3S05A

Meos2 fluorescent protein-green form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
221
structure length
220
Chain Sequence
MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green to red photoconvertible GPF-like protein EosFP
publication title mEos2 Fluorescent Protein-Green Form
rcsb
source organism Lobophyllia hemprichii
molecule tags Fluorescent protein
total genus 56
structure length 220
sequence length 221
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3s05A00
2JADA 1MOUA 1Q4AA 2AWKA 3DQDA 2ZO6A 4IK9A 2QU1A 3PIBA 3PJ7A 4XVPA 5EB6A 4PPLA 2A56B 3PJ5A 1ZGOA 4H3LA 1B9CA 3G9AA 3U0KA 3VHTA 3NT3A 5LTPA 5FVFA 4ORNA 2WSNA 3DQLA 3WCKA 3DQ9A 4EULA 3P8UA 2DUGA 2QZ0A 2AWJA 4GOBA 3SVOA 4XL5A 4W73A 2EMDA 3U8AA 5FVGA 2EMOA 4Q7RA 1JC0A 3CB9A 4W6NA 3SG5A 2OJKA 3AI5A 1KYPA 3NEDA 5EB7A 2RH7A 2V4EC 2A52B 3IP2A 3EVVA 4W6LA 1YHHA 4LJBA 3SVSA 3LVCA 4DXIA 5DRGA 3SV5A 4DXNA 4KF5C 1YZWA 1YHGA 2GX2A 2H5PA 2H5QA 2A48A 2H5OA 2YE0A 3BXAA 2QLHA 3VHTB 3SS0A 4EDSA 4OHSA 5HGEA 3NF0A 4GF6B 1YJFA 3E5VA 4W6TA 2VVHA 1RM9A 4JGEA 1KYSA 3ADFA 4ZFSA 5AQBB 2ARLA 3SRYA 4KA9A 3SG6A 3DQFA 2VVIA 4J89A 4EN1A 2QLGB 3EKJA 1H6RA 5DTYA 5H87A 4W6CA 3BXCA 1XSSA 4UTSA 1YFPA 4JFGA 4R6BA 1RMPA 3DPWA 4DXOA 2HCGA 3RWAA 2WHSA 5KTGA 2YFPA 4KAGA 1OXEA 4I2YA 4XOVA 2HQZA 4W7XA 5DRFA 4TZAA 4OY4A 4W76A 4IK1A 1XA9A 2IE2A 1KP5A 3OSQA 3EK7A 4Z4KA 5DU0A 1ZGQA 4DXPA 2O2BA 3DQKA 3GJ2A 3SVBA 1MYWA 2QT2A 2HQKA 4LQUA 4W6RA 3SG2A 2VADA 4U2VA 1EMAA 1W7SA 4W6FA 1EMMA 2A53B 4KW9A 3CFHA 5DPIA 4HE4A 2Z6ZA 3M22A 3U8PA 1JC1A 4Q7UA 1W7TA 1JBZA 4DXQA 4IZNA 5EXBA 2AWLA 4DXMA 4PPJA 3LA1A 3V3DA 4LW5A 3OSRA 4W6DA 1OXDA 1XMZA 3E5TA 1RMMA 4ZBLA 2VZXA 4TZGA 3DQ3A 3DQOA 3SVUA 4AR7A 2Q6PA 2H5RA 1W7UA 4ZIOA 5DPJA 2AHAA 2G6EA 5EXUA 2FL1A 4RTCA 2Z1OA 1YHIA 4J88A 5LK4A 4B30B 5FHVA 1Z1QA 3CFFA 2H9WA 3LF4B 4KW8A 4W7RA 4ZB1A 2C9IA 2V4EB 3GL4A 2G6YA 4JEOA 2POXA 4W7AA 4L1IA 3SG7A 5H88A 4W6IA 2B3QA 3SSVA 5HZSA 2WIQA 4J8AA 2WISA 3A8SA 3SVDA 2QLGA 1XQMA 1Z1PA 2BTJA 3EK4A 4ZF4A 2HRSA 3EVUA 4HQ8A 4W7DA 4PPKA 5H89A 4IK5A 5EBJA 3M24A 3WLCA 3AKOA 4ZINA 3SSKA 5HZTA 2WURA 4BDUA 3EK8A 3WLDA 5BTTA 4W6MA 4Z4MA 1BFPA 3DQIA 2Z6YA 4IK4A 5BT0A 5LTRA 2VAEA 3SVEA 2G6XA 4W72A 5DQBA 4W6KA 2QLIA 4LJDC 4W6GA 3PJBA 4ZF5A 2HFCA 4W69A 3BX9A 3SG3A 4RYWA 3ZTFA 1EMFA 3SVCA 2WHUA 4DKMA 2OTBA 3U0MA 3ST3A 5DTLA 1EMEA 1YJ2A 2G3OA 4KEXA 5BTTB 4W74A 2IB6A 5BQLA 5DY6A 3W1DA 4Q9XA 1F09A 3DQEA 4W6HA 4Q7TA 3W1CA 4W6OA 3VK1A 4IK3A 3SSPA 3EVPA 3DQ6A 2H8QA 3KCTA 3CBEA 1QYFA 3O78A 2H6VA 3I19A 3K1KA 4B30A 3BXBA 5F9GA 4H47A 2EMNA 1MOVA 2Z6XA 4W75A 3ZULA 2O29A 4HVFA 2V4EA 2FWQA 3SSLA 5DTXA 1Q73A 3E5WA 1JBYA 2DD7A 1RMOA 5T3IA 2A47A 2G5ZB 4AS8A 4JC2A 4KF5A 4W6JA 3SG4A 4LQTA 1HUYA 2DDCA 4W7EA 3MGFA 4W6UA 3ZUFA 2AWMA 4RYSA 4EMQA 3DPZA 4W7CA 3NEZA 4H3NA 2PXWA 1ZGPA 2YDZA 3S05A 4L13A 2ZMWA 2GW4B 2HGYA 3TMRA 3DPXA 4P76A 1C4FA 2DD9A 5HZOA 2O24A 3DQHA 2C9JA 4ANJA 4KPIA 5DPGA 1H4UA 3ST2A 2QLEA 2DDDA 2P4MA 1CV7A 3DQMA 5DPHA 2Y0GA 2OKYA 2ZMUA 4R6DA 4JF9A 4H48A 3TMTA 3DQ2A 3KCSA 4W6PA 4LJCA 4W77A 3CGLA 3ST0A 4XOWA 4PFEA 2A54B 4Q9WA 3SSYA 3EVRA 2DUIA 2AH8A 1EMBA 2HGDA 3U0LA 4N3DA 3SVRA 3GB3A 4OGSA 4P1QA 3LVDA 3UFZA 2IB5A 4XGYA 3CD1A 3U8CA 2Q57A 1F0BA 4B5YA 4GESB 3LSAA 3DQNA 4W6SA 2ZO7A 1EMCA 3CD9A 1GGXA 2A50B 3DQUA 1GFLA 1UISA 2DUHA 3U0NA 3DQ4A 5EJUA 1QYQA 3AI4A 5HBDA 3NT9A 2G16B 1OXFA 3DQ8A 3P28A 1XAEA 1EMGA 3ZUJA 4KGFA 1RRXA 4L12A 5J2OA 3EKHA 1S6ZA 2G2SB 3RWTA 4OQWA 3UG0A 2PXSA 1QXTA 5FVIA 3VICA 1HCJA 5LTQA 1KYRA 3O77A 2DUFA 4DKNA 3DQ1A 3H1RA 2OTEA 2YE1A 4IK8A 4KGEA 2HPWA 2QRFA 5HW9A 5EHUA 4HQ9A 3SSTA 2WSOA 5HZUA 2OKWA 1GL4A 2B3PA 3SSHA 3ST4A 3IR8A 4KF4A 5EXCI 4JRBA 2ICRA 1Q4EA 3DQAA 3GEXA 3GJ1A 4W7FA 3CFAA 2GX0A 4ZF3A 4W6AA 3LF3A 2GW3A 4OJ0A 3OGOA 2IOVA 2VVJA 1QY3A 4KW4A 3DQ5A 1EMLA 1ZUXA 2HJOA 2FZUA 3DQJA 3LS3A 3DQ7A 3LVAA 4W6BA 2WHTA 2OGRA 1G7KA 2G3DB 4LJDA 5DTZA 3DQCA 4HQCA 4NWSA 3SVNA 1EMKA 2DUEA 5DQMA 2A46A 4EDOA 4H3MA 3ED8A 1Q4BA 3H1OA 1Q4CA 1QYOA 1Q4DA
chains in the Genus database with same CATH superfamily
2JADA 1MOUA 1Q4AA 2AWKA 3DQDA 2ZO6A 4IK9A 2QU1A 3PIBA 3PJ7A 4XVPA 5EB6A 4PPLA 2A56B 3PJ5A 1ZGOA 4H3LA 1B9CA 3G9AA 3U0KA 3VHTA 3NT3A 5LTPA 5FVFA 4ORNA 2WSNA 3DQLA 3WCKA 3DQ9A 4EULA 3P8UA 2DUGA 2QZ0A 2AWJA 4GOBA 3SVOA 4XL5A 4W73A 2EMDA 3U8AA 5FVGA 2EMOA 4Q7RA 1JC0A 3CB9A 4W6NA 3SG5A 2OJKA 3AI5A 1KYPA 3NEDA 5EB7A 2RH7A 2V4EC 2A52B 3IP2A 3EVVA 4W6LA 1YHHA 4LJBA 3SVSA 3LVCA 4DXIA 5DRGA 3SV5A 4DXNA 4KF5C 1YZWA 1YHGA 2GX2A 2H5PA 2H5QA 2A48A 2H5OA 2YE0A 3BXAA 2QLHA 3VHTB 3SS0A 4EDSA 4OHSA 5HGEA 3NF0A 4GF6B 1YJFA 3E5VA 4W6TA 2VVHA 1RM9A 4JGEA 1KYSA 3ADFA 4ZFSA 5AQBB 2ARLA 3SRYA 4KA9A 3SG6A 3DQFA 2VVIA 4J89A 4EN1A 2QLGB 3EKJA 1H6RA 5DTYA 5H87A 4W6CA 3BXCA 1XSSA 4UTSA 1YFPA 4JFGA 4R6BA 1RMPA 3DPWA 4DXOA 2HCGA 3RWAA 2WHSA 5KTGA 2YFPA 4KAGA 1OXEA 4I2YA 4XOVA 2HQZA 4W7XA 5DRFA 4TZAA 4OY4A 4W76A 4IK1A 1XA9A 2IE2A 1KP5A 3OSQA 3EK7A 4Z4KA 5DU0A 1ZGQA 4DXPA 2O2BA 3DQKA 3GJ2A 3SVBA 1MYWA 2QT2A 2HQKA 4LQUA 4W6RA 3SG2A 2VADA 4U2VA 1EMAA 1W7SA 4W6FA 1EMMA 2A53B 4KW9A 3CFHA 5DPIA 4HE4A 2Z6ZA 3M22A 3U8PA 1JC1A 4Q7UA 1W7TA 1JBZA 4DXQA 4IZNA 5EXBA 2AWLA 4DXMA 4PPJA 3LA1A 3V3DA 4LW5A 3OSRA 4W6DA 1OXDA 1XMZA 3E5TA 1RMMA 4ZBLA 2VZXA 4TZGA 3DQ3A 3DQOA 3SVUA 4AR7A 2Q6PA 2H5RA 1W7UA 4ZIOA 5DPJA 2AHAA 2G6EA 5EXUA 2FL1A 4RTCA 2Z1OA 1YHIA 4J88A 5LK4A 4B30B 5FHVA 1Z1QA 3CFFA 2H9WA 3LF4B 4KW8A 4W7RA 4ZB1A 2C9IA 2V4EB 3GL4A 2G6YA 4JEOA 2POXA 4W7AA 4L1IA 3SG7A 5H88A 4W6IA 2B3QA 3SSVA 5HZSA 2WIQA 4J8AA 2WISA 3A8SA 3SVDA 2QLGA 1XQMA 1Z1PA 2BTJA 3EK4A 4ZF4A 2HRSA 3EVUA 4HQ8A 4W7DA 4PPKA 5H89A 4IK5A 5EBJA 3M24A 3WLCA 3AKOA 4ZINA 3SSKA 5HZTA 2WURA 4BDUA 3EK8A 3WLDA 5BTTA 4W6MA 4Z4MA 1BFPA 3DQIA 2Z6YA 4IK4A 5BT0A 5LTRA 2VAEA 3SVEA 2G6XA 4W72A 5DQBA 4W6KA 2QLIA 4LJDC 4W6GA 3PJBA 4ZF5A 2HFCA 4W69A 3BX9A 3SG3A 4RYWA 3ZTFA 1EMFA 3SVCA 2WHUA 4DKMA 2OTBA 3U0MA 3ST3A 5DTLA 1EMEA 1YJ2A 2G3OA 4KEXA 5BTTB 4W74A 2IB6A 5BQLA 5DY6A 3W1DA 4Q9XA 1F09A 3DQEA 4W6HA 4Q7TA 3W1CA 4W6OA 3VK1A 4IK3A 3SSPA 3EVPA 3DQ6A 2H8QA 3KCTA 3CBEA 1QYFA 3O78A 2H6VA 3I19A 3K1KA 4B30A 3BXBA 5F9GA 4H47A 2EMNA 1MOVA 2Z6XA 4W75A 3ZULA 2O29A 4HVFA 2V4EA 2FWQA 3SSLA 5DTXA 1Q73A 3E5WA 1JBYA 2DD7A 1RMOA 5T3IA 2A47A 2G5ZB 4AS8A 4JC2A 4KF5A 4W6JA 3SG4A 4LQTA 1HUYA 2DDCA 4W7EA 3MGFA 4W6UA 3ZUFA 2AWMA 4RYSA 4EMQA 3DPZA 4W7CA 3NEZA 4H3NA 2PXWA 1ZGPA 2YDZA 3S05A 4L13A 2ZMWA 2GW4B 2HGYA 3TMRA 3DPXA 4P76A 1C4FA 2DD9A 5HZOA 2O24A 3DQHA 2C9JA 4ANJA 4KPIA 5DPGA 1H4UA 3ST2A 2QLEA 2DDDA 2P4MA 1CV7A 3DQMA 5DPHA 2Y0GA 2OKYA 2ZMUA 4R6DA 4JF9A 4H48A 3TMTA 3DQ2A 3KCSA 4W6PA 4LJCA 4W77A 3CGLA 3ST0A 4XOWA 4PFEA 2A54B 4Q9WA 3SSYA 3EVRA 2DUIA 2AH8A 1EMBA 2HGDA 3U0LA 4N3DA 3SVRA 3GB3A 4OGSA 4P1QA 3LVDA 3UFZA 2IB5A 4XGYA 3CD1A 3U8CA 2Q57A 1F0BA 4B5YA 4GESB 3LSAA 3DQNA 4W6SA 2ZO7A 1EMCA 3CD9A 1GGXA 2A50B 3DQUA 1GFLA 1UISA 2DUHA 3U0NA 3DQ4A 5EJUA 1QYQA 3AI4A 5HBDA 3NT9A 2G16B 1OXFA 3DQ8A 3P28A 1XAEA 1EMGA 3ZUJA 4KGFA 1RRXA 4L12A 5J2OA 3EKHA 1S6ZA 2G2SB 3RWTA 4OQWA 3UG0A 2PXSA 1QXTA 5FVIA 3VICA 1HCJA 5LTQA 1KYRA 3O77A 2DUFA 4DKNA 3DQ1A 3H1RA 2OTEA 2YE1A 4IK8A 4KGEA 2HPWA 2QRFA 5HW9A 5EHUA 4HQ9A 3SSTA 2WSOA 5HZUA 2OKWA 1GL4A 2B3PA 3SSHA 3ST4A 3IR8A 4KF4A 5EXCI 4JRBA 2ICRA 1Q4EA 3DQAA 3GEXA 3GJ1A 4W7FA 3CFAA 2GX0A 4ZF3A 4W6AA 3LF3A 2GW3A 4OJ0A 3OGOA 2IOVA 2VVJA 1QY3A 4KW4A 3DQ5A 1EMLA 1ZUXA 2HJOA 2FZUA 3DQJA 3LS3A 3DQ7A 3LVAA 4W6BA 2WHTA 2OGRA 1G7KA 2G3DB 4LJDA 5DTZA 3DQCA 4HQCA 4NWSA 3SVNA 1EMKA 2DUEA 5DQMA 2A46A 4EDOA 4H3MA 3ED8A 1Q4BA 3H1OA 1Q4CA 1QYOA 1Q4DA
chains in the Genus database with same CATH topology
2JADA 1MOUA 1Q4AA 2AWKA 3DQDA 2ZO6A 4IK9A 2QU1A 3PIBA 3PJ7A 4XVPA 5EB6A 4PPLA 2A56B 3PJ5A 1ZGOA 4H3LA 1B9CA 3G9AA 3U0KA 3VHTA 3NT3A 5LTPA 5FVFA 4ORNA 2WSNA 3DQLA 3WCKA 3DQ9A 4EULA 3P8UA 2DUGA 2QZ0A 2AWJA 4GOBA 3SVOA 4XL5A 4W73A 2EMDA 3U8AA 5FVGA 2EMOA 4Q7RA 1JC0A 3CB9A 4W6NA 3SG5A 2OJKA 3AI5A 1KYPA 3NEDA 5EB7A 2RH7A 2V4EC 2A52B 3IP2A 3EVVA 4W6LA 1YHHA 4LJBA 3SVSA 3LVCA 4DXIA 5DRGA 3SV5A 4DXNA 4KF5C 1YZWA 1YHGA 2GX2A 2H5PA 2H5QA 2A48A 2H5OA 2YE0A 3BXAA 2QLHA 3VHTB 3SS0A 4EDSA 4OHSA 5HGEA 3NF0A 4GF6B 1YJFA 3E5VA 4W6TA 2VVHA 1RM9A 4JGEA 1KYSA 3ADFA 4ZFSA 5AQBB 2ARLA 3SRYA 4KA9A 3SG6A 3DQFA 2VVIA 4J89A 4EN1A 2QLGB 3EKJA 1H6RA 5DTYA 5H87A 4W6CA 3BXCA 1XSSA 4UTSA 1YFPA 4JFGA 4R6BA 1RMPA 3DPWA 4DXOA 2HCGA 3RWAA 2WHSA 5KTGA 2YFPA 4KAGA 1OXEA 4I2YA 4XOVA 2HQZA 4W7XA 5DRFA 4TZAA 4OY4A 4W76A 4IK1A 1XA9A 2IE2A 1KP5A 3OSQA 3EK7A 4Z4KA 5DU0A 1ZGQA 4DXPA 2O2BA 3DQKA 3GJ2A 3SVBA 1MYWA 2QT2A 2HQKA 4LQUA 4W6RA 3SG2A 2VADA 4U2VA 1EMAA 1W7SA 4W6FA 1EMMA 2A53B 4KW9A 3CFHA 5DPIA 4HE4A 2Z6ZA 3M22A 3U8PA 1JC1A 4Q7UA 1W7TA 1JBZA 4DXQA 4IZNA 5EXBA 2AWLA 4DXMA 4PPJA 3LA1A 3V3DA 4LW5A 3OSRA 4W6DA 1OXDA 1XMZA 3E5TA 1RMMA 4ZBLA 2VZXA 4TZGA 3DQ3A 3DQOA 3SVUA 4AR7A 2Q6PA 2H5RA 1W7UA 4ZIOA 5DPJA 2AHAA 2G6EA 5EXUA 2FL1A 4RTCA 2Z1OA 1YHIA 4J88A 5LK4A 4B30B 5FHVA 1Z1QA 3CFFA 2H9WA 3LF4B 4KW8A 4W7RA 4ZB1A 2C9IA 2V4EB 3GL4A 2G6YA 4JEOA 2POXA 4W7AA 4L1IA 3SG7A 5H88A 4W6IA 2B3QA 3SSVA 5HZSA 2WIQA 4J8AA 2WISA 3A8SA 3SVDA 2QLGA 1XQMA 1Z1PA 2BTJA 3EK4A 4ZF4A 2HRSA 3EVUA 4HQ8A 4W7DA 4PPKA 5H89A 4IK5A 5EBJA 3M24A 3WLCA 3AKOA 4ZINA 3SSKA 5HZTA 2WURA 4BDUA 3EK8A 3WLDA 5BTTA 4W6MA 4Z4MA 1BFPA 3DQIA 2Z6YA 4IK4A 5BT0A 5LTRA 2VAEA 3SVEA 2G6XA 4W72A 5DQBA 4W6KA 2QLIA 4LJDC 4W6GA 3PJBA 4ZF5A 2HFCA 4W69A 3BX9A 3SG3A 4RYWA 3ZTFA 1EMFA 3SVCA 2WHUA 4DKMA 2OTBA 3U0MA 3ST3A 5DTLA 1EMEA 1YJ2A 2G3OA 4KEXA 5BTTB 4W74A 2IB6A 5BQLA 5DY6A 3W1DA 4Q9XA 1F09A 3DQEA 4W6HA 4Q7TA 3W1CA 4W6OA 3VK1A 4IK3A 3SSPA 3EVPA 3DQ6A 2H8QA 3KCTA 3CBEA 1QYFA 3O78A 2H6VA 3I19A 3K1KA 4B30A 3BXBA 5F9GA 4H47A 2EMNA 1MOVA 2Z6XA 4W75A 3ZULA 2O29A 4HVFA 2V4EA 2FWQA 3SSLA 5DTXA 1Q73A 3E5WA 1JBYA 2DD7A 1RMOA 5T3IA 2A47A 2G5ZB 4AS8A 4JC2A 4KF5A 4W6JA 3SG4A 4LQTA 1HUYA 2DDCA 4W7EA 3MGFA 4W6UA 3ZUFA 2AWMA 4RYSA 4EMQA 3DPZA 4W7CA 3NEZA 4H3NA 2PXWA 1ZGPA 2YDZA 3S05A 4L13A 2ZMWA 2GW4B 2HGYA 3TMRA 3DPXA 4P76A 1C4FA 2DD9A 5HZOA 2O24A 3DQHA 2C9JA 4ANJA 4KPIA 5DPGA 1H4UA 3ST2A 2QLEA 2DDDA 2P4MA 1CV7A 3DQMA 5DPHA 2Y0GA 2OKYA 2ZMUA 4R6DA 4JF9A 4H48A 3TMTA 3DQ2A 3KCSA 4W6PA 4LJCA 4W77A 3CGLA 3ST0A 4XOWA 4PFEA 2A54B 4Q9WA 3SSYA 3EVRA 2DUIA 2AH8A 1EMBA 2HGDA 3U0LA 4N3DA 3SVRA 3GB3A 4OGSA 4P1QA 3LVDA 3UFZA 2IB5A 4XGYA 3CD1A 3U8CA 2Q57A 1F0BA 4B5YA 4GESB 3LSAA 3DQNA 4W6SA 2ZO7A 1EMCA 3CD9A 1GGXA 2A50B 3DQUA 1GFLA 1UISA 2DUHA 3U0NA 3DQ4A 5EJUA 1QYQA 3AI4A 5HBDA 3NT9A 2G16B 1OXFA 3DQ8A 3P28A 1XAEA 1EMGA 3ZUJA 4KGFA 1RRXA 4L12A 5J2OA 3EKHA 1S6ZA 2G2SB 3RWTA 4OQWA 3UG0A 2PXSA 1QXTA 5FVIA 3VICA 1HCJA 5LTQA 1KYRA 3O77A 2DUFA 4DKNA 3DQ1A 3H1RA 2OTEA 2YE1A 4IK8A 4KGEA 2HPWA 2QRFA 5HW9A 5EHUA 4HQ9A 3SSTA 2WSOA 5HZUA 2OKWA 1GL4A 2B3PA 3SSHA 3ST4A 3IR8A 4KF4A 5EXCI 4JRBA 2ICRA 1Q4EA 3DQAA 3GEXA 3GJ1A 4W7FA 3CFAA 2GX0A 4ZF3A 4W6AA 3LF3A 2GW3A 4OJ0A 3OGOA 2IOVA 2VVJA 1QY3A 4KW4A 3DQ5A 1EMLA 1ZUXA 2HJOA 2FZUA 3DQJA 3LS3A 3DQ7A 3LVAA 4W6BA 2WHTA 2OGRA 1G7KA 2G3DB 4LJDA 5DTZA 3DQCA 4HQCA 4NWSA 3SVNA 1EMKA 2DUEA 5DQMA 2A46A 4EDOA 4H3MA 3ED8A 1Q4BA 3H1OA 1Q4CA 1QYOA 1Q4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JAD A;  1MOU A;  1Q4A A;  2AWK A;  3DQD A;  2ZO6 A;  4IK9 A;  2QU1 A;  3PIB A;  3PJ7 A;  4XVP A;  5EB6 A;  4PPL A;  2A56 B;  3PJ5 A;  1ZGO A;  4H3L A;  1B9C A;  3G9A A;  3U0K A;  3VHT A;  3NT3 A;  5LTP A;  5FVF A;  4ORN A;  2WSN A;  3DQL A;  3WCK A;  3DQ9 A;  4EUL A;  3P8U A;  2DUG A;  2QZ0 A;  2AWJ A;  4GOB A;  3SVO A;  4XL5 A;  4W73 A;  2EMD A;  3U8A A;  5FVG A;  2EMO A;  4Q7R A;  1JC0 A;  3CB9 A;  4W6N A;  3SG5 A;  2OJK A;  3AI5 A;  1KYP A;  3NED A;  5EB7 A;  2RH7 A;  2V4E C;  2A52 B;  3IP2 A;  3EVV A;  4W6L A;  1YHH A;  4LJB A;  3SVS A;  3LVC A;  4DXI A;  5DRG A;  3SV5 A;  4DXN A;  4KF5 C;  1YZW A;  1YHG A;  2GX2 A;  2H5P A;  2H5Q A;  2A48 A;  2H5O A;  2YE0 A;  3BXA A;  2QLH A;  3VHT B;  3SS0 A;  4EDS A;  4OHS A;  5HGE A;  3NF0 A;  4GF6 B;  1YJF A;  3E5V A;  4W6T A;  2VVH A;  1RM9 A;  4JGE A;  1KYS A;  3ADF A;  4ZFS A;  5AQB B;  2ARL A;  3SRY A;  4KA9 A;  3SG6 A;  3DQF A;  2VVI A;  4J89 A;  4EN1 A;  2QLG B;  3EKJ A;  1H6R A;  5DTY A;  5H87 A;  4W6C A;  3BXC A;  1XSS A;  4UTS A;  1YFP A;  4JFG A;  4R6B A;  1RMP A;  3DPW A;  4DXO A;  2HCG A;  3RWA A;  2WHS A;  5KTG A;  2YFP A;  4KAG A;  1OXE A;  4I2Y A;  4XOV A;  2HQZ A;  4W7X A;  5DRF A;  4TZA A;  4OY4 A;  4W76 A;  4IK1 A;  1XA9 A;  2IE2 A;  1KP5 A;  3OSQ A;  3EK7 A;  4Z4K A;  5DU0 A;  1ZGQ A;  4DXP A;  2O2B A;  3DQK A;  3GJ2 A;  3SVB A;  1MYW A;  2QT2 A;  2HQK A;  4LQU A;  4W6R A;  3SG2 A;  2VAD A;  4U2V A;  1EMA A;  1W7S A;  4W6F A;  1EMM A;  2A53 B;  4KW9 A;  3CFH A;  5DPI A;  4HE4 A;  2Z6Z A;  3M22 A;  3U8P A;  1JC1 A;  4Q7U A;  1W7T A;  1JBZ A;  4DXQ A;  4IZN A;  5EXB A;  2AWL A;  4DXM A;  4PPJ A;  3LA1 A;  3V3D A;  4LW5 A;  3OSR A;  4W6D A;  1OXD A;  1XMZ A;  3E5T A;  1RMM A;  4ZBL A;  2VZX A;  4TZG A;  3DQ3 A;  3DQO A;  3SVU A;  4AR7 A;  2Q6P A;  2H5R A;  1W7U A;  4ZIO A;  5DPJ A;  2AHA A;  2G6E A;  5EXU A;  2FL1 A;  4RTC A;  2Z1O A;  1YHI A;  4J88 A;  5LK4 A;  4B30 B;  5FHV A;  1Z1Q A;  3CFF A;  2H9W A;  3LF4 B;  4KW8 A;  4W7R A;  4ZB1 A;  2C9I A;  2V4E B;  3GL4 A;  2G6Y A;  4JEO A;  2POX A;  4W7A A;  4L1I A;  3SG7 A;  5H88 A;  4W6I A;  2B3Q A;  3SSV A;  5HZS A;  2WIQ A;  4J8A A;  2WIS A;  3A8S A;  3SVD A;  2QLG A;  1XQM A;  1Z1P A;  2BTJ A;  3EK4 A;  4ZF4 A;  2HRS A;  3EVU A;  4HQ8 A;  4W7D A;  4PPK A;  5H89 A;  4IK5 A;  5EBJ A;  3M24 A;  3WLC A;  3AKO A;  4ZIN A;  3SSK A;  5HZT A;  2WUR A;  4BDU A;  3EK8 A;  3WLD A;  5BTT A;  4W6M A;  4Z4M A;  1BFP A;  3DQI A;  2Z6Y A;  4IK4 A;  5BT0 A;  5LTR A;  2VAE A;  3SVE A;  2G6X A;  4W72 A;  5DQB A;  4W6K A;  2QLI A;  4LJD C;  4W6G A;  3PJB A;  4ZF5 A;  2HFC A;  4W69 A;  3BX9 A;  3SG3 A;  4RYW A;  3ZTF A;  1EMF A;  3SVC A;  2WHU A;  4DKM A;  2OTB A;  3U0M A;  3ST3 A;  5DTL A;  1EME A;  1YJ2 A;  2G3O A;  4KEX A;  5BTT B;  4W74 A;  2IB6 A;  5BQL A;  5DY6 A;  3W1D A;  4Q9X A;  1F09 A;  3DQE A;  4W6H A;  4Q7T A;  3W1C A;  4W6O A;  3VK1 A;  4IK3 A;  3SSP A;  3EVP A;  3DQ6 A;  2H8Q A;  3KCT A;  3CBE A;  1QYF A;  3O78 A;  2H6V A;  3I19 A;  3K1K A;  4B30 A;  3BXB A;  5F9G A;  4H47 A;  2EMN A;  1MOV A;  2Z6X A;  4W75 A;  3ZUL A;  2O29 A;  4HVF A;  2V4E A;  2FWQ A;  3SSL A;  5DTX A;  1Q73 A;  3E5W A;  1JBY A;  2DD7 A;  1RMO A;  5T3I A;  2A47 A;  2G5Z B;  4AS8 A;  4JC2 A;  4KF5 A;  4W6J A;  3SG4 A;  4LQT A;  1HUY A;  2DDC A;  4W7E A;  3MGF A;  4W6U A;  3ZUF A;  2AWM A;  4RYS A;  4EMQ A;  3DPZ A;  4W7C A;  3NEZ A;  4H3N A;  2PXW A;  1ZGP A;  2YDZ A;  3S05 A;  4L13 A;  2ZMW A;  2GW4 B;  2HGY A;  3TMR A;  3DPX A;  4P76 A;  1C4F A;  2DD9 A;  5HZO A;  2O24 A;  3DQH A;  2C9J A;  4ANJ A;  4KPI A;  5DPG A;  1H4U A;  3ST2 A;  2QLE A;  2DDD A;  2P4M A;  1CV7 A;  3DQM A;  5DPH A;  2Y0G A;  2OKY A;  2ZMU A;  4R6D A;  4JF9 A;  4H48 A;  3TMT A;  3DQ2 A;  3KCS A;  4W6P A;  4LJC A;  4W77 A;  3CGL A;  3ST0 A;  4XOW A;  4PFE A;  2A54 B;  4Q9W A;  3SSY A;  3EVR A;  2DUI A;  2AH8 A;  1EMB A;  2HGD A;  3U0L A;  4N3D A;  3SVR A;  3GB3 A;  4OGS A;  4P1Q A;  3LVD A;  3UFZ A;  2IB5 A;  4XGY A;  3CD1 A;  3U8C A;  2Q57 A;  1F0B A;  4B5Y A;  4GES B;  3LSA A;  3DQN A;  4W6S A;  2ZO7 A;  1EMC A;  3CD9 A;  1GGX A;  2A50 B;  3DQU A;  1GFL A;  1UIS A;  2DUH A;  3U0N A;  3DQ4 A;  5EJU A;  1QYQ A;  3AI4 A;  5HBD A;  3NT9 A;  2G16 B;  1OXF A;  3DQ8 A;  3P28 A;  1XAE A;  1EMG A;  3ZUJ A;  4KGF A;  1RRX A;  4L12 A;  5J2O A;  3EKH A;  1S6Z A;  2G2S B;  3RWT A;  4OQW A;  3UG0 A;  2PXS A;  1QXT A;  5FVI A;  3VIC A;  1HCJ A;  5LTQ A;  1KYR A;  3O77 A;  2DUF A;  4DKN A;  3DQ1 A;  3H1R A;  2OTE A;  2YE1 A;  4IK8 A;  4KGE A;  2HPW A;  2QRF A;  5HW9 A;  5EHU A;  4HQ9 A;  3SST A;  2WSO A;  5HZU A;  2OKW A;  1GL4 A;  2B3P A;  3SSH A;  3ST4 A;  3IR8 A;  4KF4 A;  5EXC I;  4JRB A;  2ICR A;  1Q4E A;  3DQA A;  3GEX A;  3GJ1 A;  4W7F A;  3CFA A;  2GX0 A;  4ZF3 A;  4W6A A;  3LF3 A;  2GW3 A;  4OJ0 A;  3OGO A;  2IOV A;  2VVJ A;  1QY3 A;  4KW4 A;  3DQ5 A;  1EML A;  1ZUX A;  2HJO A;  2FZU A;  3DQJ A;  3LS3 A;  3DQ7 A;  3LVA A;  4W6B A;  2WHT A;  2OGR A;  1G7K A;  2G3D B;  4LJD A;  5DTZ A;  3DQC A;  4HQC A;  4NWS A;  3SVN A;  1EMK A;  2DUE A;  5DQM A;  2A46 A;  4EDO A;  4H3M A;  3ED8 A;  1Q4B A;  3H1O A;  1Q4C A;  1QYO A;  1Q4D A; 
#chains in the Genus database with same CATH topology
 2JAD A;  1MOU A;  1Q4A A;  2AWK A;  3DQD A;  2ZO6 A;  4IK9 A;  2QU1 A;  3PIB A;  3PJ7 A;  4XVP A;  5EB6 A;  4PPL A;  2A56 B;  3PJ5 A;  1ZGO A;  4H3L A;  1B9C A;  3G9A A;  3U0K A;  3VHT A;  3NT3 A;  5LTP A;  5FVF A;  4ORN A;  2WSN A;  3DQL A;  3WCK A;  3DQ9 A;  4EUL A;  3P8U A;  2DUG A;  2QZ0 A;  2AWJ A;  4GOB A;  3SVO A;  4XL5 A;  4W73 A;  2EMD A;  3U8A A;  5FVG A;  2EMO A;  4Q7R A;  1JC0 A;  3CB9 A;  4W6N A;  3SG5 A;  2OJK A;  3AI5 A;  1KYP A;  3NED A;  5EB7 A;  2RH7 A;  2V4E C;  2A52 B;  3IP2 A;  3EVV A;  4W6L A;  1YHH A;  4LJB A;  3SVS A;  3LVC A;  4DXI A;  5DRG A;  3SV5 A;  4DXN A;  4KF5 C;  1YZW A;  1YHG A;  2GX2 A;  2H5P A;  2H5Q A;  2A48 A;  2H5O A;  2YE0 A;  3BXA A;  2QLH A;  3VHT B;  3SS0 A;  4EDS A;  4OHS A;  5HGE A;  3NF0 A;  4GF6 B;  1YJF A;  3E5V A;  4W6T A;  2VVH A;  1RM9 A;  4JGE A;  1KYS A;  3ADF A;  4ZFS A;  5AQB B;  2ARL A;  3SRY A;  4KA9 A;  3SG6 A;  3DQF A;  2VVI A;  4J89 A;  4EN1 A;  2QLG B;  3EKJ A;  1H6R A;  5DTY A;  5H87 A;  4W6C A;  3BXC A;  1XSS A;  4UTS A;  1YFP A;  4JFG A;  4R6B A;  1RMP A;  3DPW A;  4DXO A;  2HCG A;  3RWA A;  2WHS A;  5KTG A;  2YFP A;  4KAG A;  1OXE A;  4I2Y A;  4XOV A;  2HQZ A;  4W7X A;  5DRF A;  4TZA A;  4OY4 A;  4W76 A;  4IK1 A;  1XA9 A;  2IE2 A;  1KP5 A;  3OSQ A;  3EK7 A;  4Z4K A;  5DU0 A;  1ZGQ A;  4DXP A;  2O2B A;  3DQK A;  3GJ2 A;  3SVB A;  1MYW A;  2QT2 A;  2HQK A;  4LQU A;  4W6R A;  3SG2 A;  2VAD A;  4U2V A;  1EMA A;  1W7S A;  4W6F A;  1EMM A;  2A53 B;  4KW9 A;  3CFH A;  5DPI A;  4HE4 A;  2Z6Z A;  3M22 A;  3U8P A;  1JC1 A;  4Q7U A;  1W7T A;  1JBZ A;  4DXQ A;  4IZN A;  5EXB A;  2AWL A;  4DXM A;  4PPJ A;  3LA1 A;  3V3D A;  4LW5 A;  3OSR A;  4W6D A;  1OXD A;  1XMZ A;  3E5T A;  1RMM A;  4ZBL A;  2VZX A;  4TZG A;  3DQ3 A;  3DQO A;  3SVU A;  4AR7 A;  2Q6P A;  2H5R A;  1W7U A;  4ZIO A;  5DPJ A;  2AHA A;  2G6E A;  5EXU A;  2FL1 A;  4RTC A;  2Z1O A;  1YHI A;  4J88 A;  5LK4 A;  4B30 B;  5FHV A;  1Z1Q A;  3CFF A;  2H9W A;  3LF4 B;  4KW8 A;  4W7R A;  4ZB1 A;  2C9I A;  2V4E B;  3GL4 A;  2G6Y A;  4JEO A;  2POX A;  4W7A A;  4L1I A;  3SG7 A;  5H88 A;  4W6I A;  2B3Q A;  3SSV A;  5HZS A;  2WIQ A;  4J8A A;  2WIS A;  3A8S A;  3SVD A;  2QLG A;  1XQM A;  1Z1P A;  2BTJ A;  3EK4 A;  4ZF4 A;  2HRS A;  3EVU A;  4HQ8 A;  4W7D A;  4PPK A;  5H89 A;  4IK5 A;  5EBJ A;  3M24 A;  3WLC A;  3AKO A;  4ZIN A;  3SSK A;  5HZT A;  2WUR A;  4BDU A;  3EK8 A;  3WLD A;  5BTT A;  4W6M A;  4Z4M A;  1BFP A;  3DQI A;  2Z6Y A;  4IK4 A;  5BT0 A;  5LTR A;  2VAE A;  3SVE A;  2G6X A;  4W72 A;  5DQB A;  4W6K A;  2QLI A;  4LJD C;  4W6G A;  3PJB A;  4ZF5 A;  2HFC A;  4W69 A;  3BX9 A;  3SG3 A;  4RYW A;  3ZTF A;  1EMF A;  3SVC A;  2WHU A;  4DKM A;  2OTB A;  3U0M A;  3ST3 A;  5DTL A;  1EME A;  1YJ2 A;  2G3O A;  4KEX A;  5BTT B;  4W74 A;  2IB6 A;  5BQL A;  5DY6 A;  3W1D A;  4Q9X A;  1F09 A;  3DQE A;  4W6H A;  4Q7T A;  3W1C A;  4W6O A;  3VK1 A;  4IK3 A;  3SSP A;  3EVP A;  3DQ6 A;  2H8Q A;  3KCT A;  3CBE A;  1QYF A;  3O78 A;  2H6V A;  3I19 A;  3K1K A;  4B30 A;  3BXB A;  5F9G A;  4H47 A;  2EMN A;  1MOV A;  2Z6X A;  4W75 A;  3ZUL A;  2O29 A;  4HVF A;  2V4E A;  2FWQ A;  3SSL A;  5DTX A;  1Q73 A;  3E5W A;  1JBY A;  2DD7 A;  1RMO A;  5T3I A;  2A47 A;  2G5Z B;  4AS8 A;  4JC2 A;  4KF5 A;  4W6J A;  3SG4 A;  4LQT A;  1HUY A;  2DDC A;  4W7E A;  3MGF A;  4W6U A;  3ZUF A;  2AWM A;  4RYS A;  4EMQ A;  3DPZ A;  4W7C A;  3NEZ A;  4H3N A;  2PXW A;  1ZGP A;  2YDZ A;  3S05 A;  4L13 A;  2ZMW A;  2GW4 B;  2HGY A;  3TMR A;  3DPX A;  4P76 A;  1C4F A;  2DD9 A;  5HZO A;  2O24 A;  3DQH A;  2C9J A;  4ANJ A;  4KPI A;  5DPG A;  1H4U A;  3ST2 A;  2QLE A;  2DDD A;  2P4M A;  1CV7 A;  3DQM A;  5DPH A;  2Y0G A;  2OKY A;  2ZMU A;  4R6D A;  4JF9 A;  4H48 A;  3TMT A;  3DQ2 A;  3KCS A;  4W6P A;  4LJC A;  4W77 A;  3CGL A;  3ST0 A;  4XOW A;  4PFE A;  2A54 B;  4Q9W A;  3SSY A;  3EVR A;  2DUI A;  2AH8 A;  1EMB A;  2HGD A;  3U0L A;  4N3D A;  3SVR A;  3GB3 A;  4OGS A;  4P1Q A;  3LVD A;  3UFZ A;  2IB5 A;  4XGY A;  3CD1 A;  3U8C A;  2Q57 A;  1F0B A;  4B5Y A;  4GES B;  3LSA A;  3DQN A;  4W6S A;  2ZO7 A;  1EMC A;  3CD9 A;  1GGX A;  2A50 B;  3DQU A;  1GFL A;  1UIS A;  2DUH A;  3U0N A;  3DQ4 A;  5EJU A;  1QYQ A;  3AI4 A;  5HBD A;  3NT9 A;  2G16 B;  1OXF A;  3DQ8 A;  3P28 A;  1XAE A;  1EMG A;  3ZUJ A;  4KGF A;  1RRX A;  4L12 A;  5J2O A;  3EKH A;  1S6Z A;  2G2S B;  3RWT A;  4OQW A;  3UG0 A;  2PXS A;  1QXT A;  5FVI A;  3VIC A;  1HCJ A;  5LTQ A;  1KYR A;  3O77 A;  2DUF A;  4DKN A;  3DQ1 A;  3H1R A;  2OTE A;  2YE1 A;  4IK8 A;  4KGE A;  2HPW A;  2QRF A;  5HW9 A;  5EHU A;  4HQ9 A;  3SST A;  2WSO A;  5HZU A;  2OKW A;  1GL4 A;  2B3P A;  3SSH A;  3ST4 A;  3IR8 A;  4KF4 A;  5EXC I;  4JRB A;  2ICR A;  1Q4E A;  3DQA A;  3GEX A;  3GJ1 A;  4W7F A;  3CFA A;  2GX0 A;  4ZF3 A;  4W6A A;  3LF3 A;  2GW3 A;  4OJ0 A;  3OGO A;  2IOV A;  2VVJ A;  1QY3 A;  4KW4 A;  3DQ5 A;  1EML A;  1ZUX A;  2HJO A;  2FZU A;  3DQJ A;  3LS3 A;  3DQ7 A;  3LVA A;  4W6B A;  2WHT A;  2OGR A;  1G7K A;  2G3D B;  4LJD A;  5DTZ A;  3DQC A;  4HQC A;  4NWS A;  3SVN A;  1EMK A;  2DUE A;  5DQM A;  2A46 A;  4EDO A;  4H3M A;  3ED8 A;  1Q4B A;  3H1O A;  1Q4C A;  1QYO A;  1Q4D A; 
#chains in the Genus database with same CATH homology
 2JAD A;  1MOU A;  1Q4A A;  2AWK A;  3DQD A;  2ZO6 A;  4IK9 A;  2QU1 A;  3PIB A;  3PJ7 A;  4XVP A;  5EB6 A;  4PPL A;  2A56 B;  3PJ5 A;  1ZGO A;  4H3L A;  1B9C A;  3G9A A;  3U0K A;  3VHT A;  3NT3 A;  5LTP A;  5FVF A;  4ORN A;  2WSN A;  3DQL A;  3WCK A;  3DQ9 A;  4EUL A;  3P8U A;  2DUG A;  2QZ0 A;  2AWJ A;  4GOB A;  3SVO A;  4XL5 A;  4W73 A;  2EMD A;  3U8A A;  5FVG A;  2EMO A;  4Q7R A;  1JC0 A;  3CB9 A;  4W6N A;  3SG5 A;  2OJK A;  3AI5 A;  1KYP A;  3NED A;  5EB7 A;  2RH7 A;  2V4E C;  2A52 B;  3IP2 A;  3EVV A;  4W6L A;  1YHH A;  4LJB A;  3SVS A;  3LVC A;  4DXI A;  5DRG A;  3SV5 A;  4DXN A;  4KF5 C;  1YZW A;  1YHG A;  2GX2 A;  2H5P A;  2H5Q A;  2A48 A;  2H5O A;  2YE0 A;  3BXA A;  2QLH A;  3VHT B;  3SS0 A;  4EDS A;  4OHS A;  5HGE A;  3NF0 A;  4GF6 B;  1YJF A;  3E5V A;  4W6T A;  2VVH A;  1RM9 A;  4JGE A;  1KYS A;  3ADF A;  4ZFS A;  5AQB B;  2ARL A;  3SRY A;  4KA9 A;  3SG6 A;  3DQF A;  2VVI A;  4J89 A;  4EN1 A;  2QLG B;  3EKJ A;  1H6R A;  5DTY A;  5H87 A;  4W6C A;  3BXC A;  1XSS A;  4UTS A;  1YFP A;  4JFG A;  4R6B A;  1RMP A;  3DPW A;  4DXO A;  2HCG A;  3RWA A;  2WHS A;  5KTG A;  2YFP A;  4KAG A;  1OXE A;  4I2Y A;  4XOV A;  2HQZ A;  4W7X A;  5DRF A;  4TZA A;  4OY4 A;  4W76 A;  4IK1 A;  1XA9 A;  2IE2 A;  1KP5 A;  3OSQ A;  3EK7 A;  4Z4K A;  5DU0 A;  1ZGQ A;  4DXP A;  2O2B A;  3DQK A;  3GJ2 A;  3SVB A;  1MYW A;  2QT2 A;  2HQK A;  4LQU A;  4W6R A;  3SG2 A;  2VAD A;  4U2V A;  1EMA A;  1W7S A;  4W6F A;  1EMM A;  2A53 B;  4KW9 A;  3CFH A;  5DPI A;  4HE4 A;  2Z6Z A;  3M22 A;  3U8P A;  1JC1 A;  4Q7U A;  1W7T A;  1JBZ A;  4DXQ A;  4IZN A;  5EXB A;  2AWL A;  4DXM A;  4PPJ A;  3LA1 A;  3V3D A;  4LW5 A;  3OSR A;  4W6D A;  1OXD A;  1XMZ A;  3E5T A;  1RMM A;  4ZBL A;  2VZX A;  4TZG A;  3DQ3 A;  3DQO A;  3SVU A;  4AR7 A;  2Q6P A;  2H5R A;  1W7U A;  4ZIO A;  5DPJ A;  2AHA A;  2G6E A;  5EXU A;  2FL1 A;  4RTC A;  2Z1O A;  1YHI A;  4J88 A;  5LK4 A;  4B30 B;  5FHV A;  1Z1Q A;  3CFF A;  2H9W A;  3LF4 B;  4KW8 A;  4W7R A;  4ZB1 A;  2C9I A;  2V4E B;  3GL4 A;  2G6Y A;  4JEO A;  2POX A;  4W7A A;  4L1I A;  3SG7 A;  5H88 A;  4W6I A;  2B3Q A;  3SSV A;  5HZS A;  2WIQ A;  4J8A A;  2WIS A;  3A8S A;  3SVD A;  2QLG A;  1XQM A;  1Z1P A;  2BTJ A;  3EK4 A;  4ZF4 A;  2HRS A;  3EVU A;  4HQ8 A;  4W7D A;  4PPK A;  5H89 A;  4IK5 A;  5EBJ A;  3M24 A;  3WLC A;  3AKO A;  4ZIN A;  3SSK A;  5HZT A;  2WUR A;  4BDU A;  3EK8 A;  3WLD A;  5BTT A;  4W6M A;  4Z4M A;  1BFP A;  3DQI A;  2Z6Y A;  4IK4 A;  5BT0 A;  5LTR A;  2VAE A;  3SVE A;  2G6X A;  4W72 A;  5DQB A;  4W6K A;  2QLI A;  4LJD C;  4W6G A;  3PJB A;  4ZF5 A;  2HFC A;  4W69 A;  3BX9 A;  3SG3 A;  4RYW A;  3ZTF A;  1EMF A;  3SVC A;  2WHU A;  4DKM A;  2OTB A;  3U0M A;  3ST3 A;  5DTL A;  1EME A;  1YJ2 A;  2G3O A;  4KEX A;  5BTT B;  4W74 A;  2IB6 A;  5BQL A;  5DY6 A;  3W1D A;  4Q9X A;  1F09 A;  3DQE A;  4W6H A;  4Q7T A;  3W1C A;  4W6O A;  3VK1 A;  4IK3 A;  3SSP A;  3EVP A;  3DQ6 A;  2H8Q A;  3KCT A;  3CBE A;  1QYF A;  3O78 A;  2H6V A;  3I19 A;  3K1K A;  4B30 A;  3BXB A;  5F9G A;  4H47 A;  2EMN A;  1MOV A;  2Z6X A;  4W75 A;  3ZUL A;  2O29 A;  4HVF A;  2V4E A;  2FWQ A;  3SSL A;  5DTX A;  1Q73 A;  3E5W A;  1JBY A;  2DD7 A;  1RMO A;  5T3I A;  2A47 A;  2G5Z B;  4AS8 A;  4JC2 A;  4KF5 A;  4W6J A;  3SG4 A;  4LQT A;  1HUY A;  2DDC A;  4W7E A;  3MGF A;  4W6U A;  3ZUF A;  2AWM A;  4RYS A;  4EMQ A;  3DPZ A;  4W7C A;  3NEZ A;  4H3N A;  2PXW A;  1ZGP A;  2YDZ A;  3S05 A;  4L13 A;  2ZMW A;  2GW4 B;  2HGY A;  3TMR A;  3DPX A;  4P76 A;  1C4F A;  2DD9 A;  5HZO A;  2O24 A;  3DQH A;  2C9J A;  4ANJ A;  4KPI A;  5DPG A;  1H4U A;  3ST2 A;  2QLE A;  2DDD A;  2P4M A;  1CV7 A;  3DQM A;  5DPH A;  2Y0G A;  2OKY A;  2ZMU A;  4R6D A;  4JF9 A;  4H48 A;  3TMT A;  3DQ2 A;  3KCS A;  4W6P A;  4LJC A;  4W77 A;  3CGL A;  3ST0 A;  4XOW A;  4PFE A;  2A54 B;  4Q9W A;  3SSY A;  3EVR A;  2DUI A;  2AH8 A;  1EMB A;  2HGD A;  3U0L A;  4N3D A;  3SVR A;  3GB3 A;  4OGS A;  4P1Q A;  3LVD A;  3UFZ A;  2IB5 A;  4XGY A;  3CD1 A;  3U8C A;  2Q57 A;  1F0B A;  4B5Y A;  4GES B;  3LSA A;  3DQN A;  4W6S A;  2ZO7 A;  1EMC A;  3CD9 A;  1GGX A;  2A50 B;  3DQU A;  1GFL A;  1UIS A;  2DUH A;  3U0N A;  3DQ4 A;  5EJU A;  1QYQ A;  3AI4 A;  5HBD A;  3NT9 A;  2G16 B;  1OXF A;  3DQ8 A;  3P28 A;  1XAE A;  1EMG A;  3ZUJ A;  4KGF A;  1RRX A;  4L12 A;  5J2O A;  3EKH A;  1S6Z A;  2G2S B;  3RWT A;  4OQW A;  3UG0 A;  2PXS A;  1QXT A;  5FVI A;  3VIC A;  1HCJ A;  5LTQ A;  1KYR A;  3O77 A;  2DUF A;  4DKN A;  3DQ1 A;  3H1R A;  2OTE A;  2YE1 A;  4IK8 A;  4KGE A;  2HPW A;  2QRF A;  5HW9 A;  5EHU A;  4HQ9 A;  3SST A;  2WSO A;  5HZU A;  2OKW A;  1GL4 A;  2B3P A;  3SSH A;  3ST4 A;  3IR8 A;  4KF4 A;  5EXC I;  4JRB A;  2ICR A;  1Q4E A;  3DQA A;  3GEX A;  3GJ1 A;  4W7F A;  3CFA A;  2GX0 A;  4ZF3 A;  4W6A A;  3LF3 A;  2GW3 A;  4OJ0 A;  3OGO A;  2IOV A;  2VVJ A;  1QY3 A;  4KW4 A;  3DQ5 A;  1EML A;  1ZUX A;  2HJO A;  2FZU A;  3DQJ A;  3LS3 A;  3DQ7 A;  3LVA A;  4W6B A;  2WHT A;  2OGR A;  1G7K A;  2G3D B;  4LJD A;  5DTZ A;  3DQC A;  4HQC A;  4NWS A;  3SVN A;  1EMK A;  2DUE A;  5DQM A;  2A46 A;  4EDO A;  4H3M A;  3ED8 A;  1Q4B A;  3H1O A;  1Q4C A;  1QYO A;  1Q4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...