3S02A

The crystal structure of the periplasmic domain of helicobacter pylori motb (residues 103-256)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
146
structure length
146
Chain Sequence
SVLEQIDQGSILKLPSNLLFENATSDAINQDMMLYIERIAKIIQKLPKRVHINVRGFTDDTPLVKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDSLENRMKNNRVEIFFSTDANDLSKIHSILDNEFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Motility protein B
publication title Role of the MotB linker in the assembly and activation of the bacterial flagellar motor.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Motor protein
total genus 44
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3s02A00
3WPXA 3TD3A 4ZHYB 4ZHVA 4RHAA 2K1SA 2LCAA 4B5CA 4PWTA 5EB1B 1OAPA 2HQSC 3WPWA 3LDTA 4G4XA 2ZVZA 1R1MA 3S0HA 4ERHA 3S0YA 3CYPB 3TD5A 2LBTA 3S0WA 3S02A 3OONA 2ZOVA 2W8BC 3KHNA 2ZVYA 2ZF8A 3TD4A 3S03A 4G4VA 4R40B 3CYQA 3S06A 2N48A 3IMPA 2MQEA 2AIZP 4G4YA 4G88A 4G4WA 4ZHWA 4G4ZA 2KGWA 5EB0A 2L26A 4B62A 5EAZA
chains in the Genus database with same CATH superfamily
2CWJA 4YJ3B 1M1KH 4TV8A 2R6R1 4HNAA 4BY9D 2UYNB 3P10A 5HP8A 4BT3A 3N4ZA 1W3EX 3KE1A 4O4IB 3N2GB 1IV2A 1VQMF 3IR9A 4DRXA 1U3LA 1GX1A 3CG6A 4TV9A 3JCMM 1ONIA 3MCAB 1N8RH 1XBIA 3SIVA 3JALA 5KX5B 5IT9M 3MCQA 1X7PA 4TUYA 2W8BC 1IV3A 4O4JA 3JAMM 1VQNF 4IHJA 1JY8A 3NVKE 4I50A 2KGWA 3RYHA 5HY4A 5LA6B 1M90H 5JQGB 3ESJA 4ZHVA 5JCOA 5HXUA 2FGYA 1RLGA 2CW4A 5HY1A 3C9RA 1GZ0A 5CB4A 3LDTA 1YQNA 4U3JB 1QVFF 4TV8B 2NMUA 1SDSA 3HKDA 3GTZA 3TD5A 3F6MA 3VOAA 3JARA 2ZOVA 4DRXB 3P0ZA 4C4WC 4TV9B 3FFMA 3CYQA 3I55F 4X3MA 5CA1A 3B6NA 1IV1A 5EYPA 3JALB 3ERNA 4ZK7A 5J2UA 4TUYB 2I6RA 1COMA 1FNJA 3QTYA 3WGKA 4O4JB 2V9YA 4C82A 4IHJB 5LP6A 2K1SA 3CCSF 5EB1B 3M4SA 3WGMA 2Q1XA 4I50B 4C8GA 3ZP7A 3CMAF 3RYHB 1ODEA 3ELCA 2IAFA 3HKCA 1VQ9F 5DCVA 2UYKA 3S0HA 3JVHA 2CHSA 4ERHA 2PMPA 4I55B 1H47A 2RHJA 5CB4B 3S02A 1VQVA 3G71F 4NQ3A 1Q7YH 3S03A 3HKBA 2LBXA 4G4VA 3NK7A 3RYFA 2N48A 1KNKA 3CXCF 1KD1H 2RHHA 1FSZA 3HKDB 4BVTA 4ZHWA 1JJ2F 1Q82H 3RE3A 3E22A 3JARB 2Z01A 2KTUA 3WPXA 2HRUA 3K0TA 4FFBA 5KMGB 1H48A 4X1YA 3T80A 3VYTC 5EYPB 3M84A 2RB9A 4O4LA 5IJ0B 5J2UB 5JH7A 3VMFB 3NK6A 1YIJF 2Z1FA 1X7OA 3JASA 1R1MA 1T0KB 5LP6B 5HWEA 5JCOC 3HKCB 1XRGA 3IMPA 1KC8H 4M8IA 5GONB 2B33A 3ON1A 2Z1UA 2CZWA 1DBFA 4O4IA 3RYFB 4X20B 4RHAA 3PLAC 3RYIB 3ZO8A 3RA6A 3E22B 3FD6A 2FC3A 2HS4A 1Q86H 4FFBB 3E1YA 3G4SF 3CCUF 1SA0A 2HRYA 5LP6C 5G4UC 3O85A 4O4LB 2VGNA 2HP3A 3DC2A 5JH7B 3HJWC 3MDOA 4BVQA 1W59A 2Z1TA 3KHNA 3C9TA 1X52A 3CPQA 3JASB 3S06A 3WGNA 2BTOA 1K9MH 2VGMA 3OBYA 3CCLF 5MN5A 3FBAA 3OBWA 1YHQF 2OHWA 2VAMA 2CSLA 1YJWF 2Q1YA 1KNJA 2H8EA 1KQSF 5EWRA 4U3JA 3AGKA 5J2TA 2QEXF 2QA4F 3VYUC 1VQ8F 2ZODA 4B45A 3EORA 5GANK 4LNUA 3N2KA 3VCZA 4C81A 1YJ9F 1OFUA 2RHLA 5G4VC 3FPIA 1SA0B 2AIZP 5FJ4C 3LYBA 3CCJF 5B8FA 2GZLA 4DXDA 3GHZA 3CB2A 2YYEA 1W581 5GIPC 4I55A 3FD5A 2Z1EA 4RQOA 5MN6A 1W5EA 5J2TB 1VHAA 4BT6A 2VAWA 2OTLF 2DYYA 4X1KA 5HY2A 4U39A 3CC4F 4LNUB 3N2KB 5KMGA 1Q8RA 2IQQA 2VAPA 3VIUA 5GINC 4G4WA 5LOVA 2OZBA 4G4ZA 3BYQA 4BVSA 5IJ0A 3IEWA 1J7HA 1OAPA 1Z5WA 3CCRF 3LWVC 1U40A 1W5AA 5LXTA 5MN4A 1YITF 2OTMA 4O2BA 2ALEA 1CN7A 1W42A 5GONA 2CHTA 5IYZA 2BTQB 3CCQF 3TD4A 3HKEA 2OTJF 3CPWF 1XHOA 4EI9A 4X20A 1QAHA 3RYIA 5HXZA 4ZI7A 3GYQA 4X1KB 4ZHYB 3HWUA 4BT4A 1QD9A 1CLIA 5EZYB 4NWOB 5LOVB 4X1IB 5GAPK 1PXWA 2ZVZA 3D01A 3KJKA 3KIZA 1U3PA 5EO3A 4BT5A 5LXTB 4O2BB 1X25A 4G4YA 3CCEF 1NJIH 1W40A 3WJQA 3V4DA 3F0GA 4C8IA 1YJNF 5IYZB 3HKEB 3TD3A 3F0DA 4EB6A 2UYPA 5HY0A 2HQSC 3JATB 5CA0A 3OW2F 4ZI7B 3VI6A 1H7MA 3WJRA 3CCVF 1NQ3A 2VXYA 1W55A 3J80M 1IV4A 3Q8HA 3LWOC 4WBNB 3HTNA 3WXMB 1JN1A 3D00A 4R40B 1VQPF 2JNBA 4I4TA 3L7QA 4ZOLB 3LFOA 1CK2A 1VQLF 2HVYD 3RYCA 3NVIB 3I56F 4YJ2A 2QI2A 2LCAA 2RHOA 2BTUA 2KTVA 3IEQA 4XCQA 2DT4A 4BW0B 2PHNA 5JVDA 3QHDA 3J81M 2KG4A 4EB6B 3I3FA 5BMVB 3CYPB 1VK3A 5CA0B 4IIJA 1YI2F 3OONA 1GO1A 5A2QM 2ZVYA 3JAKA 3C9SA 1YGYA 3K14A 3PAFA 3C9UA 3HAXD 3N4YA 1VQ6F 4O4HA 4I4TB 1TUBA 4F6RB 2AIFA 2CVLA 3JAWA 3RYCB 4YJ2B 2LBTA 1JD1A 5JVDB 4BT2A 1FNKA 3U0OA 3V3TA 4TZZA 1W5BA 3VOBA 4EI8A 5EZYA 1W41A 4IIJB 3UT5B 3SIUA 2HP0A 5EAZA 4X1IA 5EIBD 5C8YA 3R0PA 3J7AR 3F0EA 3JAKB 2H6LA 2P6YA 5AVMA 5ITZA 5GIOC 1QVGF 1VQOF 4PWTA 3CC2F 1RA4A 4E6EA 3DDNA 3IKFA 3K2XA 3LMEA 1NMUB 3CMEF 5HP7A 2ZAUA 4HNAB 5FLXM 4ZHQA 4O4HB 1K8AH 1DT9A 1TUBB 4C8EA 4NUTA 3M1XA 3QUWA 1RLUA 3F0FA 4O2AA 3JAWB 3LWQC 3V7EA 2GVIA 3CCMF 2H8CA 1W57A 3VTIC 1Q81H 1TVKA 3IKEA 1VQ7F 3JATA 3LWRC 3WGLA 2EWCA 3WGJA 1JFFA 4B5CA 3VYSC 3ZP4A 2HX0A 4WBNA 1RQ7A 2HP0B 3C8LA 1UI9A 5C8YB 1U43A 5ITZB 1K73H 3ZOPA 5FNVA 1SZQA 2R751 4ZOLA 1E7KA 3V7QA 2UYJA 2ZF8A 4KWEA 1S72F 3D54A 1VQ5F 1XV2A 2GLZA 4ZHQB 2HS0A 4B46A 5IJ9A 4O2AB 1FFXA 5CA1B 4BVRA 2YXZA 1RQ2A 2WALA 2UZHA 1T0AA 3CD6F 1TVKB 5BMVA 2IG8A 2BO1A 4LCKA 1W5FA 3I7TA 1JFFB 1PF5A 3S0WA 3MQWA 4EI7A 2AMTA 1VQKF 1Z5VA 5LYJA 4YJ3A 5EIBC 4BT7A 4G88A 2F9ZC 2UYNA 5FNVB 2G9IA 3K12A 2HS3A 3RA5A 3N2GA 2L26A 2I6DA 4B62A 4F6RA 3HKBB 2LBWA 3VO8A 3G6EF 1QU9A 1ZWZA 3P4EA 1IPAA 5KX5A 3WPWA 1VQ4F 5IJ9B 4G4XA 3CC7F 2QTPA 1FFXB 1VH8A 4X1YB 1W2BF 3NMUC 3S0YA 3LWPC 4X3LA 3MBMA 3UT5A 5LA6A 5JQGA 2MQEA 1UFYA 3E20B 3WJPA 5EB0A 1GO0A 3KJJA 5LYJB
chains in the Genus database with same CATH topology
3WPXA 3TD3A 4ZHYB 4ZHVA 4RHAA 2K1SA 2LCAA 4B5CA 4PWTA 5EB1B 1OAPA 2HQSC 3WPWA 3LDTA 4G4XA 2ZVZA 1R1MA 3S0HA 4ERHA 3S0YA 3CYPB 3TD5A 2LBTA 3S0WA 3S02A 3OONA 2ZOVA 2W8BC 3KHNA 2ZVYA 2ZF8A 3TD4A 3S03A 4G4VA 4R40B 3CYQA 3S06A 2N48A 3IMPA 2MQEA 2AIZP 4G4YA 4G88A 4G4WA 4ZHWA 4G4ZA 2KGWA 5EB0A 2L26A 4B62A 5EAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WPX A;  3TD3 A;  4ZHY B;  4ZHV A;  4RHA A;  2K1S A;  2LCA A;  4B5C A;  4PWT A;  5EB1 B;  1OAP A;  2HQS C;  3WPW A;  3LDT A;  4G4X A;  2ZVZ A;  1R1M A;  3S0H A;  4ERH A;  3S0Y A;  3CYP B;  3TD5 A;  2LBT A;  3S0W A;  3S02 A;  3OON A;  2ZOV A;  2W8B C;  3KHN A;  2ZVY A;  2ZF8 A;  3TD4 A;  3S03 A;  4G4V A;  4R40 B;  3CYQ A;  3S06 A;  2N48 A;  3IMP A;  2MQE A;  2AIZ P;  4G4Y A;  4G88 A;  4G4W A;  4ZHW A;  4G4Z A;  2KGW A;  5EB0 A;  2L26 A;  4B62 A;  5EAZ A; 
#chains in the Genus database with same CATH topology
 2CWJ A;  4YJ3 B;  1M1K H;  4TV8 A;  2R6R 1;  4HNA A;  4BY9 D;  2UYN B;  3P10 A;  5HP8 A;  4BT3 A;  3N4Z A;  1W3E X;  3KE1 A;  4O4I B;  3N2G B;  1IV2 A;  1VQM F;  3IR9 A;  4DRX A;  1U3L A;  1GX1 A;  3CG6 A;  4TV9 A;  3JCM M;  1ONI A;  3MCA B;  1N8R H;  1XBI A;  3SIV A;  3JAL A;  5KX5 B;  5IT9 M;  3MCQ A;  1X7P A;  4TUY A;  2W8B C;  1IV3 A;  4O4J A;  3JAM M;  1VQN F;  4IHJ A;  1JY8 A;  3NVK E;  4I50 A;  2KGW A;  3RYH A;  5HY4 A;  5LA6 B;  1M90 H;  5JQG B;  3ESJ A;  4ZHV A;  5JCO A;  5HXU A;  2FGY A;  1RLG A;  2CW4 A;  5HY1 A;  3C9R A;  1GZ0 A;  5CB4 A;  3LDT A;  1YQN A;  4U3J B;  1QVF F;  4TV8 B;  2NMU A;  1SDS A;  3HKD A;  3GTZ A;  3TD5 A;  3F6M A;  3VOA A;  3JAR A;  2ZOV A;  4DRX B;  3P0Z A;  4C4W C;  4TV9 B;  3FFM A;  3CYQ A;  3I55 F;  4X3M A;  5CA1 A;  3B6N A;  1IV1 A;  5EYP A;  3JAL B;  3ERN A;  4ZK7 A;  5J2U A;  4TUY B;  2I6R A;  1COM A;  1FNJ A;  3QTY A;  3WGK A;  4O4J B;  2V9Y A;  4C82 A;  4IHJ B;  5LP6 A;  2K1S A;  3CCS F;  5EB1 B;  3M4S A;  3WGM A;  2Q1X A;  4I50 B;  4C8G A;  3ZP7 A;  3CMA F;  3RYH B;  1ODE A;  3ELC A;  2IAF A;  3HKC A;  1VQ9 F;  5DCV A;  2UYK A;  3S0H A;  3JVH A;  2CHS A;  4ERH A;  2PMP A;  4I55 B;  1H47 A;  2RHJ A;  5CB4 B;  3S02 A;  1VQV A;  3G71 F;  4NQ3 A;  1Q7Y H;  3S03 A;  3HKB A;  2LBX A;  4G4V A;  3NK7 A;  3RYF A;  2N48 A;  1KNK A;  3CXC F;  1KD1 H;  2RHH A;  1FSZ A;  3HKD B;  4BVT A;  4ZHW A;  1JJ2 F;  1Q82 H;  3RE3 A;  3E22 A;  3JAR B;  2Z01 A;  2KTU A;  3WPX A;  2HRU A;  3K0T A;  4FFB A;  5KMG B;  1H48 A;  4X1Y A;  3T80 A;  3VYT C;  5EYP B;  3M84 A;  2RB9 A;  4O4L A;  5IJ0 B;  5J2U B;  5JH7 A;  3VMF B;  3NK6 A;  1YIJ F;  2Z1F A;  1X7O A;  3JAS A;  1R1M A;  1T0K B;  5LP6 B;  5HWE A;  5JCO C;  3HKC B;  1XRG A;  3IMP A;  1KC8 H;  4M8I A;  5GON B;  2B33 A;  3ON1 A;  2Z1U A;  2CZW A;  1DBF A;  4O4I A;  3RYF B;  4X20 B;  4RHA A;  3PLA C;  3RYI B;  3ZO8 A;  3RA6 A;  3E22 B;  3FD6 A;  2FC3 A;  2HS4 A;  1Q86 H;  4FFB B;  3E1Y A;  3G4S F;  3CCU F;  1SA0 A;  2HRY A;  5LP6 C;  5G4U C;  3O85 A;  4O4L B;  2VGN A;  2HP3 A;  3DC2 A;  5JH7 B;  3HJW C;  3MDO A;  4BVQ A;  1W59 A;  2Z1T A;  3KHN A;  3C9T A;  1X52 A;  3CPQ A;  3JAS B;  3S06 A;  3WGN A;  2BTO A;  1K9M H;  2VGM A;  3OBY A;  3CCL F;  5MN5 A;  3FBA A;  3OBW A;  1YHQ F;  2OHW A;  2VAM A;  2CSL A;  1YJW F;  2Q1Y A;  1KNJ A;  2H8E A;  1KQS F;  5EWR A;  4U3J A;  3AGK A;  5J2T A;  2QEX F;  2QA4 F;  3VYU C;  1VQ8 F;  2ZOD A;  4B45 A;  3EOR A;  5GAN K;  4LNU A;  3N2K A;  3VCZ A;  4C81 A;  1YJ9 F;  1OFU A;  2RHL A;  5G4V C;  3FPI A;  1SA0 B;  2AIZ P;  5FJ4 C;  3LYB A;  3CCJ F;  5B8F A;  2GZL A;  4DXD A;  3GHZ A;  3CB2 A;  2YYE A;  1W58 1;  5GIP C;  4I55 A;  3FD5 A;  2Z1E A;  4RQO A;  5MN6 A;  1W5E A;  5J2T B;  1VHA A;  4BT6 A;  2VAW A;  2OTL F;  2DYY A;  4X1K A;  5HY2 A;  4U39 A;  3CC4 F;  4LNU B;  3N2K B;  5KMG A;  1Q8R A;  2IQQ A;  2VAP A;  3VIU A;  5GIN C;  4G4W A;  5LOV A;  2OZB A;  4G4Z A;  3BYQ A;  4BVS A;  5IJ0 A;  3IEW A;  1J7H A;  1OAP A;  1Z5W A;  3CCR F;  3LWV C;  1U40 A;  1W5A A;  5LXT A;  5MN4 A;  1YIT F;  2OTM A;  4O2B A;  2ALE A;  1CN7 A;  1W42 A;  5GON A;  2CHT A;  5IYZ A;  2BTQ B;  3CCQ F;  3TD4 A;  3HKE A;  2OTJ F;  3CPW F;  1XHO A;  4EI9 A;  4X20 A;  1QAH A;  3RYI A;  5HXZ A;  4ZI7 A;  3GYQ A;  4X1K B;  4ZHY B;  3HWU A;  4BT4 A;  1QD9 A;  1CLI A;  5EZY B;  4NWO B;  5LOV B;  4X1I B;  5GAP K;  1PXW A;  2ZVZ A;  3D01 A;  3KJK A;  3KIZ A;  1U3P A;  5EO3 A;  4BT5 A;  5LXT B;  4O2B B;  1X25 A;  4G4Y A;  3CCE F;  1NJI H;  1W40 A;  3WJQ A;  3V4D A;  3F0G A;  4C8I A;  1YJN F;  5IYZ B;  3HKE B;  3TD3 A;  3F0D A;  4EB6 A;  2UYP A;  5HY0 A;  2HQS C;  3JAT B;  5CA0 A;  3OW2 F;  4ZI7 B;  3VI6 A;  1H7M A;  3WJR A;  3CCV F;  1NQ3 A;  2VXY A;  1W55 A;  3J80 M;  1IV4 A;  3Q8H A;  3LWO C;  4WBN B;  3HTN A;  3WXM B;  1JN1 A;  3D00 A;  4R40 B;  1VQP F;  2JNB A;  4I4T A;  3L7Q A;  4ZOL B;  3LFO A;  1CK2 A;  1VQL F;  2HVY D;  3RYC A;  3NVI B;  3I56 F;  4YJ2 A;  2QI2 A;  2LCA A;  2RHO A;  2BTU A;  2KTV A;  3IEQ A;  4XCQ A;  2DT4 A;  4BW0 B;  2PHN A;  5JVD A;  3QHD A;  3J81 M;  2KG4 A;  4EB6 B;  3I3F A;  5BMV B;  3CYP B;  1VK3 A;  5CA0 B;  4IIJ A;  1YI2 F;  3OON A;  1GO1 A;  5A2Q M;  2ZVY A;  3JAK A;  3C9S A;  1YGY A;  3K14 A;  3PAF A;  3C9U A;  3HAX D;  3N4Y A;  1VQ6 F;  4O4H A;  4I4T B;  1TUB A;  4F6R B;  2AIF A;  2CVL A;  3JAW A;  3RYC B;  4YJ2 B;  2LBT A;  1JD1 A;  5JVD B;  4BT2 A;  1FNK A;  3U0O A;  3V3T A;  4TZZ A;  1W5B A;  3VOB A;  4EI8 A;  5EZY A;  1W41 A;  4IIJ B;  3UT5 B;  3SIU A;  2HP0 A;  5EAZ A;  4X1I A;  5EIB D;  5C8Y A;  3R0P A;  3J7A R;  3F0E A;  3JAK B;  2H6L A;  2P6Y A;  5AVM A;  5ITZ A;  5GIO C;  1QVG F;  1VQO F;  4PWT A;  3CC2 F;  1RA4 A;  4E6E A;  3DDN A;  3IKF A;  3K2X A;  3LME A;  1NMU B;  3CME F;  5HP7 A;  2ZAU A;  4HNA B;  5FLX M;  4ZHQ A;  4O4H B;  1K8A H;  1DT9 A;  1TUB B;  4C8E A;  4NUT A;  3M1X A;  3QUW A;  1RLU A;  3F0F A;  4O2A A;  3JAW B;  3LWQ C;  3V7E A;  2GVI A;  3CCM F;  2H8C A;  1W57 A;  3VTI C;  1Q81 H;  1TVK A;  3IKE A;  1VQ7 F;  3JAT A;  3LWR C;  3WGL A;  2EWC A;  3WGJ A;  1JFF A;  4B5C A;  3VYS C;  3ZP4 A;  2HX0 A;  4WBN A;  1RQ7 A;  2HP0 B;  3C8L A;  1UI9 A;  5C8Y B;  1U43 A;  5ITZ B;  1K73 H;  3ZOP A;  5FNV A;  1SZQ A;  2R75 1;  4ZOL A;  1E7K A;  3V7Q A;  2UYJ A;  2ZF8 A;  4KWE A;  1S72 F;  3D54 A;  1VQ5 F;  1XV2 A;  2GLZ A;  4ZHQ B;  2HS0 A;  4B46 A;  5IJ9 A;  4O2A B;  1FFX A;  5CA1 B;  4BVR A;  2YXZ A;  1RQ2 A;  2WAL A;  2UZH A;  1T0A A;  3CD6 F;  1TVK B;  5BMV A;  2IG8 A;  2BO1 A;  4LCK A;  1W5F A;  3I7T A;  1JFF B;  1PF5 A;  3S0W A;  3MQW A;  4EI7 A;  2AMT A;  1VQK F;  1Z5V A;  5LYJ A;  4YJ3 A;  5EIB C;  4BT7 A;  4G88 A;  2F9Z C;  2UYN A;  5FNV B;  2G9I A;  3K12 A;  2HS3 A;  3RA5 A;  3N2G A;  2L26 A;  2I6D A;  4B62 A;  4F6R A;  3HKB B;  2LBW A;  3VO8 A;  3G6E F;  1QU9 A;  1ZWZ A;  3P4E A;  1IPA A;  5KX5 A;  3WPW A;  1VQ4 F;  5IJ9 B;  4G4X A;  3CC7 F;  2QTP A;  1FFX B;  1VH8 A;  4X1Y B;  1W2B F;  3NMU C;  3S0Y A;  3LWP C;  4X3L A;  3MBM A;  3UT5 A;  5LA6 A;  5JQG A;  2MQE A;  1UFY A;  3E20 B;  3WJP A;  5EB0 A;  1GO0 A;  3KJJ A;  5LYJ B; 
#chains in the Genus database with same CATH homology
 3WPX A;  3TD3 A;  4ZHY B;  4ZHV A;  4RHA A;  2K1S A;  2LCA A;  4B5C A;  4PWT A;  5EB1 B;  1OAP A;  2HQS C;  3WPW A;  3LDT A;  4G4X A;  2ZVZ A;  1R1M A;  3S0H A;  4ERH A;  3S0Y A;  3CYP B;  3TD5 A;  2LBT A;  3S0W A;  3S02 A;  3OON A;  2ZOV A;  2W8B C;  3KHN A;  2ZVY A;  2ZF8 A;  3TD4 A;  3S03 A;  4G4V A;  4R40 B;  3CYQ A;  3S06 A;  2N48 A;  3IMP A;  2MQE A;  2AIZ P;  4G4Y A;  4G88 A;  4G4W A;  4ZHW A;  4G4Z A;  2KGW A;  5EB0 A;  2L26 A;  4B62 A;  5EAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...