3S01A

Crystal structure of a heterogeneous nuclear ribonucleoprotein l (hnrpl) from mus musculus at 2.15 a resolution
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
212
structure length
209
Chain Sequence
b'GADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNNFMFGQKMNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPTSVKVFSGRSSSGLLEWDSKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQHAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a Heterogeneous nuclear ribonucleoprotein L (Hnrpl) from Mus musculuS at 2.15 A resolution
rcsb
molecule keywords Heterogeneous nuclear ribonucleoprotein L
source organism Mus musculus
molecule tags Rna binding protein
total genus 50
structure length 209
sequence length 212
ec nomenclature
pdb deposition date 2011-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3s01A02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3s01A01
4WFNQ 2YKAA 2XS5A 1WG4A 4CIOA 5D78A 1VQNS 2M0GB 3CCVS 3K0JA 2MKIA 5DETA 4CH0S 2YH1A 1FXLA 2KXFA 1Q81T 3ZZYA 2L08A 1H2TZ 2MZRA 3L3CA 1NU4A 4ERDA 1D8ZA 2DNQA 2MKCA 2DO4A 2KYXA 5LXRA 4IUFA 1WELA 2FC8A 3VAIA 2KG1A 2E5IA 5CYJA 2D9PA 1VQ5S 1WHXA 3V4MA 3G8TA 3CULA 3PIOQ 2M52A 3RW6A 1WEYA 2PE8A 1A9NB 5JVGQ 2MQLA 3IWNC 1FJ7A 5JVHQ 3Q2TC 3CCQS 3CC2S 5GADU 1X5PA 1X4HA 2SXLA 5IQQA 2MB0B 1M5KC 1S72S 1URNA 2Q79A 2DGWA 3G8SA 4ZKAA 3UD3P 4YOEA 2G1DA 2VODA 4M5DB 1A7GE 1JJ2R 2CJKA 2EK6A 1YJNS 2FHOB 1AUDA 1YIJS 1U1NA 2DGSA 1VBZA 2WBRA 3CCJS 1X4CA 4TU7A 5D77A 3MDFA 1FT8A 2KRBA 3G4SS 2RQCA 3VAJA 5FJ4A 2FC9A 3VAMA 2HYIB 1N52B 5CXTA 2MZQA 3CMES 3NS6A 3U1LA 1WF2A 1X4DA 2KRRA 2DNMA 3VAFA 1U6BA 1VQKS 3R1HA 1SJQA 1RKJA 2F3JA 2G4BA 1M1KT 1WWHA 2DK2A 2KXHA 1U1OA 1QVGR 5CA5A 1KQSR 1VQ9S 2RUGA 3SDEB 3UD4P 2DNPA 1X4BA 1KD1T 1U1KA 3S8SA 2DHXA 5DDRC 2CQCA 2YH0A 2CQ4A 4Y00A 5DDQC 5LJ5Y 5GAGU 2M2BA 5GVQA 3DLLQ 5EN1A 2E5JA 3G9CA 2MHNA 2CQIA 4QU7A 2KI2A 4WCEQ 1SJFA 1VQ6S 2EVZA 2CQ2A 2MGZB 2YWKA 5DDPC 2BZ2A 2MQNA 1X5SA 1M90T 2XB2D 2I38A 3MD1A 1FNXH 1R8PA 1U1LA 3MXHP 4RU2A 2LCWA 2DGOA 3P3DA 3CCES 3NNCA 2CQBA 2KT5A 1BY9A 3NS5A 2E5GA 1WF1A 2MKKA 4FXVA 1FHTA 2DNKA 2L9WA 1U1QA 3RW7A 4WKRA 2G0CA 2KXNB 2DNHA 1P27B 3MI7X 1H2UX 2NLWA 2DGQA 1VQLS 2MKHA 2VOPA 2CPYA 2DGUA 1H2VZ 1VC0A 1M5PC 2MKSA 2OTJS 1U2FA 2MZSA 3TP2A 2XSFA 2ERRA 2MQPA 1KOHA 4Y0FA 2ADBA 5HO4A 2X1GA 2CPIA 2KHCA 4QQBA 1VBXA 2M70A 1X4FA 1WI8A 2HZCA 5LSLA 2RNEA 1K8AT 3DXBA 1M5OC 2LKZA 4CQ1A 2RVJA 4C0OC 2DIVA 1X0FA 2X1BA 5BJRA 2CPZA 2DH9A 1HL6A 1L3KA 2OSQA 4F26A 2NZ4A 3CCRS 2KG0A 1D9AA 5IM0B 2RT3A 2N7CA 2RQ4A 3P5TL 3MUMP 3VF0B 1SJRA 3BO4A 1YJWS 1WHVA 2DNNA 2I2YA 2RRAA 2M88A 5GAHU 4BS2A 2M4MA 4WIIA 1B7FA 2KN4A 2KFYA 2MY7A 2LYVA 3J7ZT 1RK8A 3BS9A 3S7RA 2MPUA 4TU9A 1U1RA 2AD9A 2MYFA 2KVIA 1VQPS 2KM8C 3G96A 3BEGB 2OJ3A 4PRFA 3VAGA 5DM7Q 2CPEA 2F9JA 5DM6Q 2HVZA 1QM9A 3MOJB 1P1TA 2AYGA 2LA6A 3J7YU 4UY8T 1WHYA 1YITS 1VQOS 1HD0A 2AYEA 2N82B 2JX2A 4IOCQ 1KC8T 5IFMA 2MZ1A 4F02A 4PKDB 1X4GA 1SXLA 1UW4A 3LQVA 1WTBA 2J8AA 1U6FA 2YTCA 2MZJA 1FJEB 3ZZZA 2U2FA 2QFJA 2CQ0A 1WF0A 2DGXA 1FO1A 3S6EA 1Q82T 2B0GA 2CQGA 1WI6A 1H6KX 1N88A 2VONA 3EX7B 4P6QA 2PEHA 2DNZA 2K8GA 2JVOA 3CC4S 2LECA 3HI9A 2DNRA 5ITHA 2CPFA 1X4AA 2LQ5A 1K9MT 3PIPQ 2N3LA 2M8HA 3CCUS 1VC5A 1Q86T 2CQPA 1N54B 2ZJRQ 3JB9k 1U1MA 2CPDA 2E44A 4WF9Q 2DNOA 1PO6A 3D2WA 1G2EA 1JJHA 1VQMS 2MJNA 2M9KA 1JJ4A 4LJMA 2JVRA 1YHQS 3MD3A 2CPJA 1UP1A 2DGVA 3CTRA 1YWXA 3SXLA 2KM8B 2ZJPQ 3I55S 1K73T 2D9OA 3CF5Q 5LSOA 3IRWP 5HL7Q 2CPHA 5H1SV 2ADCA 3H2VE 2LXUA 2DNGA 3UCZP 2N3OA 2L41A 2DNYA 3EGZA 4A8XA 2M8DB 2DNLA 1N8RT 4EGLA 2DHSA 3HHNB 2KU7A 3US5A 3MURP 1NJIT 1VQ4S 2GHPA 3BO2A 1PGZA 1X4EA 2OTLS 1VC6A 3I56S 3P6YC 3MUVP 2LXIA 4TU8A 4W90B 5DDOC 2F9DA 1OIAA 1JMTA 2MSSA 3SDEA 2XNRA 2J0SD 4CH1A 3VAHA 3VAKA 3CC7S 2V94A 1QVFR 1YJ9S 3MUTP 3B4MA 2EK1A 1DRZA 2DHAA 2LA4A 1X5TA 2LMIA 3UCUP 3BO3A 2XS2A 1ZZNA 2FPHX 3OW2R 4OZ0A 2MGZA 2DISA 1DZ5A 2K3KA 3B4DA 2MMYA 2O3DA 2DGTA 2U1AA 1ZH5A 3EGNA 3U1MA 2DO0A 3CCSS 1FJCA 3FEYB 2FY1A 4OZ1A 3G6ES 1WG5A 4C4WA 4IOAQ 3CXCR 1VBYA 1NO8A 4LIRA 1HD1A 3SMZA 2MKJA 2CQ1A 4W92B 2M7SA 1WHWA 3Q2SC 3H2UB 1IQTA 1WEZA 2JWNA 4QPTA 1HA1A 3CCMS 4FXWA 2BOPA 2J0QD 4WFAQ 3FEXB 2MY8A 4UQTA 2DIUA 1SJ3P 4ED5A 2X1AA 2DH7A 5GMKa 2CQHA 3NNHA 4LMZA 2E5HA 4YUDA 3UWTA 2CQ3A 1R8HA 4YB1P 3S01A 3CUNA 2D3OR 1F9FA 2HGLA 3CPWR 3VALA 2VOOA 3CMAS 1WG1A 2MXYA 1YTYA 3TYTA 1W2BR 2DB1A 1O0PA 2LEAA 1U1PA 2UP1A 4PR6A 5LJ3Y 2RS8A 3N9UC 2DH8A 1OWXA 5MLCV 2ZJQQ 1M5VC 1DBDA 2GO9A 2JRSA 5GAEU 1ZZFA 1S79A 2OIHA 1DHMA 2A3JA 5IM0A 4F25A 3TO8A 1OO0B 2HGNA 1WEXA 1CVJA 4IO9Q 1VQ7S 1Q7YT 3UE2A 2HGMA 4U67Q 2CQDA 4C7QA 3ULHA 2XS7A 2CPXA 2MQMA 2DHGA 1VQ8S 3G71S 2J76E 1YI2S 2DITA 1UFWA 2MJUA 2RRBA 2LEBA 3NNAA 2AYBA 4V19X 3THTA 4QU6A 1UAWA 4WFBQ 3THPA 3LPYA 4Z2XA 2MQQA 3P49B 2QA4S 2X1FA 2MQOA 2QEXS 1X5OA 1XN9A 2RU3A 3CD6S 2MSTA 4TLQA 3R1LA 1OPIA 3UCGA 3NMRA 4J5OA 1SJ4P 3R27A 3CCLS 1KOOA 2OSRA 2KH9A 5LXYA 2AYMA 2RS2A 2XNQA 2MZTA
chains in the Genus database with same CATH superfamily
3UVJA 1R8AA 2V63A 4P2SA 2RDDA 3I5AA 4ZCKA 1LFWA 1XMOF 1Q81T 4HHJA 5I42A 5HBMA 2DNQA 5DJBA 4ED2A 1WHXA 1S12A 3RW6A 3CCZA 5AJ3J 5JVGQ 4RW7A 4YHHJ 2V5HG 3J81Y 4NMXA 1SBRA 4YOEA 2VODA 4OV1A 4B9UA 2EK6A 4IH6A 2YWWA 3QT5A 1X4CA 4F4AA 1T05A 2NR0A 3R6LB 4NLDA 2XO6A 2LLZA 3MCMA 1RBOB 1K47A 1WF2A 1MROB 2EXUA 4IKAA 2DT9A 5KAKA 3VGUA 1QVGR 2BACA 2E66A 3GIMA 3HX9A 1XR5A 4NLRA 2W7PA 4Y00A 1CULA 1KFSA 2M2BA 4PG5A 3UNGC 1Y5LB 1TK8A 2I38A 1FFSB 3MXHP 1WSVA 3ILIA 1J2VA 3BB5A 4X4TA 3RUBL 4A8WA 1BY9A 2IVYA 3DLKA 4WE1A 4B3TF 3H98A 1QD1A 2AEJA 2RRNA 2QMWA 1OQ3A 1U2FA 1S1TA 3NXZA 2DJWA 3HO1A 3EICA 3OVSA 2YKMA 1PJ6A 4USJC 3D6MB 4ZVFA 4Q45A 3W2WA 5KG5A 1D9AA 2F8HA 1YJWS 4ILLA 3BREA 2JH3A 4BS2A 2HHHJ 1B7FA 1UFKA 3VTIA 3V6DB 4RLEA 1MMDA 2MYFA 3VVUA 2P9EA 2F9JA 3QGHA 1HMVB 1RT2B 4UY8T 4R0EA 1VQOS 1XR6A 2JEGA 4JOUA 3H7HB 2GVZA 4X4OA 2B9EA 5AE2A 3DLHA 4Q0BB 2IFXA 2MEWA 1YJTA 3ZZZA 2C2NA 3PJ9A 2HG4A 1ACMB 2DGXA 3W7BA 4NRUA 1R7IA 1B0PA 4DFKA 1SIZA 1R0BG 3V4IB 1VK3A 2DNRA 5ITHA 3T41A 4WFXA 3QLHB 1K9MT 2N3LA 2M8HA 4IG3B 2OFGX 5LL6d 1N54B 4GKJJ 2Q1LA 4DR2F 4WP3A 3E01A 1HHTP 3NMAA 1G2EA 3FC9A 2M9KA 2QRRA 3RR7A 3C15B 4DV5F 1IR1A 3GJRB 5JXSA 1B3TA 4OYAA 1K73T 4WYLA 3ENAA 2ZWOA 4XTTA 3PV8A 1P8GA 2D74B 1RT7A 4B9VA 2Y8WA 1NSPA 1CEZA 3R5CA 5F9NA 2KU7A 2XC9A 1PGZA 3OTDA 1N5YA 4F8RA 5DDOC 5L1LA 2XNRA 1E6YA 4RUCA 2B3TB 2LDIA 1C0UA 3V4IA 5FLXY 2XYHB 1Y3JA 2COLA 3QLHA 3JYTA 1CJTB 2K7KA 4ZHRA 1DRZA 4M8LA 2HVDA 2U1AA 1RT1B 4CLSA 1FJCA 5A0YB 3G6VA 3Q8SB 3GIIA 3ZTOA 4ECWA 2VH7A 4O3QA 5I3UB 3OL8A 1WC6A 3FEXB 2DPJA 2QFIA 4CYUA 3FGVA 5B08A 4KQZA 1S7IA 3CJRA 3GJSB 1OWXA 3RB6A 4HT7A 2WBMA 4I7FB 4MIWA 2RIJA 5G4DA 1HQUB 4GKKF 3M9OB 3LPEA 4C7QA 1NKBA 5U47A 1SB6A 4V1Ak 2CJBA 4V19X 1RT5B 3Q8PB 1S6UA 1OY8A 3PVXA 4ID8A 2MQQA 5LMUF 2QA4S 5A0YA 2H51B 4CRJA 1URRA 1K0VA 4TLQA 3C6UA 1MW7A 1T8EA 2KJWA 1D9FA 2KH9A 2GAGC 3T3FA 4PXBA 4GO5X 2XS5A 1PYSB 3AA8A 4DG1B 4X4SA 1NM2A 2Y8YA 5M2RA 1XMQJ 5CD4H 3OTOF 5HLFA 3W65A 2ZH8A 2IMWP 4ZVTB 4FNIA 3MFIA 3DDIA 4F3OA 1HPZA 2MZRA 1RKIA 4LR9A 5KT5A 4IUFA 3SEOA 2OHDA 4NLXA 3LGHA 3V4MA 1HQUA 4X4QA 3PRVA 3KDOA 1UEVA 3RBXA 5JVHQ 1GXUA 3ZTQA 1RZMA 1WC5A 1RT5A 4RW8B 1JJ2R 4FF2A 4B08A 4RUAA 2HPUA 1C1BB 2FHOB 3CCJS 2W7AA 3BF4A 1M5HA 3E3XA 4F4WA 1ZM2A 3G4SS 1YG0A 3I9V9 4PWDB 1SH0A 4DG1A 1W2IA 3GWCA 1MLAA 2BRKA 2RUGA 4WKYA 4NLYA 4QW8A 2WSCC 4M5MA 3IR6B 4OHZA 2E1MC 2MHNA 3FRZA 1RWNB 4J9KA 4RL1A 1PBAA 4OLPA 1X5SA 1QLNA 2ABYA 2J9DE 3MOZA 2JLFA 1QE1B 4KB7A 2CZ9A 1IM6A 1R6VA 1FHTA 2RHQB 2R2SA 2YY3A 1C1BA 4FBTA 2GFFA 4U7UD 3BJYA 2NLWA 5DG7A 2MQPA 1X4FA 2R4FA 1LWCB 1JXVA 2WZ1A 4X66F 1DJ0A 3PKMA 1FWPA 2EI5A 2VBWA 2RVJA 1N4LA 3PJWA 2IRUA 2XGQA 4B3SJ 3JTOA 2HQDA 4Z7YA 1Q5YA 2NREA 1GTEA 4F4ZA 2M4MA 2O66A 5E2QA 2WHOA 1FNOA 4DPTA 3BEGB 4KSEB 1QM9A 1P1TA 2AYGA 2VV5A 2LA6A 1HD0A 2JX2A 4UUWA 2HVEA 2A18A 4LIWA 3EXCX 1QE1A 2Y1LB 2XG8A 2W9CA 2HMIB 2U2FA 5RUBA 2EFQA 1S9EA 4ZVPB 2R7UA 4ZDNA 3UDLA 4P6QA 4KTQA 4KPCA 5IV3A 1DURA 4QYRA 4U95A 3P96A 5KFXA 4PAAA 3DLEA 5AXMA 2ZJRQ 4ID5B 4EO6A 2E44A 1U48A 1SQGA 2HZVA 5F41A 5CCMA 1JJ4A 2H5JB 1YWXA 1FCAA 5CYMB 2DRDA 2V68A 5CABA 3PYDA 5KFKA 3SFUA 3WIVA 2JEJA 4HHHA 4F3QA 2ZHBA 3MAQA 1VR6A 4JV2A 5HP1A 1EAYC 3ET6B 2L41A 1FRHA 4P10A 1RT3A 1SH2A 2GHPA 4RKUC 3R5DA 5E41A 2MSSA 4USMA 1ZAXA 3TI0A 3CEDA 3T1AA 3MUTP 3ITHA 3OR2B 1GX5A 3BO3A 5M2UA 2ACYA 2IY5B 4BC7A 2DGTA 4KYZA 3Q8YA 3EUNA 3FBEA 1WG5A 2MTLA 4PPDA 1BE4A 5CYMA 4NYPA 3OVBA 2ZUAA 5KT6A 3HHKA 3OR1B 2O67A 4DDFA 4DR1J 4LF4J 4O44A 3ET6A 3C14B 1F9FA 3Q89A 4DSIA 2YX4A 5JMNA 2DB1A 2ZC3A 1O0PA 2ZBRA 2Q66A 1T9TA 1NSKL 4C98A 2DR7A 2OIHA 2ZVSA 4KT0C 5IM0A 1JWWA 1SJ1A 3QJJA 3D6TB 2W8KA 2NUUG 4IO9Q 1Q7YT 3T5KA 2CPXA 1EARA 4K50A 2OUGA 3DOLB 3THTA 4X4RA 2JC0A 2KDOA 4C8OA 3VR1A 2WB4A 3CD6S 2RAQA 1UCNA 4YY3F 4LRFA 3PZPA 2AYMA 3F73A 3HXMA 3DLBA 3T5JA 2VB6A 3GCXP 4MIBA 2CJQA 3OR1A 3M8RA 3IP0A 1S0OA 3QJPA 4C8YA 5E33A 3OFGA 1VIXA 2YX7A 5FDLA 3GFYA 2D41A 4LQ9A 1KHWA 3M7VA 3QZ8A 3DI6A 2L08A 5EGYA 1AYEA 2AP6A 3SIPB 4PG4A 1DQ8A 1LXNA 1OSCA 4LF1A 2VFUA 2MQLA 4PG7A 2ZH3A 3GR0A 4B02A 3G2XA 1F2GA 2SXLA 2BA9A 5F8LA 4ZKAA 3OFEA 4ELVA 3QWPA 4KJIA 1UJ5A 4QCLA 1MN9A 2OPSA 2PDAA 6FDRA 2FLOA 3TX0A 3O5TB 2VASA 1F5CA 4NA1A 2FC9A 1U24A 3LAKA 4C48A 2H48B 1GX6A 2OPQB 2X3GA 2C1EB 3ISND 3PYEA 3HHDA 2EW9A 4KHMA 4ZCLA 5A2QY 4OJGA 3D0IE 1NK6A 4UF4A 2WOMA 2EPIA 4NL5A 2RE1A 4BC9A 3MR6A 3BKUA 4PPZA 4KGKA 1N32J 3D6HB 3NNCA 1S1XB 4R5PB 3IO1A 2MKKA 4QYZK 2OEKA 4URQU 3MEDB 1NK9A 4DUZJ 3ZO7A 1RWXB 1P1LA 1H2VZ 1R43A 3WDOA 1H0HB 4J9MA 2RDJA 2A6OA 2CVEA 4FS2A 2YNHB 1YVFA 2BX6A 2RNEA 2OPQA 3I82A 3PG9A 2EG2A 3HULA 1R31A 2YWGA 3W8GA 1D3WA 3DCAA 3AJ2A 4TY8B 4EUVA 5SZTA 1RWUA 2MPUA 3DRRA 2KVIA 3MM8A 3G96A 2QA2A 1LWEA 2FLNA 4JI1F 1WHYA 1S1WB 2BJ9A 4FN5A 1G7CB 4ZP9A 2ZZNA 4R5PA 4F02A 1SKRA 3LQVA 3H20A 4OYOA 2JLGA 2KKHA 2QFJA 2KO1A 3S6EA 2PI4A 1N88A 3CDEA 5F9LA 2R7XA 1NRKA 2VQEF 4X64J 1F9EB 4N41A 1X9MA 1T9VA 4RR5A 2VL1A 3K7RA 4FYYB 4DR6J 3PIPQ 4F2SA 4WP9A 3W9JA 1M5SA 4OHYA 3C3LA 2IJNA 1RT4A 2DNOA 1Q5VA 3SV4A 1YHQS 3I31A 3PXGa 3PCOB 1CQMA 4WJBA 4N56A 2GGPB 4N47A 2R8GA 3GIJA 9RUBA 2HRTA 3EYZA 1SL1A 3GYGA 2AZ3A 2RH3A 3CJ5A 4CO4A 3Q0AA 2GQCA 2OI2A 2V50A 1DTTB 3D3CJ 1BQMB 5AJ3F 2CJ9A 1JMTA 4JI5J 4NLGA 3SDEA 1NNDA 4YHHF 3VAHA 1Q8IA 1EKRA 4RNOA 1SQEA 1NKCA 5I3QA 4CTAA 2HBRB 3EWGA 1JKHB 1AA1B 2WVBA 3CSKA 1VRUA 2V2VA 1R27B 4CT8A 2GGPA 4WP8A 1NK4A 1B7YB 2MY8A 2XWYA 4ED5A 1DARA 1H3DA 1FKPB 3LP0A 4DJBA 2QL7B 1U2RA 3A3PB 4ED8A 2GO9A 3HZGA 4EMDA 5KFVA 3ZZUA 2BOAA 5CHCB 1VDHA 2VBXA 3PR5B 3D67A 2A0FB 1WEXA 4ZPWR 2BE2A 5HJXA 2BQRA 2GHWA 4OX7A 4TKTA 2EEYA 1UFWA 4K5SA 4JI3J 2HSEB 3QGIA 2XCAA 2QG9B 4Q43A 2XHWA 3BDEA 3RAXA 4WK3A 2AHOB 1U09A 1IKWB 3R7NB 2LP4A 2OD4A 1VQNS 5C25B 3ZXWA 3CCVS 1HQEB 3MPYA 5KFNA 2NSBA 2XM3A 3M32B 5C2GA 2EKYA 2KXFA 2KHDA 2HHHF 4ZIVA 4P75A 4ERDA 3BN7A 4PUOA 1B64A 1ELOA 2PC6A 3UFCX 2QTWA 2RMLA 2OELA 4ZLLA 4OX6A 2WK4A 2VKRA 3CIMA 2DGWA 2W2OP 1TU0B 2C3OA 3RYLA 3UQSA 3HKWA 3MMBB 4DEZA 1RAFB 2R7SA 2DGSA 1SH3A 1LQ9A 3T9NA 5HQMA 4CLTA 1WSRA 3D0GE 1RWPB 2K7JA 4USWA 4B17A 3BR9A 1MG7A 1IKWA 5J2NA 4GKJF 2R2TA 2KRRA 1TP7A 1DQ9A 1HQEA 1UPPA 3FRYA 1RAGB 1U1OA 4B3OB 2NS1B 2ZNYA 1REGX 1KS2A 3DOMA 3MMCB 1QDUB 3TAPA 2HHXA 5LJ5Y 3UN2A 1JLQB 3I96A 1L3VA 3KG1A 3JTPA 1E6VB 1U25A 5ETVA 5J2QA 2IM0A 3BQ0A 4HT5A 2VDIA 4P9SA 3R5JB 3MM9B 4RJVA 2XBPA 2FB0A 3MMBA 1IM4A 1VC0A 2XMVA 5GAEI 3X1LB 4QQBA 2QX0A 1S0NA 3ZNUA 2JLEA 3EGWB 1S59A 1TL4A 1HL6A 3NP5A 2YWEA 2DEJA 1TL1B 4OJ1A 4C0BA 2CNKB 4WIIA 1JLQA 4F3MA 4H4OB 2HK2A 3EXYA 4A48A 1I6JA 1X7VA 3TJAA 4ZVQB 1FEEA 4ETXA 3GYNA 3Q8RB 5ETSA 2V2QA 4EBEA 3MM9A 4HHUA 1EZZB 4DN0A 3PY8A 3B6BA 1Y11A 4MYTA 1FJEB 2RU9A 2YNGA 4GVBA 2V8PA 4KV8B 3SYZA 1KBRA 3LANA 2PEHA 4DS4A 4OYWA 3LO3A 3H8YA 1V5VA 3KNGA 4R8UA 2IA0A 3O1LA 4F4KA 1HYSA 2Y1JA 1TL1A 1LKZA 4J91A 2GX8A 2H9ZA 3DC2A 2Q6BA 1X8DA 4HTJA 1MU2B 2Z2LA 3EDQB 4DL0C 2V8DA 3TNVA 2VPWB 1XMQF 4WU2A 1T94A 5JJBA 4K4XA 3CJ4A 5M2PA 5HJYA 4EGLA 3UO0A 1IUJA 2BJ8A 4LF6J 2XY5A 2BYCA 4W90B 2OEJA 5IT9U 2F9DA 5T7LB 2DHHA 1IBMJ 4X84A 5E3AA 5HQLA 2PFFB 2VBZA 4WU3A 3M2RB 1F0XA 3IBCB 2LA4A 2R2RA 4NYOA 2IDEA 4CH7A 3LAMA 3KJQB 2O3DA 2V8GA 2HHVA 1TMMA 2DO0A 2E1AA 2CAJA 3KTQA 3OFFA 4KKOB 1MU2A 3CCWA 5FIIA 5H9FJ 3AY0A 2WVFA 5IV4A 4URSA 5IOLA 4C97A 5K5MA 4P73A 1WG1A 2CFXA 1Q53A 4FDFA 1UVKA 2LEAA 5KFLA 2HQGA 3OBIA 1M5VC 1NLKL 1VRTB 1TTHB 1TZ0A 1XJWB 4XK8C 1KR4A 4R0JA 5K20B 1KSPA 4PXDA 3FNNA 4U67Q 1AB8A 3IWXA 2D3ZA 1S0MA 3G6XA 3U1NA 3OL9A 2WW8A 3P49B 4KIAA 1RLDA 4ZK7M 4YFUA 2RU3A 3PW5A 4NX9A 4EBCA 2Z4PA 2OSRA 5HQ8A 5LXYA 2C2MB 3T9ZA 1DLOB 4I2QA 2YKAA 5CAAA 3NG8A 2KTQA 1RWVB 3IRXB 3V6JA 4B3SF 2J6TA 2MKIA 4CH0S 2YH1A 2I5JA 2UXCF 3UN5A 1AFJA 2W4DA 4Y2IA 1D8ZA 3CJ0A 5D3GB 2B7CB 1UA0A 4DFJA 1KNZA 4ED3A 1M1GA 1VGYA 3QFWA 2QJ3A 3BGFA 1WEYA 1RACB 1FFGB 2HWHA 4IH7A 4NASA 3CCQS 4DX5A 3CIZA 1EJ7L 2KZZA 4EWTA 1S72S 2C2ZB 1SCJB 4Y2AA 2BXJA 4M5DB 4BCAA 2AGPA 4ZN1A 3G82B 2R7QA 4WPAA 1CS4A 3HJFA 1YIJS 3GCWP 1JLBA 1CJKA 4ES2A 2PA8D 1FWLA 2KB2A 3IS9B 1X9SA 3QIDA 3CMES 5HROB 3D68A 3BSCA 3EZOA 2F40A 2QL5B 2QA4G 3O44A 3W63A 2KXHA 5CA5A 1KFDA 1RHMB 2DHXA 5DDRC 2CQCA 5D3GA 3UN3A 4YEAA 4DQSA 4KFBB 2J5AA 3ONQA 4AL5A 1UL3A 5I3PA 4QU7A 2PEBA 2VFTA 3GFXA 1U1LA 4JI6J 1ZTWA 2LCWA 3M6XA 2B5JA 2KT5A 4K8RA 2QA1A 2E5GA 1WF1A 4M5NA 1U1QA 3OXGA 2GMJA 5LSRA 2WAQD 2DGQA 2CPYA 2W2MP 1FE0A 2HW3A 3ZZTA 1GTHA 3C6TB 3TP2A 3VGSA 2ERRA 4P2XA 3M9NB 3TRGA 3JSBA 2NZCA 7FDRA 4L74A 1VBKA 2GVDB 5C24A 4A8YA 4C0OC 2AWZA 5CZXA 4YR0A 4A8KA 3BO4A 4LVNP 1IWAA 3NWRA 1LOUA 4KFBA 4ZJOA 1EP4A 1YBAA 3EJMA 5ADZA 1VHFA 1RUSA 4B9TA 3M30B 3SCJE 4DR1F 4LF4F 1KC8T 2YNIA 5LMNJ 2WTFA 3N0VA 2GMLA 3A3OB 4M5KA 1EHWA 2ZITA 2MZJA 3HMJG 2VF3A 2OGUA 2KL8A 3EVWA 3JAMU 1TFWA 4I67A 1MSWD 4LFBJ 4MJKA 3BPSP 1G6BA 2DY9A 2QLJB 3C66A 4DUTA 2GVDA 2LQ5A 1RTDA 1VC5A 4LRAA 2NUHA 3LTOA 3WZ0A 1IKVB 4EFAC 5DQGA 4EEYA 2KVQE 2ZBCA 1VQMS 3NGUA 2DGVA 4LF8F 1NZAA 1FVSA 3OUYA 1GK8A 1NJWA 1NXIA 3CF5Q 5L1JA 2CPHA 3O8WA 2MHEA 4EI2A 5DQHA 1H74A 5G0RA 2DNGA 4WFZA 4AXIA 5DG9A 4IYQA 4AL6A 3OHBA 4ZP8A 3W64A 1HNVB 2A6MA 3G8QA 2ZZTA 1FFWB 3IG1B 1HBNA 1HNIB 2RHSB 2WCXA 3DRXA 4ECXA 1N36J 3K59A 2FPHX 3OW2R 3G6YA 3T19A 2CDQA 2FY1A 2FIUA 3HSGA 1RQ0A 4Z37A 5A8WB 4XO0A 4UZCA 3IBWA 3PEHA 2F8MA 4QPTA 4UUXA 1Z2ZA 3PJXA 1WORA 4PG8A 2OP5A 3KJFB 4FXWA 2Z56B 1RGVA 1AZSB 3GMGA 4KR0B 2E9RX 4H4MA 3CMAS 5LJ3Y 4DSEA 4NLWA 3QSIA 3ELHA 3MM6B 2HQIA 2VD3A 3A12A 3CD5A 3IG1A 1RYSA 1N32F 2FGCA 2ZFHA 4C9DA 1FTRA 1V9OA 4OJHA 3ULHA 3AD9C 1B0VA 4UY85 3IC1A 4TVAB 2J8SA 5CCLA 4DUZF 4WFBQ 3F44A 2B6AA 2HFVA 2J7UA 5HATA 4NLUA 3ZTPA 2JFKA 4NEYA 2G2ZA 4C8MA 3TVYA 4MKAA 2B8PA 2LQJA 1RTHA 4OJ3A 4CIOA 2XYPB 4FP9A 2EFPA 1G3OA 3VGTA 2BQUA 2M0GB 2XSJB 3A8IA 4HL9A 2VG6B 4DLGA 3ZZYA 4WTOB 5KG0A 3OL7A 2PO4A 4RW6A 3UPFA 2DO4A 2KYXA 5LXRA 4DU7A 2XWXA 4XPCA 1GMUA 4J9VA 5E3RA 5B0AA 1KVKA 1OPZA 2PE8A 1JLEB 4NPOA 4EYHB 2VU5A 1KLMA 4K7QA 5DG8A 1IR2A 2C3UA 1URNA 2Q79A 1HR0J 3C16A 1J27A 4Y2KA 1S6QB 1S1VB 3ZNJ1 1R8BA 3MMAB 4LSLA 1U1NA 5B0GA 1VBZA 5K14B 1NK5A 1RABB 5D77A 3MDFA 4X64F 3W60A 2RQCA 1JLCA 4L73A 2NSCA 4QWAA 3LUYA 4DR6F 4I0WA 2L3MA 3U1LA 2WW4A 3JSMB 2DYAA 2G4BA 3FQKA 3RR8A 5A6WA 2LU1A 5SUHA 4F4YA 2QSFA 1I3OB 4HDHA 5HSPA 2FTRA 3CJ2A 2ROGA 2R8IA 5C5JA 3G9CA 3GLJA 2MQNA 1N0UA 4RWXA 1Q7LB 3B78A 2W7OA 4N8OA 2UUCJ 2XLIA 3VWSA 2DVIA 1S6QA 4F36A 1LV5A 4G1IA 1S1VA 2NCKL 1IKXA 2BQ3A 5K14A 3PW2A 2Q43A 4JI5F 4QWEA 3CJQA 4K4ZA 5DQIA 2UVVA 4HR2A 1J5OA 2BBEA 1KOHA 5HO4A 2X1GA 3I6PA 1VBXA 2XMTA 2FJDB 3BM7A 5F8NA 3JSMA 1GMVA 1TVRB 2FJWA 3KJVB 1KTQA 1G1XA 4KAIA 2AZ1A 3VF0B 5KOXA 1XBWA 1WACA 3AOCA 1TKZB 1V5IB 1VHIA 1WNEA 1U49A 3S7RA 2UUBJ 2XZWA 4PRFA 2IAJB 2KYZA 1LW2A 4LRBA 4JBCA 2YBVA 1MWYA 3GV5B 1RLCL 2AYEA 2LFVA 2Y1RI 3DOKB 4O3RA 2UUAJ 4P7VA 2H5EA 3J81j 3LP1B 4KBIA 2J7WA 4DR5J 2QMUB 3DKDA 1ZA1B 1R0AB 2IPOB 3W62A 3NGTA 2FQQB 1Q82T 1QSLA 2DTJA 1N5TA 3HVTB 1TK5A 5KFZA 5F8HA 2W9BB 4U8YA 3PW0A 1X4AA 1KLNA 3IM9A 4JI3F 1ZOTA 5IQ6A 3B54A 1NHVA 2HQFA 1GT8A 4YQWA 4LSNA 1SKSA 2JVRA 2FVRA 1RBLA 1Y9OA 1TKTB 2FD2A 3IGVA 3A8KA 3DOKA 1TV6B 2AIRB 4KH1B 3EPGA 3LA0A 4C6AA 3O6QA 3T1YJ 3LP1A 5KFHA 2DXEA 1VOMA 2DNLA 1CJVA 4DV0J 5B0DA 2W01A 3OSPA 3BO2A 3DRSB 5J1EB 3HVTA 1T9XA 3D9BA 3RAMA 3DM2A 1NJZA 5HMYA 2W9BA 1AFIA 3WIUA 4WXOA 4LBPA 3OQ2A 2DXFA 1RISA 4NXMJ 1YJ9S 3FQLA 3T6JA 3A1YG 2DRBA 1Z4UA 4YDDB 4WZQA 4K4TA 3KNAA 1YRUA 1FK9A 1ZA2B 2NQPA 3HSJA 2CUYA 4WTYA 1TKTA 2HS4A 2M7SA 2W4PA 2IC3B 4G65A 1S77D 5D15A 1L3TA 2PGCA 2K06A 3FMWA 2X1AA 1TAUA 1Z1ZA 1K44A 3QWUA 2DXDA 5L1IA 2CXEA 2VOOA 5KFMA 3M2UB 5MLCV 3DGPA 4EYIB 2JRSA 3V81B 4F25A 4HEA9 2V8HA 4QPXA 3GIKA 5KG6A 4TLRA 2PFDA 4UZBA 2YWFA 4DMZA 4YMEA 4DX7A 4ZMMA 3NEKA 3TUZC 3GZ7A 5KFJA 1YGYA 5ETMA 5B7WA 4UT4A 2X1FA 1HIYA 4DS5A 1BXNA 3UCGA 1KQFB 1FEHA 2BJ3A 3MECA 4N76A 5A8KB 2C22A 3BV8A 1FA0A 5A8RA 2KJVA 1ZPWX 4NCGB 1BWEA 1DY3A 5D4NA 4I2PB 4W98A 3MR7A 3SQOP 1V6HA 3SQGB 2YKPA 4AD6A 2ZVIA 5GMEA 3J7AN 2UZAA 4DI6A 1T95A 4DV6J 2E5IA 2D9PA 2A2DA 2X51A 4OZ2A 4U9RA 3PIOQ 1NBEB 4KO0A 2WSEC 4BWMA 3DN9A 1UW9A 1T11A 2POKA 4RNNA 2V4JB 2HFZA 1OSDA 3CD7A 2B9XA 3TWZA 1WDDA 8AT1B 4P52A 1AUDA 4NLPA 1RTIB 4C8ZA 4ATNA 3QO9A 1JXEA 1FT8A 4RNHA 4KHPJ 2ZZMA 3VAJA 2NXCA 1VIOA 3IGNA 4ZJQA 5A8KA 2HBQB 4L6V3 3BBCA 5J1NA 2BV3A 4EZ9A 2C3PA 4RBUA 2F3JA 1HLWA 4I2PA 2DK2A 3SQGA 1FDAA 2KZMA 1YJUA 2KFZA 2WB1D 3I4PA 1QAJA 2DCUB 4JI7J 3BPDA 3PR4A 2HQCA 2GS8A 3KFWX 3GV8B 2HHSA 2J6UA 3ENVA 3BQ2A 3IAS9 2HHQA 2V4JA 4X2BA 4CCHA 2BANB 4B9MA 1IKYA 4FXVA 1UZHA 4DZDA 1OYDA 4L76A 2G0CA 2AJQA 3W1YC 1RTIA 2HNZB 1TQLA 1IBMF 4I6AA 2DGUA 3PX0A 1HKAA 2XSFA 3OXLA 3DDNA 4NI2B 3C8YA 4HACB 1S9GA 3D7SB 4FXDA 4OYMA 2EKNA 5EUHA 3RG6A 4DQRA 5C2CA 4JV5J 3TA0A 4YR3A 4WK1A 2XQCA 5GAHU 5FD1A 2GQ2A 2BKPA 3MR5A 1HBOB 3KLGB 4O3PA 4XDCA 3FSYA 5IS2A 1VQPS 1YK9A 4PABA 2HVZA 1B4SA 2CA9A 1REVB 3M2VB 5IFMA 1RTZA 3MAAA 1CBKA 3MCNA 2WSFC 2ZOMA 3NCPA 2YTCA 3A13A 1Y5IB 3UVJB 2WVDA 5E3CA 1R3NA 2CQ0A 5J2MA 1FO1A 1NEEA 2ZOFA 1I94J 2PMZD 1S49A 2NPIA 4OLOA 4HACA 5I42B 1F2HA 5GADI 5HBMB 2H4WB 2C28A 4GC7A 4FZVA 4RW7B 4LJMA 2OPRA 1KRPA 2NPFA 1HBOA 4KRWA 2D69A 2ZJPQ 4X4VA 2LU2A 4J9RA 4PQUA 2D7SA 2ALYB 5LSOA 2LVWA 3J80U 3QIPA 4DV3F 1T05B 1RYRA 4JYAJ 4ZLJA 3H2VE 2P5VA 1IWGA 1PIEA 2HURA 2XMJA 3WHIA 4QBUA 5D0HA 3TA1A 2ATCB 4UOHA 3TX8A 2HVHA 1NUEA 3FBFA 1CULB 2LMIA 3H25A 1DZ5A 5KG4A 3EGNA 1PYTA 5KG1A 1XQIA 2BE9B 3U1MA 3PO4A 5DLGA 3D4JA 5ETLA 2ZD1A 4OHVA 1NAQA 4C4WA 3HM9A 1WKKA 3RBZA 3UDVA 3SMZA 3DLKB 4WE1B 1IQTA 1WEZA 2Q6CA 2QGFB 3CCMS 2C3MA 5LOQA 1LWXA 4LMZA 4I1TA 3QT7A 1S1TB 4C0HA 1ROFA 3D1HA 3LALA 1RAEB 2YKMB 3QBCA 4RUHA 1APSA 1WOSA 1DBDA 3IWLA 3W2WB 5H9EJ 1V3RA 1JLAB 4EBDA 3HVWA 4OI2A 4JI6F 1K1SA 4KY3A 2DD8S 3KK1A 4DXLA 2OEMA 5HANA 2RRBA 1NDPA 1TFYA 1UAWA 3HDSA 2HNYA 2W2QP 4IRDA 4PYAA 1X5OA 3MEEB 3UDCA 2Z30B 2UUWA 1IBLJ 3NMRA 4K4SA 3EZ5A 2GVZB 2HFOA 4TY9A 2FJXA 4CLPA 3I32A 4FBUA 1GFWB 2PMHA 1ZPVA 4JI0J 3HHLD 3KLFA 3L95X 4FVCA 3LOUA 2YVSA 5KFOA 2AKWB 1YRXA 5EDWA 2F4VJ 1S1UB 5EWGA 3L3CA 3AXMA 2HKEA 3ZZOA 2MKCA 3AAWB 3GYXB 3PEJA 3TA2A 4ZCIA 3TAMA 5CYJA 5HVGA 1JLAA 4OI1A 2ZH9A 3RRGA 1OJ4A 1A9NB 3E01B 3QNWB 3MPWA 3PW4A 5LMNF 4TQSA 2F8EX 4ZA1A 2VG7B 2IMOA 5BYRA 4DL7A 4RWWA 3NGDA 1KTVA 4I4BA 1ZAVA 3MEEA 2F63A 2QLFB 1VLYA 5FJ4A 1RT7B 4NLTA 4CLUA 1Y0HA 3HJVA 1VQKS 1TK0A 5EX0A 1N5YB 2BE7D 3L7UA 1UTAA 1E6YB 1C0UB 1S1UA 2YH0A 5D0EA 3JYTB 3GE9A 3DLLQ 4ZHRB 3SZ2A 4DQIA 1O6XA 2OLWA 2IHR1 4P2FA 3O2IA 2VG7A 4KE5A 1YJRA 3A8JA 4Y65A 3SFGA 2AEFA 2D1CA 2MKHA 3BQ1A 3PKYA 1M5PC 2X7IA 2C42A 4OX8A 3ILLA 3GJQB 2ZDOA 1YLXA 4CYUB 4ECYA 2Z8QA 4ZN3A 1N36F 2ILZA 3I87A 1BGXT 2ASYA 1S0VA 4X62J 2NZ4A 3OXFA 1DAXA 4U6PA 4CI0B 3CDBA 3MPUB 1BQNA 1OS5A 4LRDA 1HFEL 2KN4A 2MY7A 3GTYX 1W26A 1RK8A 4BWJA 1U1RA 1JLGA 3OSNA 4DR4J 1CJUA 3BGLA 1PKUA 2OJ3A 1RU1A 3VAGA 2AEMA 1F1BB 3LGNA 3H4DA 3K5NA 3TJ8A 2HS0A 2QMXA 4NXNJ 2BKNA 2Y0BB 3KYLA 3I0SB 3C6UB 2F4FA 2RDIA 5IT0A 4AE5A 2CADA 1ZAWA 4HI2A 1HHQA 1ULRA 2DCLA 5E7OB 3DYAB 4IFVA 2YKNA 4CLFA 3BH7B 5HLFB 1YQHA 1S6PB 1HPZB 3ZC4A 4QIGA 3RZAA 2YXLA 2FYXA 4Y3CA 2CPDA 3HSDA 4DFPA 1IBKJ 2GO8A 4NA2A 1XC9A 2CZVC 3SBMA 1JJHA 3SCIE 2IJFA 4O0IA 1VMBA 1RAOA 4ECZA 3EDRB 2XTJP 2EWHA 1DQAA 5KT7A 4QWBA 5D8HB 2V67A 3HVAA 1LW0A 2P8IA 3V6HA 3I0SA 2ZM6F 2AX1A 2VIHA 4C11A 3ICLA 4PXEA 1NPPA 3P8BB 1XIQA 4D3GA 4LUBA 3PO5A 2QC3A 3P6YC 2JNJA 3DYAA 3JQKA 1U45A 5CQGA 1S6PA 1HR0F 2J7KA 2DHAA 3CDAA 2A2CA 2MGZA 1RBAA 1EETB 3QFHA 2VZ9A 3GB0A 3FEYB 2HAFA 4DUYJ 3N01A 5EWEA 4J9NA 2Z57B 1HD1A 5IXUA 4IQMA 3Q83A 3POTA 3Q8VA 2Z58B 2ZKUA 4WFAQ 2CYYA 1A0OB 1RWWB 3ISNC 5K8NA 4YUDA 4ZCMA 1R8HA 2HNDB 2D3OR 3QMQA 1RXOB 2CKWA 2G9OA 2PIIA 1YZ7A 2RS8A 3N79A 1S79A 1DHMA 2HWIA 1CPZA 1O5JA 4J9QA 4B3MJ 1OO0B 5B09A 2UUCF 4EK2A 3OTCA 3M8QA 4L72B 2H65B 1QUVA 2ZH1A 3R6GB 1CG2A 3TQEA 1EETA 5KFQA 2Z2ZA 2G2YA 2MLZA 2MQOA 2CJXB 2ZBPA 1X9WA 4F2RA 3CJTA 1UMJA 5L9XA 1V3SA 4OZNA 4DZ6A 4A8SA 4CM0A 4U96A 1Q0NA 2W9CB 2XEXA 2IDLA 4DV7J 4FNHA 4USIA 5CH7B 1S9EB 3GFHA 3W61A 2YQ1A 3M05A 1QSYA 3WX8A 2HNDA 3IBFB 4MTPA 4ED0A 4A8OA 4O4GA 1H2TZ 1NU4A 2P2CB 2UUBF 3QPIA 4X66J 2KT2A 3DLEB 2J9EA 2CJYB 1WKLA 4J90A 2UUAF 3CC2S 1X5PA 3DLGA 1C0TA 3TARA 2Z2YB 3P45B 2IBKA 4YS2A 3RBEA 2HBZB 4FF4A 4CLKA 2GNKA 4TNOA 4YB7A 2FHJA 1TUWA 5HP1B 1RWOB 4RW9A 3VAMA 1H72C 3NS7B 5BYSA 1HW8A 8RUCA 5L38A 1GQEA 3B82A 3KLIB 3PRBA 2N7YA 1X4DA 1RT3B 2F65A 3VAFA 3CO0P 1FDDA 2BUNA 3CJSA 4WXWA 1N5QA 1FRLA 1RCOB 3ENQA 1LNQA 1U1KA 2BW2A 3VCDA 2VPYB 3ITHB 4W4MA 4J9UE 2M5YA 2KI2A 1XNRJ 2WONB 1M90T 3HD1A 4A47A 3MM5A 1ICEB 1H7WA 4RU2A 4JP8A 2CQBA 4DV0F 1HI8A 2W24A 1U47A 4CZCA 5AE1A 4GMKA 5C7PA 1VQLS 1QTMA 5E3PA 1Q8LA 5HI7A 4O44B 4Q8FA 1O51A 2FVCA 4Y0FA 2CPIA 4NXMF 3JSYA 1WI8A 1LFPA 2HZCA 2UVWA 3KLIA 4J37A 3C2PA 3D1QA 1RHJB 4OYZA 2B51A 2UU9J 5IM0B 1KWMA 1FDBA 3CJKA 1WHVA 1Q8KA 2RRAA 1RADB 5KFUA 1I1GA 1QAYA 1FDNA 1JXLA 5KT3A 2WONA 3BZQA 4LBIA 5DM6Q 3MOJB 1EB0A 2GW8A 3GG1A 3J7YU 3I4HX 1S97A 4LF9F 3BH6B 1UW4A 1UVIA 1WOPA 4URGA 4UW2A 3IA0A 1Q4RA 4C8KA 4KGVB 5FDLB 1IBCB 2VC0A 2RF2A 2K8GA 3CC4S 4WWSA 3DI6B 3HSZA 3GSDA 3HCXA 1ZM4A 4USVA 2FJBB 1Q86T 2C2EA 1EX8A 1EQMA 4C2MA 4ZOSA 3KHHA 4WFYA 3RU0A 4NEZA 4FS1A 2P6TA 1HBUA 4AXJA 4ED7A 3KHGA 3FSIA 1N5VA 3DRYA 5F3TA 3CDUA 1KQKA 5KFAA 5KFIA 3JSRA 4ZP6A 2UXDJ 2OPSB 4ZPAA 1RA7A 2N3OA 4YY3J 1H98A 1T7PA 3P4UB 3M1VA 2HIYA 4DF8A 4DV6F 3HHNB 5GAGI 1NJIT 4DF4A 4AFFA 2XCPA 5DZ6A 1L5UA 4Q5VA 4ER8A 2J0SD 1IQZA 4R25A 5K8MA 3N28A 4PXCA 2FY8A 1S5ZA 2N4CA 4JB8B 3HPOA 2MMYA 2V9KA 2WOMB 3NAIA 3CCSS 4KHPF 1YBTA 2VG5A 4OYIA 1QTNB 2GJ2A 3CXCR 3H5XA 2CQ1A 1T03B 2IYIA 4TXSA 1HA1A 4C8NA 1SJ3P 3K2YA 4MK9A 1WOOA 4OI6A 3RAQA 3GP9A 3Q24A 2XMAA 3AB4B 1RAAB 5HVFA 2GCFA 4ES1A 2ZE2A 3N9UC 4JI7F 1RE1B 4CO3A 1UKUA 1MWQA 5GAEU 1H73A 1YZ6A 2PSZA 3TO8A 1PJ5A 4Q7AA 2CQDA 4CT9A 2YPZA 2J76E 3DRRB 2LEBA 3MM8B 1OQ6A 3JTNA 1FD2A 4M5JA 4M63A 1LWEB 2QEXS 4AQYF 1XN9A 1FERA 4X4PA 3R2DJ 1T3OA 1H7XA 2ZH6A 1PSDA 3PDNA 4AYBD 1T03A 3E8OA 1N33J 1Y00A 3KLHA 4OZ5A 2IIHA 1RAHB 3DLJA 5KTQA 4JV5F 1RAIB 1S7HA 4LF5J 3W9IA 3EM1A 1WELA 2ZUGA 4KGZB 2UVRA 2QZ8A 5L9NA 3VVTA 2BEFA 4M5LA 5KFTA 1RT4B 2XO7A 3KK2A 2P6SA 4F67A 1L3UA 1UEKA 4NYZA 1M5KC 1RWKB 4KHRA 1A7GE 1NK7A 2BMBA 1X0PA 2OPPA 5DGAA 2B4OA 4Q2LA 4PWWA 2FVPA 3AXKA 2HEKA 1DTQA 1I94F 3PHTA 1PBUA 1QAIA 3MPVA 2GMHA 3TQ1A 4LFCJ 2FJEB 2KRBA 1EQ0A 2UXBJ 1NDLA 1FX4A 2R7TA 3H5YA 4H4KA 4DOZA 5F8JA 1VQ9S 3MWBA 3H5UA 1HNXJ 3SDEB 2AT1B 3NGKA 2ATLA 3H42A 3PNIA 2F5GA 5HAOA 4IR9A 3OT9A 4WCEQ 1XWLA 4CTAB 4K2JA 4OZ3A 2CIMA 3KLEA 2IJRA 4JYAF 1PC5A 3TR5A 1R8PA 1VRUB 2DGOA 3HHLA 1KDNA 2VDHA 3NAHA 2HLTA 2KXNB 4O23A 2HLUA 1JJCB 2OTJS 2ZH2A 4ECQA 5AXNA 3TUJC 2OMLA 3LP0B 3B8HA 1FKAF 2R2UA 1NKEA 3RB4A 2GIFA 3W5ZA 1NHKL 4P72A 3VZIA 2KG0A 2RQ4A 2AGOA 1XK8A 2D3UA 3CGIA 4ECTA 1WTFA 3FK4A 3ZTSA 4OHWA 5GMDA 1FKOA 2BE2B 4J9OA 3FBBA 2KM8C 2GJFA 1IVZA 2NYHA 2YX1A 1X4GA 1O8BA 1N6QA 1OYEA 3CJ8A 2R7VA 1FXRA 3MM7B 1XNQJ 3HVRA 2GZOA 1YJ7A 4QWDA 1FE4A 5THWA 1H6KX 2Y1IA 2EFGA 1TUVA 5IT9Y 3F0NA 2MDAA 3FFIB 5DRKA 4PUOB 2E1RA 2BW7A 3FCWA 3J7Z5 1M1HA 1IBLF 3KLVA 3LGMA 1FESA 3TZZA 3QSYB 3WQPA 2F1FA 3UW1A 4JI0F 4ES3A 4RNMA 3PYFA 1TR0A 2HVIA 1RJJA 5F8MA 5ETTA 2VPZB 1RHKB 2HFSA 4OMFG 4LREA 2HHUA 1QUPA 2F4VF 1YSJA 4F0MA 5MAOA 3DXSX 3MM7A 1N8RT 5J2NB 2DR8A 1MROA 4JI4J 1FRKA 2XMWA 4ELUA 1XTZA 2G1HA 2XMUA 4O0NA 2VFVA 2UV8A 3I0RB 3DOMB 4G1QB 3FFIA 2EFVA 1VQSA 3Q22A 3CT9A 1Q78A 4ECVA 2EK1A 1X5TA 5J2QB 2IA6A 3D5MA 3EE3A 4J7CA 3MTKA 3PTWA 1GNKA 1HNWJ 2K1RB 3T5LA 2JEIA 2E7WA 1YX2A 4I56A 3T5HA 5CD4A 8ATCB 3H2UB 3NGSA 2VKZG 4FVMA 1VRQC 1NK8A 5D4LA 3HT0A 2VFSA 1YTYA 4M5HA 1U1PA 3EZUA 3N5BA 5HMXA 3I0RA 4ENOA 4G1QA 3V6DA 2XS7A 1LXJA 2N4DA 4LF7J 5AXLA 4OV6A 1AROP 2I9SA 2UUTA 2XZDB 1HMVA 1RT2A 2PMWA 1VJQA 2HFUA 2K1RA 1KOOA 5H9FK 4MFBB 4Q0BA 2XNQA 2ZHAA 3T1HJ 3QT6A 1NZ8A 4X62F 2YNGB 4GVBB 3KDNA 1OMSA 2ZNZA 4C3MA 4DR3J 5DETA 4IQXA 4K2XA 4ILRA 2RSQA 2O1PA 3GPAA 3SSSA 3MHYA 2XMMA 4DR4F 4IG3A 5KFYA 3VAIA 4J9LA 4RX6A 1WKJA 2JDJA 3OV7A 3C46A 4R8UB 4NXNF 2M52A 1HYSB 3VQSA 3M4XA 2FVSA 3C15A 1X4HA 1SC6A 4HH0A 3TVKA 4LRCA 1N5SA 3PACA 3GSIA 2IM2A 2RQMA 1NMEB 4CO1A 2LQ8A 2CDRB 2B4PA 4MFBA 2EBEA 4RPFA 4FKXA 2MZQA 2RILA 4AUKA 3NS6A 5GAHI 3SCLE 2DNMA 1RSCA 4JV1A 1IBKF 1M1KT 4XIUA 2QIFA 3PM9A 1BLUA 5DS7A 4D3HA 5DDQC 1CJTA 2ZKTA 2W8LA 2OAUA 1FXDA 1SJFA 2ZBQA 4PEOA 1RT1A 2OD6A 5LM7E 2YWKA 2BM0A 1MN7A 3J81U 3QJLA 4DQPA 2XULA 3OLAA 1FNMA 3VHQA 4E2FB 4JV0A 3N6MA 5I3UA 4WKRA 4ZVGA 1H38A 1H2UX 2ALZA 2XI3A 3U02A 3SSRA 3PHEA 4ED1A 5K9FA 4FYVB 2QN6B 3M9MB 1A6LA 4OFZA 1Y4ZB 4M95A 4NE9C 4DV2J 1M0SA 1VISA 1WC1A 3JAMY 3J7A1 3N5FA 1M5OC 3FZBA 4I7FA 3FBCA 1ZTTA 5BJRA 1D09B 2FVQA 2OSQA 3M6VA 2HAIA 4RU9A 4E0DA 2XLKA 2QV6A 4DUYF 2DBBA 4ED4A 2CVIA 5HN0A 4A8MP 4TYAA 3G87A 2LYVA 4TN2A 4TU9A 3AH6A 1T0TV 5DM7Q 1NH7A 5KFRA 1R8CA 3QATA 1CC7A 1G4CA 1HHSA 1SXLA 2ZWPA 4J9PA 1UVLA 3EVOA 4YR2A 1NK0A 1TL7B 1UJ4A 4I2QB 3LW5C 1U7LA 4IO1A 2VA3A 3BYRA 3HD2A 1TL3B 2VONA 2DPIA 4B3MF 2LDYA 1U26A 2DNZA 2I5JB 1SC4B 1FRXA 4CDIA 4B3RJ 4NZ6A 4O4RA 1Y5NB 1YRTA 2W9AA 4P7TA 3MD3A 2CPJA 1GAOA 1HWUA 3KJNB 4UOGA 1PCAA 4RW8A 3H40A 3I55S 5F8IA 3FCHA 4DV7F 2RJZA 1CS4B 5HL7Q 1JLBB 1CJKB 5H1SV 3GR1A 1W7WA 1BWVA 4YB6A 2FUG9 2LXUA 4P71A 3UR0A 1TL7A 4PWDA 4LR8A 1X4EA 3DU5A 3TANA 1VC6A 5IC4B 1KQGB 1TL3A 3MUVP 1SVDA 3M6UA 5ETPA 2YQ0A 3QT8A 2MLXA 3OJUA 1XMBA 2D3O1 4JI8J 3DU6A 2V94A 2UXCJ 2ASLA 2R3VA 2YWHA 4RZRA 1D8YA 2JC1A 3AODA 1P9YA 4OZ0A 1UEUA 3BSAA 4K5RA 5IC6B 1RA6A 4DV1J 4IOAQ 2B5JB 3TZWA 3CVKA 4W92B 2NYIA 4CM2A 1UVJA 3OPKA 4F7VA 5B0CA 2BOPA 3QZ7A 4UQTA 2ASJA 3O3LA 2E5HA 5A6PA 4DQQA 1JX4A 3VALA 2BR0A 1LWCA 2W4CA 2UP1A 5AT1B 3KMQA 4OZJA 4I6WA 1XNRF 5C24B 3AD8C 1ZETA 5FLXU 2A3JA 2C2KB 4TQRA 3FCVA 2HGMA 4IRCA 1MMLA 2BDPA 1EP4B 3EVMA 3T6BA 3HZEA 1C1CB 4QU6A 2W25A 4LQ3A 3QRPA 1WC0A 3MR3A 1C4CA 3TOQA 4IH5A 2YNIB 2MSTA 4ZLNA 3CCLS 2PI5A 2MZTA 3OLBA 2HMIA 1C4AA 2UU9F 3N6LA 3AFGA 1K0TA 2E7XA 3R5AA 2F7VA 5K8OA 3BKTA 3Q8UA 1IJFB 1RTDB 4ID5A 4DCOB 3NCRA 4MH8A 3E51A 2J0XA 3PYGA 3KHLA 1F60B 3IWNC 2H3EB 3DHWC 2XY6A 3Q2TC 2RUSA 4UOCA 2YKQA 3R5GA 3G8SA 4LF2A 1C1CA 3TJ9A 1UVMA 2XMKA 3OUYB 1KONA 2PN6A 2H1YA 5G0RB 1CC8A 2JOQA 3JS9A 3KKFA 1PAEX 1ITPA 1SJQA 2I8EA 3EGVA 1T3NA 4DPXA 1KQSR 4NZ0A 1W25A 2J9CA 2L9DA 1X4BA 4EZ6A 3D66A 4PQAA 1NDKA 2O01C 3FKBA 3PW7A 1HBNB 4IG0B 1NJXA 2EC0A 5K8PA 4MAKA 3M8PB 5EN1A 3OR2A 3ISZA 2E5JA 4CO5A 5LT5A 2V9WA 5L8RC 2UXDF 2CQ2A 5DDPC 4Y2MA 2CNLB 1R0CB 2EFOA 1FRMA 3DGVA 2ILYA 4NLOA 3NS5A 3AB2B 4LF8J 2YKOA 2VQFJ 3MI7X 2ACMA 2JSXA 2V0NA 3NOCA 3M8WA 2VOPA 5F8GA 3C14A 2AX0A 4H4MB 4EO8A 2UVUA 3FSXA 1AXQA 3K5LA 2AU0A 1S48A 3PFOA 1HNZJ 2VICA 2LKZA 3H4BA 5HK4A 2DIVA 4X65J 2DH9A 4CWBA 3MCOA 1L3KA 4UOFA 4F26A 3UDEA 4IG0A 2E9TA 1ZM3A 4KC5A 3M8PA 2JL9A 3DOLA 2KFNA 4ED6A 4FKYA 2B6AB 3ZTRA 2N82B 4IOCQ 4V19J 5BYQA 4MK8A 1WTBA 2J8AA 4ECSA 4MKVA 3MMJA 1U6FA 1RTHB 5EX3A 3BGOP 5KFWA 3NY0A 2CQGA 2B4VA 2JVOA 4LVOP 2L48A 3OD2A 1JLFB 3FMBA 3IN5A 2CPFA 4RW6B 4RBVA 2K2PA 5KG7A 1U8WA 1SV5B 5E5NA 4MYUA 2XY7A 2VFRA 1PO6A 4OYBA 1QY7A 3BBFA 1KLMB 2IVFB 4OL8A 1VK8A 3IR5B 1K1QA 3GU0A 3SXLA 1N33F 3N4WA 2CRLA 3C16B 4CLWA 2ROPA 4P74A 4DSLA 4LSLB 5L1KA 3IRWP 2R8HA 2B56A 2ADCA 4LF5F 4KPYA 1JLCB 3K5PA 3C19A 4K4UA 4B9SA 2E1CA 3HT3A 2VBYA 1VQ4S 5DO2A 1TKDA 4L3KA 4ANEA 2LXIA 5ETNA 1F5BA 3VQTA 3VAKA 1JLFA 4L75A 1SV5A 1TUGB 2ZEJA 1RU2A 4YDXA 3GG0A 3NLCA 3GJTB 4M1KA 4Y28C 4LFCF 2ZH5A 4OX9J 3AQOA 1S1XA 1VBYA 1Q95G 1UJ6A 3HHEA 2UXBF 3W5YA 1CSJA 3ENWA 1YBUA 3Q2SC 1WHWA 3AOAA 4DFMA 3MEDA 3CCTA 3EPIA 4ZP7A 1IKXB 1B0TA 5DLFA 1HNXF 3NNHA 1SL0A 1J5OB 2CQ3A 3BSOA 2YNHA 2H54B 3R5BA 9ATCB 1F3FA 1FJGJ 1UWBB 2E29A 3UD5A 5ETRA 2ZJQQ 3VZHA 4F0KA 1T9UA 2ROEA 4TY8A 4DPYA 3THVA 4A4JA 1CVJA 2JEFA 3D54A 3OTEA 1KVIA 2Y9HA 4NZ7A 3LPYA 1LW2B 2XHCA 1S1WA 4QOTA 1SC1B 1OPIA 5CYQB 4J5OA 1WJ9A 5D0GA 1ZYQA 1EKSA 2B4UA 2CG8A 3D3BJ 1HI0P 2L9NA 5ETOA 1J5EJ 1ZM9A 3KUGA 3CO9A 2HHPA 2V4QA 1UWBA 4L3NA 1JK9B 2FC8A 4DBQA 1VQ5S 3CNQP 3IMQJ 2BJ1A 3HFKA 3UI3A 1TELA 4LSNB 5GADU 2RKIB 1VS3A 2GV1A 4OHXA 1WD6A 4BLGA 2QO3A 1XNQF 2CJKA 3HF5A 4QYZJ 3MF5A 4J9SA 4DPWA 4QIVA 2IVMA 1IJEB 5CYQA 1AT1B 4DV4J 1N52B 2M3DA 1CJVB 3H2LA 1U6BA 5JUMA 1DTTA 4ZPVR 4HKQA 4ZPDA 1BQMA 3K5MA 1GXLA 5EWFA 2P9GA 1LEOA 3DM2B 1LK7A 3J7YI 3S8SA 2HHWA 3I9ZA 1U2CA 5BR8J 1FI4A 4RW4B 1JKHA 2R8JA 4K59A 2JJ4D 1FK9B 2RKIA 1IXKA 5F0WA 3GQCA 4HH1A 3HLUA 4JI4F 2K3IA 4RUBA 5ETQA 2W1BA 2DNHA 2BM1A 2VJVA 1D9DA 1FKPA 2MKSA 4HI1A 2MZSA 3G86A 4HTIA 2A1BA 3ZFVA 3CJ3A 3A4TA 4CQ1A 3DGPB 2LEPA 2WRMA 4DPOA 2CPZA 1S4FA 4ZVOB 2I2YA 5A2QU 1S57A 1HNWF 3L09A 4C8LA 4RW4A 2NXNA 2I1RA 1U0SA 2GA7A 1SPBP 4DX8H 5KFDA 3DFEA 3NOGA 1OY9A 3D1OA 3J80Y 2R7WA 4K4WA 3MECB 2JHEA 4CNZA 4ZPTR 5A8RB 2AGQA 5C25A 4MK7A 3AJ1A 5IT4A 4O3OA 3M32A 4H4KC 4M94A 1JNRB 5BXIA 2MKYA 4LF7F 3R7BB 3BKFA 2E5LJ 1BUXA 1V3ZA 3V5RA 1HW9A 1Q16B 2YQ3A 3D2WA 2WVEA 4KO0B 2BJEA 4A46A 1FRJA 1L3SA 4GO7X 2QYCA 2KM8B 3HHLC 3T1HF 5KFCA 5IZHA 2E7VA 4JI2J 1RDRA 4QWCA 3IXQA 4DR3F 2VA2A 3Q86A 4CP5A 3ZZRA 2E9ZA 2AMCB 3QO9B 1PYOB 3UCZP 4IR1A 4DL6A 2FHMA 2DNYA 3EGZA 3GV7B 3E2EA 3KMSA 2IRXA 2EG1A 5KG3A 2HK3A 4DR7J 3BYPA 3I56S 4TU8A 5E3QA 5I4MA 4B3OA 5ETKA 5C42B 4CH1A 3MMCA 1IN0A 2WVCA 3BGRB 3KK3B 2R7RA 1E6VA 1Z2LA 2XS2A 1PG5B 3F41A 3LWLA 1HI1A 4LFAJ 2HQ3A 2GHVC 3RRHA 4OZ1A 3ILJA 4CLYA 1HQ2A 2FZKB 1IKYB 3W5XA 2JWNA 4E98A 3ADAC 5B0FA 2J0QD 2AV5A 2DIUA 1F3VA 3M8ZA 3SSQA 1RTJB 1RHUB 4P2MA 3S01A 3CUNA 3CB4A 3TYTA 1I51B 3OTBA 5IWAJ 2GJIA 4HDGA 1S9GB 2DH8A 3SCKE 1GMWD 1TKXB 5C42A 3KUEA 5D4PA 1S6OA 2FZGB 3BGRA 4H4OA 3QAEA 3KK3A 4ZITA 3G71S 1ZS6A 2Y0SD 1YI2S 2AYBA 3R97A 3THPA 3IFEA 4XDDA 2OH2A 2FJVA 4F0HA 3KG4A 4IFYB 1RCXB 4DV2F 2RQKA 4ZPCA 3MAAB 3ETOA 4FF1A 4LF6F 2CNOB 5KFPA 4ALZA 4KV8A 5J2MB 1RTJA 1RP5A 2CWXA 4DWIA 2ASDA 2AF6A 3MPDA 1HWKA 5H9EK 1Y7PA 4NWBA 1TKXA 1FJ7A 2B7BB 3K17A 2BRLA 4ZVUB 2G0IA 3AOBA 2OPRB 3PFEA 3CDWA 3RJMB 2GQQA 2IYGA 3QRQA 4FYDA 4PQUB 1N34J 2FGOA 2WBRA 3BDPA 4IFYA 3TZXA 1RI7A 3QIPB 2GC8A 3FJ2A 1S4EA 4K4YA 4BHQA 3R7SB 4ZPBA 5CXTA 4B3RF 1WUUA 3RGIA 3R1HA 2HZAA 5T7LA 5E0OA 4CO2A 4GVLA 2VUGA 3TAQA 4PWUA 3M2RA 3MTJA 4KGMA 4CO0A 4GC6A 4DX6A 4ILMA 3TW0A 1B99A 3A8EA 1NB2A 2ZDPA 2NXJA 2DEIA 1U02A 4QJVA 5CZVA 1RB0A 2ZD1B 2DY1A 2DKOB 4Q8EA 4X4UA 2C2OB 1X31C 3R9LA 1F6TA 4KKOA 4LR7A 2L9WA 3TUIC 3RB0A 4NOHA 5KFSA 1CLFA 4K0KJ 3MCSA 4OI3A 5HMZA 4DV3J 2ADBA 2EFNA 4JI8F 2KHCA 2M70A 5KFEA 5KFFA 4RBTA 1TL5A 2Z2MA 3H90A 1NHUA 4DL3A 2RB7A 3MAHA 1VRTA 1X0FA 1KEKA 4A8FA 3R2CJ 6AT1B 4ANDA 3MUMP 3FVYA 4F04B 2DNNA 4DV1F 2BKOA 1XMOJ 4M5GA 4Q2MA 4YP3A 3KK1B 2KFYA 3FZ2A 2AD9A 1TAQA 2BABA 2QT7A 4QR0A 2HNYB 4FYWB 3X3UA 4ANCA 3TUPA 3IAM9 3MR2A 2XZTB 4ZVHA 3AHPA 1N48A 1DLOA 2CNNB 3CD0A 3DNCA 4DL5A 3KLFB 2VPXB 2XYGB 3IRXA 3MZIA 2B0GA 2R9LA 2V2ZA 4ZS6A 1WI6A 2C2RA 2MLYA 2HWTA 7AT1B 2FZCB 4HLBA 3M6WA 4JUZA 4DHVA 3NBPB 3ZZPA 2CQPA 1UVNA 3TAMB 1U1MA 4WF9Q 1VFJA 5D4OA 2E1PA 4ZVSB 2DR6A 1PJ7A 3MEGB 1HBMB 2NXEA 3OJSA 3CTRA 2AQ4A 4M5DA 2QLBB 3G82A 5KFGA 3WC0A 2D9OA 3H5SA 4N5SA 4YN3B 4Z7CA 2PT0A 2H4YB 3PRDA 3R8YA 3WC2A 3IS9A 2HRYA 4A8XA 4LSZB 3HFZB 4IDKB 1PILA 5HROA 4MIAA 4B3TJ 3MURP 5L39A 2OTLS 3I5BA 1HWLA 4ZJLA 4AT1B 2KT3A 3KG0A 1DFDA 2DR5A 3CC7S 2HFNA 1QVFR 2ZOGA 3PX4A 2R7OA 3NBPA 1VYAA 4KGXB 4CLLA 4U8VA 4USKA 3U27A 3UNYA 3MGJA 2DISA 3B4DA 1VI7A 4OIXA 4I6YA 1NSAA 3MEGA 1HBMA 4XPEA 4DN9A 2QL9B 2NXUA 2ZH7A 2G2OA 2VC1A 3CMQA 5GMKa 2CQHA 3C6TA 3Q23A 4B9NA 2QLWA 2W2NP 3UWTA 4LFBF 3RBDA 1JQGA 4TYBA 2HGLA 1F5AA 4QR2A 2XGPA 3CPWR 2W2PP 1Q1KA 3CWJA 4IDKA 1VJWA 1UPMB 2VHGA 2X3DA 4ZVRB 1D1UA 3V6KA 1EIYB 3M8SA 1KN6A 2HGNA 3RTVA 3S1TA 3UE2A 1R89A 1BQNB 1S10A 2VQFF 1JLGB 1UETA 4I69A 1CJUB 4Z2XA 3M30A 4DR2J 2V69A 3HFVA 1BD6A 2JZ5A 3R27A 3DDKA 4DV5J 4Q44A 1HNZF 2DHGA 4CNYA 5AXKA 4WFNQ 2AJ4A 1WG4A 4X65F 2I6WA 5D78A 4HVZA 3K0JA 1TMJA 4ZVEA 4WYWA 3ILOA 4IFVB 2YKNB 2R8KA 3GILA 1AUSL 1BMQB 2OO4A 2Y3YA 2QYGA 1IKVA 1S99A 3JQMA 4UTGA 2V6AA 2LQBA 4F50A 1NSQA 4I64A 2MB0B 4RO0A 2G1DA 1GH8A 1PAUB 3D28A 4DLEA 4NLSA 5T14A 3BGUA 4TU7A 3L7OA 1LW0B 4ZLPA 3K5OA 2UV8G 1YJVA 4C11B 4PCQA 4PZVA 3NL0A 1Q79A 1RKJA 1HNVA 1U8SA 4DL2A 4MKBA 4USTA 1HNIA 1KD1T 4OI0A 2EBGA 2CQ4A 4ZIWA 5GAGU 3NKYA 2H5IB 1SL2A 2CQIA 2YPYA 4USHA 2EVZA 2MGZB 1SC3B 1CQNA 1SQFA 7FD1A 3MD1A 4GKKJ 5A8WA 3AJDA 3KOAA 4WIQA 2HBYB 2HHTA 3GONA 3OL6A 1ZBTA 2FLPA 2DNKA 1FD8A 3CE8A 2J0WA 1FVQA 1P27B 4QIWD 3POTB 4DSFA 1AZSA 3FEZA 1NPKA 2APOA 5LMUJ 2C2DA 1SI9A 1SIWB 1U6ZA 1YKWA 2ZM6J 2ZH4A 1VLOA 1NH8A 4Y34A 1RHRB 5LSLA 2FDNA 1K8AT 1UFLA 3MM6A 2I0XA 4I68A 4NLQA 2MQ8A 2RT3A 4RNFA 4OX9F 2FLLA 4BBYA 3OTOJ 4N8NA 2IM3A 4FYXB 4B9LA 2CG4A 1QSSA 2IM1A 2GIQA 3W9HA 4OQJA 3M8QB 3J7ZT 3BS9A 3TEGA 4NCAA 4MT1A 3DMJB 3TEHB 6FD1A 2CPEA 5J2PB 1U0HB 2CZ4A 4X4NA 2C3YA 2MZ1A 4PKDB 1FJGF 3GIRA 4FPRA 1SUQB 3I5CA 5L46A 1WF0A 1JB0C 2XSJA 2VG6A 4PG6A 2LECA 3HI9A 2V34A 4O4GB 1SKUB 3LF0A 1RAJA 3CCUS 1UZDA 3LWMA 3JB9k 5KFBA 2HIQA 3IM8A 4Y6IA 1JLEA 3H59A 2ZHOA 5HVHA 3ZZ0A 4C3KA 2AW0A 3DLGB 4KH0B 1C0TB 3AA9A 2QE5A 4DCPB 1I5OB 3DMJA 4USUA 3MMAA 5J2PA 1U0HA 3JQJA 4LT6A 4A8QA 3DHXA 1S76D 5D0RA 1MMNA 1J5EF 3L7PA 3K8VA 2BJDA 1BC6A 3N6NA 1SUQA 1SKWA 5KG2A 4RW9B 2M8DB 2QSWA 3KXDA 3W66A 3US5A 3KWMA 3HKZD 3RB3A 2Z0GA 1WDTA 3TZYA 4N7TA 1JNZB 1KP6A 4U7CA 1HWJA 3DRPB 3SV3A 2FHKA 3UCUP 2BJ7A 1ZZNA 3WX4A 2OFHX 2XI2A 3NWGA 2VJUA 3WBZA 5DGBA 3MM5B 4QR1A 2OMOA 1RWMB 4DV4F 4ICLB 1NO8A 4LIRA 4DR5F 3BN4A 4WBFA 3U7JA 2B9YA 4YB1P 2MXYA 1W2BR 3QRRA 3QYYA 5BR8F 4QW9A 2IRYA 1TVRA 2HRUA 3KJVA 1ZZFA 3K89A 5T41A 2OKQA 1TKZA 1VQ7S 3CJKB 3HK2A 3IR7B 4NMLA 3DRPA 3D0HE 3L9ZA 1XEZA 2DITA 2MJUA 3NNAA 3NGRA 2IAJA 4GRSA 4OYXA 3AQPA 3A3NB 1RHQB 3RRKA 2V2KA 4ECRA 4OZLA 3T1YF 3W2VB 1SJ4P 3H0PA 4ICLA 2QLXA 1MNEA 4G6VB 1OY6A 2RS2A 4UQGA 1X60A 1R0AA 3QGGA 4F4XA 2AJ2A 1B70B 4QIFA 3QAUA 1FXLA 4LBHA 2RF2B 3MFHA 2FJAB 4NCBA 4EU0A 1GEHA 2KG1A 4IRKA 1QJHA 4N77A 3G8TA 3CULA 4U7UK 1UWAA 2B9WA 4HYKA 1R6YA 5KT4A 4ELTA 3F56A 5IQQA 3UD3P 1HBUB 2YNFB 2J9DA 3QGPA 3OHAA 2P9CA 3EMTA 5F3ZA 4H54A 5KT2A 1YJNS 1VQYA 2G13A 1Q8BA 1BQXA 4NA3A 1TV6A 3W2VA 3ETMA 1D0EA 4LF9J 4YB5A 3LP2B 4G1PA 2HYIB 1GMWA 3M1VB 2E5LF 4QZVB 2FHJD 1VCTA 3LH2S 4OYPA 3DRSA 5J1EA 2R42A 1WWHA 1T9WA 4DSJA 3UR3C 2LXFA 3UD4P 5KOWA 2DNPA 4DPUA 1WC4A 4XAKA 5J1PA 2CJAA 1C2PA 4ECUA 1T9YA 5GVQA 2A10A 2ZC4A 1XERA 4JI2F 4BDPA 4FF3A 3VV2B 1VQ6S 1YDLA 2BZ2A 2XB2D 1F9HA 3TVZA 1FNXH 4PYDA 4QIEA 3P3DA 3JXOA 4NRTA 2VG5B 4C3LA 2YNFA 3CCES 3SI8A 2HS3A 2AJ1A 3RW7A 2IC3A 2AJFE 4DR7F 4DSKA 3HP6A 3PX6A 3VGVA 4G3IA 2LQ9A 3LP2A 1NDCA 2RD5C 3DXBA 3M2UA 2ZE2B 3QQCD 2X1BA 3V81A 3CCRS 4LFAF 2G0JA 2N7CA 3P5TL 4NLVA 1SJRA 2M88A 3FDSA 1BHNA 4IOBA 1S9FA 3K57A 1FTCA 3KHRA 3AT1B 3KUHA 1YITS 1LWFB 3W3SA 1WC3A 4DL4A 3P5BP 5AE3A 5IWAF 3CW2C 2CWKA 4ETZA 2PD1A 3MEKA 2PA3A 3KLHB 4NCGA 3D6FB 4O3SA 1KKHA 2XLJA 1N0VC 3EX7B 4DU8A 5DZ7A 1Y3KA 1U4BA 1KHVA 2DRAA 2V4RA 3M8YA 4AL7A 4FPIA 4MMOA 1AW0A 1FRIA 1FX2A 2ZBIA 2MJNA 3KK2B 1NB7A 1FF2A 5F0UA 1UP1A 5EHHA 1HWIA 2OPPB 1RT6B 1DTQB 1LWFA 3K58A 4AQYJ 1MWZA 3BR8A 2JFDA 3L4BC 3OFHA 2B8QA 5B0EA 3BBBA 2DHSA 2B43A 3FUYA 4O3NA 1T02A 1OIAA 1LK5A 1NPRA 4K4VA 4DCJB 5A76A 4WZMA 1P6TA 1HARA 2Q3PA 4E8UA 1FWKA 5D6GA 3B4MA 1N34F 4M5IA 2K3KA 3NRBA 1ZH5A 3AD7C 4CLZA 3KLEB 1PC4A 3G6ES 2IBOA 2BANA 3Q8QB 3HHLB 1NCLA 2DR9A 2MKJA 3OVAA 2HNZA 1RT6A 1P9QC 2AJ0A 2DH7A 4JI1J 4NI2A 2BVZA 2GIRA 1JIHA 1N56A 4PR6A 3NCQA 1UA1A 1Y10A 4Y2CA 5B0BA 2V8VA 3R3TA 1QAXA 5HMWA 3BSNA 4ITSA 1GXTA 2VQEJ 1IR0A 1NJYA 2J6SA 1FKOB 2MQMA 4S0MA 3KLGA 2O5DA 1VQ8S 2GAHC 1XR7A 3W8PA 4K0KF 1REVA 4OI4A 3M2VA 3V2UC 3GFZA 3R1LA 2EC2A 1KVJA 3K8WA 4MKYA 1N6QB
chains in the Genus database with same CATH topology
1DLOB 4A8SA 2W9CB 4I2QA 2YKAA 2XEXA 3NG8A 2L9NA 1R8AA 4FNHA 4USIA 2KTQA 5CH7B 4P2SA 3IRXB 3V6JA 1S9EB 4B3SF 3I5AA 3GFHA 2MKIA 2J6TA 3M05A 1QSYA 4CH0S 2HNDA 4ZCKA 1LFWA 2YH1A 1XMOF 1Q81T 2I5JA 4MTPA 4ED0A 1ZM9A 4HHJA 2UXCF 4A8OA 1AFJA 2W4DA 5I42A 4O4GA 1H2TZ 4Y2IA 3CO9A 2HHPA 1NU4A 2V4QA 2UUBF 1UWBA 1D8ZA 3CJ0A 4L3NA 5HBMA 5D3GB 2DNQA 3QPIA 2B7CB 5DJBA 1JK9B 1UA0A 2FC8A 4ED2A 2KT2A 3DLEB 4DFJA 4DBQA 1KNZA 1VQ5S 4ED3A 1WHXA 1VGYA 3BGFA 3RW6A 1WEYA 2J9EA 3CCZA 3HFKA 5JVGQ 2HWHA 4IH7A 4RW7A 3UI3A 4LSNB 3CCQS 2UUAF 3CIZA 3CC2S 5GADU 2KZZA 1X5PA 3DLGA 4EWTA 1S72S 2RKIB 1C0TA 2V5HG 3J81Y 3TARA 1SBRA 1VS3A 2GV1A 4OHXA 1WD6A 4YOEA 2VODA 2QO3A 4OV1A 2BXJA 4Y2AA 4M5DB 4BCAA 2AGPA 2IBKA 1XNQF 2CJKA 3HF5A 3RBEA 4B9UA 2EK6A 4QYZJ 2R7QA 3MF5A 4J9SA 4FF4A 3HJFA 4IH6A 2GNKA 1YIJS 4TNOA 4QIVA 4YB7A 2IVMA 1X4CA 1JLBA 1T05A 4ES2A 2FHJA 1IJEB 2PA8D 2NR0A 5CYQA 2KB2A 3IS9B 5HP1B 1X9SA 3QIDA 4NLDA 4RW9A 3VAMA 5BYSA 1HW8A 1N52B 2LLZA 2M3DA 5L38A 3CMES 1GQEA 3B82A 5HROB 3H2LA 3KLIB 3BSCA 3PRBA 2N7YA 1WF2A 1MROB 1X4DA 1RT3B 2F40A 1DTTA 4ZPVR 5JUMA 3VAFA 1U6BA 4HKQA 2QA4G 4IKAA 1FDDA 2DT9A 4ZPDA 2BUNA 1BQMA 3K5MA 1GXLA 3O44A 5KAKA 5EWFA 2KXHA 1QVGR 4WXWA 5CA5A 1N5QA 2BACA 2P9GA 2E66A 1FRLA 3GIMA 3DM2B 1KFDA 3ENQA 1LK7A 3J7YI 3HX9A 1U1KA 3S8SA 1XR5A 2DHXA 5DDRC 2CQCA 4NLRA 2W7PA 5D3GA 4Y00A 2HHWA 2BW2A 3VCDA 1KFSA 4YEAA 2M2BA 3I9ZA 4PG5A 4DQSA 2VPYB 2J5AA 4KFBB 3ITHB 3ONQA 4RW4B 2M5YA 4AL5A 1UL3A 5I3PA 4QU7A 2KI2A 3UNGC 1JKHA 1Y5LB 2WONB 2VFTA 3GFXA 1M90T 2R8JA 4A47A 1TK8A 2I38A 4K59A 1U1LA 2JJ4D 3MM5A 3MXHP 1H7WA 1FK9B 4RU2A 1ZTWA 1J2VA 2LCWA 3BB5A 2RKIA 1IXKA 5F0WA 3M6XA 4X4TA 2CQBA 2B5JA 4A8WA 2KT5A 1BY9A 2QA1A 2IVYA 2E5GA 3DLKA 4DV0F 3GQCA 1WF1A 4HH1A 3HLUA 1HI8A 4WE1A 4JI4F 4B3TF 1U1QA 3H98A 2K3IA 2DNHA 3OXGA 2GMJA 2W24A 1U47A 4CZCA 5AE1A 2RRNA 4GMKA 5LSRA 2BM1A 2WAQD 2DGQA 2QMWA 1VQLS 1QTMA 2CPYA 1D9DA 1FE0A 5E3PA 2HW3A 1FKPA 3ZZTA 1GTHA 2MKSA 4HI1A 1OQ3A 1Q8LA 3C6TB 5HI7A 1U2FA 1S1TA 2MZSA 3TP2A 4O44B 2DJWA 3G86A 3HO1A 4Q8FA 1O51A 2FVCA 4HTIA 4Y0FA 2ERRA 2CPIA 2A1BA 3OVSA 4NXMF 3JSYA 1WI8A 2YKMA 3TRGA 3ZFVA 3JSBA 1LFPA 2HZCA 3M9NB 7FDRA 2UVWA 3KLIA 4J37A 4USJC 3CJ3A 3C2PA 4ZVFA 3D1QA 5C24A 4A8YA 4CQ1A 4Q45A 4C0OC 3W2WA 5KG5A 2AWZA 2LEPA 2WRMA 2B51A 4DPOA 2CPZA 1S4FA 5CZXA 4YR0A 1D9AA 5IM0B 2F8HA 4A8KA 3BO4A 1FDBA 1YJWS 4ILLA 3CJKA 1WHVA 2I2YA 2RRAA 3BREA 1HNWF 2JH3A 4LVNP 4BS2A 5KFUA 3L09A 1B7FA 1I1GA 3VTIA 3V6DB 1LOUA 4KFBA 4RLEA 1EP4A 1QAYA 4RW4A 4C8LA 1FDNA 1YBAA 1MMDA 2MYFA 1JXLA 2I1RA 5ADZA 2P9EA 5KT3A 1VHFA 2WONA 3BZQA 2F9JA 5DM6Q 2GA7A 3MOJB 3QGHA 2GW8A 4DX8H 3M30B 4B9TA 3GG1A 3SCJE 1HMVB 5KFDA 3J7YU 4DR1F 4LF4F 1RT2B 3I4HX 4UY8T 3DFEA 4R0EA 1VQOS 1S97A 1XR6A 2YNIA 1KC8T 4JOUA 2JEGA 4LF9F 3DLLQ 4X4OA 2WTFA 3D1OA 3N0VA 3J80Y 5AE2A 1UW4A 2R7WA 2GMLA 1UVIA 4K4WA 4URGA 3DLHA 2IFXA 4Q0BB 4UW2A 2ZITA 2MZJA 3HMJG 1YJTA 3MECB 3IA0A 3ZZZA 1Q4RA 2HG4A 2JHEA 4CNZA 4ZPTR 2DGXA 4C8KA 5A8RB 2AGQA 5C25A 3W7BA 4MK7A 3AJ1A 5IT4A 4O3OA 4NRUA 1R7IA 1B0PA 3M32A 5FDLB 4H4KC 2VC0A 1JNRB 2RF2A 4M94A 4DFKA 1TFWA 4I67A 1SIZA 1MSWD 2K8GA 3CC4S 3DI6B 4MJKA 3V4IB 1G6BA 1VK3A 2DNRA 5ITHA 4LF7F 3C66A 3GSDA 1ZM4A 4WFXA 3QLHB 2LQ5A 1K9MT 2FJBB 1RTDA 2N3LA 2M8HA 1VC5A 1Q86T 4IG3B 2OFGX 5LL6d 1N54B 1V3ZA 2C2EA 2NUHA 3V5RA 1HW9A 2Q1LA 4DR2F 1Q16B 4C2MA 3WZ0A 4ZOSA 2YQ3A 1IKVB 3E01A 4EFAC 1HHTP 3NMAA 3KHHA 3D2WA 4WFYA 5DQGA 4KO0B 1G2EA 2BJEA 4EEYA 4A46A 2ZBCA 1VQMS 2M9KA 2QRRA 3RU0A 4FS1A 3RR7A 2P6TA 4DV5F 1HBUA 2DGVA 4AXJA 1FRJA 1L3SA 4GO7X 4LF8F 2QYCA 1NZAA 1FVSA 4ED7A 5JXSA 3HHLC 1N5VA 2KM8B 3KHGA 3FSIA 3T1HF 5KFCA 3DRYA 5IZHA 1K73T 5F3TA 3OUYA 3CDUA 1KQKA 1RDRA 5KFAA 4QWCA 5KFIA 3CF5Q 1NJWA 4WYLA 3JSRA 3IXQA 4ZP6A 4DR3F 2VA2A 5L1JA 2CPHA 2OPSB 3O8WA 4ZPAA 3ZZRA 2E9ZA 2MHEA 3QO9B 3PV8A 1P8GA 1RA7A 5DQHA 2D74B 5G0RA 2DNGA 4WFZA 3UCZP 4IR1A 1RT7A 4B9VA 4DL6A 2N3OA 2FHMA 1H98A 2DNYA 1T7PA 3EGZA 1CEZA 4AXIA 5DG9A 3M1VA 3GV7B 4IYQA 4DF8A 3E2EA 4DV6F 3R5CA 5F9NA 3KMSA 3HHNB 2IRXA 2KU7A 2EG1A 5KG3A 5GAGI 2XC9A 1NJIT 4AL6A 1PGZA 3OHBA 3OTDA 3I56S 4DF4A 4AFFA 1N5YA 4TU8A 4F8RA 4ZP8A 5DDOC 2XCPA 5L1LA 1HNVB 5E3QA 5I4MA 1L5UA 4Q5VA 4B3OA 3G8QA 2XNRA 1E6YA 4RUCA 3IG1B 2J0SD 1IQZA 2B3TB 4R25A 5C42B 4CH1A 2LDIA 1C0UA 3MMCA 5K8MA 3N28A 5FLXY 3V4IA 4PXCA 1HBNA 1HNIB 1IN0A 1Y3JA 2COLA 2WCXA 3QLHA 3BGRB 3DRXA 3JYTA 2K7KA 4ZHRA 3KK3B 2R7RA 1DRZA 4ECXA 1E6VA 1Z2LA 2XS2A 2N4CA 3K59A 2FPHX 3OW2R 4M8LA 3HPOA 2MMYA 3G6YA 2U1AA 1RT1B 2V9KA 3F41A 2WOMB 3LWLA 3T19A 3NAIA 1HI1A 1FJCA 3CCSS 2CDQA 4KHPF 5A0YB 2HQ3A 2FY1A 2FIUA 2GHVC 3RRHA 3G6VA 4OZ1A 1RQ0A 4Z37A 5A8WB 3Q8SB 2VG5A 3GIIA 4XO0A 2GJ2A 3CXCR 3H5XA 3IBWA 3PEHA 1IKYB 2CQ1A 4ECWA 2F8MA 2VH7A 1T03B 2IYIA 4O3QA 2JWNA 5I3UB 4QPTA 3OL8A 4TXSA 4UUXA 1Z2ZA 1HA1A 3PJXA 4E98A 4PG8A 2OP5A 5B0FA