A;  1QYB A;  2V3B B;  3PKJ A;  5GAE c;  1ODH A;  1DX8 A;  1S24 A;  5JVG 1;  1SMM A;  1OWC A;  2C6A A;  3QVD A;  4U67 1;  4JAD A;  2J9U B;  1IW7 D;  3LNL A;  1FHH A;  1VZG A;  2V0E A;  2M4V A;  2AYJ A;  5MFZ A;  3P2A A;  1VZH A;  5MLC 3;  2XJR A;  4POG A;  4V19 6;  2CR8 A;  2Z3R B;  3A44 A;  1LTL A;  1H7V A;  1IU6 A;  4AI2 A;  4YWL A;  2JI2 A;  4AHW A;  2BE5 D;  1B2J A;  1LKM A;  4ZN1 B;  4GS7 D;  4YWM A;  4TPU A;  4AI3 A;  4B8C D;  3NFP I;  1IRN A;  2M6P A;  1B71 A;  1NXG A;  1RWD A;  1ZRP A;  2ZIX A;  1C09 A;  1QCV A;  1YV1 A;  2CKC A;  5MF6 A;  4K9F A;  1RYQ A;  1NXE A;  3RZ6 A;  1B2O A;  7RXN A;  3PWF A;  4TVM A;  5GAD c;  1JYB A;  1S2Z A;  2NYD A;  4AHZ A;  8RXN A;  2KKD A;  3WWL A;  2M4Y A;  1T9O A;  1IRO A;  2XJQ A;  1YUZ A;  1R0H A;  3KYX A;  4AR3 A;  4JAG A;  4AR5 A;  4LHL A;  2QL0 A;  5GAH c;  1CAD A;  2XJS A;  3J7Y 1;  3ZG6 A;  2PPT A;  1BQ9 A;  4AHY A;  4RXN A;  1BRF A;  3MSU A;  3QQC E;  1YK5 A;  1CAA A;  2ERJ A;  4AHX A;  2A68 D;  2KN9 A;  2JI3 A;  2O5J D;  3VPB E;  1NNQ A;  1RYT A;  2K2D A;  2XJV A;  5H1S c;  3PIP 1;  1T9Q A;  3B0A B;  3IU3 I;  2M6O A;  1YUX A;  1RB9 A;  1R0I A;  2CKA A;  2RDV A;  5MGN A;  3KYV A;  1OWB A;  1SMU A;  2L0Z A;  2JI1 A;  1R0J A;  1R0F A;  1YK4 A;  4AI0 A;  3PIO 1;  3SS2 A;  4AR4 A;  4ME3 A;  4JAE A;  5EIN C;  2DSX A;  5DM7 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...