3S0PA

Copper-reconstituted tomato chloroplast superoxide dismutase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
153
structure length
124
Chain Sequence
TKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDAGGRLACGVVGLTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical properties of Tomato Chloroplast SOD
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
total genus 27
structure length 124
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3s0pA00
2WZ6A 1E9OB 2VR8A 2AEOA 1F1AA 3ECWA 3MKGA 4MCMA 1N19A 4B3EA 1E9QA 1SRDA 1E9OA 2VR6A 1RK7A 4U4IA 2R27A 4A7UA 3MNDA 1B4LA 2JCWA 5KBKA 3F7KA 3GZPA 3SODB 1YAIA 1F1GA 4BD4A 3RE0A 4BCYA 4OH2A 3S0PA 1AZVA 1YAZA 3K91A 1S4IA 1JK9A 3L9EA 3GTVA 2V0AA 1XTLA 2APSA 2AQQA 1HL5A 3CE1A 1L3NA 1CB4A 3HFFA 1OZTG 3GZQA 1JK9B 1E9PB 1PTZA 2XJKA 1SXZA 2VR7A 1TO5A 2Z7WA 2SODB 4N3UA 1OEZW 2ZOWA 2AF2A 3GTTA 1E9PA 3L9YA 4BCZA 2WZ0A 2WYZA 1F18A 1OAJA 3LTVA 1OZUA 2WWOA 4A7TA 1JCVA 3KBFA 3KH4A 3KH3A 2GBVA 2E46A 5CU9A 2Z7YA 4A7SA 1UXMA 3T5WA 3HW7A 1SDYA 3GQFA 1QUPA 2ZKXA 1IB5A 1BA9A 2XJLA 2AQRA 1Q0EA 3KM2A 1SXSA 2WWNA 2AQNA 4FF9A 2GBUA 3CQQA 1PU0A 2GBTA 1XSOA 3H2QA 1UXLA 2AQSA 5KBMA 2C9VA 4OJAA 1KMGA 3F7LA 1IBFA 3KBEA 3PU7A 2K4WA 2Q2LA 3HOGA 2ZKYA 2WKOF 1OALA 1XTMA 1Z9NA 1F1DA 1SXAA 1B4TA 1MFMA 2WKOA 1SOSA 2ZKWA 4L05A 2E47A 1YSOA 1P1VA 5KBLA 4N3TA 3CQPA 1EQWA 1Z9PA 3ECVA 4A7VA 4A7GA 2NNXA 2AQTA 1IBDA 3KM1A 2WYTA 1ESOA 1HL4A 3H2PA 1IBBA 1SXBA 1N18A 1PZSA 2AQPA 2C9UA 1SDAB 2LU5A 1EJ8A 1SXNA 1FUNA 1DO5A 3QQDA 2WZ5A 1TO4A 1SPDA 4A7GF 2JLPA 2Z7ZA 1CBJA 1DSWA 1U3NA 2C9SA 2Z7UA 3ECUA 3GZOA 1SXCA 1COBA 3QQDB 1E9QB 1IBHA 1BZOA 4A7QA 4MCNA
chains in the Genus database with same CATH superfamily
3G6DH 4LARH 2Y2YA 2FO8A 2Y0SA 4Y5XA 2QKIB 2JCCB 4Z3JA 3VGBA 5MENB 2VL5B 3V6ZA 1VFAB 4IOIB 4ZUWB 5IEKA 2XX0A 1GKOA 1A6AA 3PP4L 1GGCL 1T7WA 3CVIL 5IW1A 5GHWL 3RY4A 1ZLVH 1DVXA 1NUDA 5BMFH 3IK2A 1KJ2B 4KY2A 1JHTA 1QTYT 1QX1A 3TBCA 2ODIA 1WQVT 3UAJC 5I8KL 2XACC 4P2OA 5IKCA 3GXUB 3DX7B 4KRPD 4ZFFA 2P52A 3IDNA 4QHLA 3NDYE 3TN0C 2LTQC 3WLBA 5TDPB 1A7RH 3O2VH 3LD8B 5ABAA 4H8QA 2VQTA 1F18A 3HNTL 4CMMA 3SKMB 1S7WA 2WB7A 1MF2L 2E6JA 1MW1A 3GI8H 3O6LL 5F1IA 2B5IC 4GBXC 2GTZB 3MBXH 4GS7B 2FTAA 5DLLA 4LSSH 5DJ2A 1R5WB 2VH5H 5HBBA 1BJ1J 5DWUH 2FEJA 2VN3A 1KXTB 1MJUH 1MFDH 4OCSH 1D5BB 1JRHL 2DEYX 4M3HA 1OGAE 1WFUA 3L4WA 4JZNB 3L1EA 4PJHB 3MR9B 2GBUA 4MZ3A 4OI8A 4JJOA 3WY3A 3T2NH 4DGIH 1BFTA 3RGVD 3OG6B 1BVZA 2XN1A 1BDYA 2GG1A 4XNYL 2F7OA 5E6IA 1OV8A 5D72H 5L4MA 4XNXL 1FZJB 1KMGA 1T2JA 1J0JA 1DLHA 4KRPB 4N5EC 2YLKA 4WFGE 5TH2A 2FX7L 3DNKA 5HYEA 2D7MA 4M5ZL 1RZ7L 1YY8A 1KGYE 3UYPA 5JHBA 5ALBL 3V6OA 3CLWA 2ZXGA 4M7ZC 1B3IA 3ZDZB 5AD0B 1GYCA 4KQ3L 3THMH 4IBWA 4B27A 4XMXA 1U2CA 5DU7A 2Q8BH 3DOHA 1JPTL 3FOMB 1NBYA 1DVSA 4H1LA 2BVEA 3OTTA 3QWQB 5J57B 5CGBA 3BGFC 3PQYD 4AG4L 4RMVA 1RY7B 3F64A 3FQUB 1GL4B 4P2YA 5K59F 1BCIA 3JWDL 3WNOA 3MOAH 1T6VN 3GLDA 5DJ6B 3RAJH 4U0RB 3VFTB 3SDDB 2IDCA 4LVHC 4XVTL 3N91A 5FWRA 1AFVH 5BRZD 1SN5A 1HZHL 5KYYA 1FYHB 3IJSB 5JPNA 5J11B 4FLHA 4XR8C 3VU1A 1CGSH 1GGUA 1YN7B 3F01A 4HUUB 3EIFA 3KCPA 4JQVA 5ICXA 3DOSA 4NQEA 3WIHL 3HE6D 3DIFA 2BMKA 1YY9C 3DHJA 4J3OF 2HH0L 3RY5A 5DRWB 5KBKA 4PCTA 1BVNT 1BVLA 1JHTB 3R4DA 2BH0A 3DMMD 4UQIM 4YMPA 2R2BB 2BVPB 3D4YA 2CLZB 4HGWA 4LP4A 3LMJH 4X9FA 3HHSA 4U1SA 5L2KA 3IVKB 4ADGA 3HBGA 1L9RA 5KSBB 1ZV9A 4MD4A 1HN1A 3RFZA 1RHHB 4QHNB 5AG8A 1N6QL 1ZHLA 4RGOH 4NQEE 3T8MA 1FF5A 1RHFA 2YPVL 3CDZA 3GMNB 2PNDA 1UD6A 3NFSH 3JWOL 2Q5BA 4Z0BL 5BRZB 4HBCL 2VLJE 5CCGE 3W81A 2H9GB 2BIMA 2AXGA 2KZKA 3HPJB 4LOFA 3MREA 5DJXB 2QGDA 5J1TC 5IHZB 1XF3A 3FQ4A 1A7NH 4F8NA 3VI4F 2NDFA 2DM4A 3V4PL 3VGDA 4BFJA 3HMWH 5IQNA 4I0PD 3BKML 3WNMA 5FYJE 3CU1A 2YA0A 4FG2A 4V2CB 5E51A 2LU3A 3MTXA 5ECJE 5T3XE 3LS5H 4LSQL 4RA0C 5D1QA 5TQ2L 3IRZA 4TNFA 3FFDB 1J11A 5BUGA 4FZ8L 4JL1A 3VWJD 3G6JA 5GRXG 3V0DA 1EGJL 4WW1A 4G82A 1H3VA 4JRXB 4PS3A 6CGTA 2I9TA 1XSIA 1YNKH 4OIFA 1Z66A 4D0CA 4DK6A 5HI5C 4XO4A 4H8WL 5KVEH 3OLEA 4TVPH 5FLUA 3TO4A 3VFGL 4ATWA 3MLPA 1KN2L 3N55A 4HKZB 2X9ZA 2ATKA 1IAMA 4LRIC 5FYLE 4PCYA 4FCHA 4URKA 1AGDB 4AEIH 4BH8B 3ARBB 1OPGH 3NK4A 4FQ1H 1JS4A 1YEJH 3DX0A 4HJGA 2VB5A 5C09E 2BWIA 3MO1A 1RU9H 1N64L 2E5EA 3EOYG 1EEYA 1H8SA 5T1MA 4IRSA 3HKFA 4NXKA 4PJ5D 2Q7YB 3WIAA 2XZQH 1E6OH 4M7LT 2BWQA 3CH1A 3FF7A 3IU3A 1ZLWK 4CILA 1PG7H 3ZDXE 4N90D 5JPNB 1QSEA 2A9AA 3E6FA 4M61A 3QCUL 1JTOA 1MVUA 1ZS2A 4JN1L 1DDHA 4O51A 1NBZB 3BSGA 3PPEA 4RBPH 5IG7B 4GQ9L 4XAKD 5EU5B 4JY4B 3ARGD 2B4CL 3T0VA 3MLZH 3IXAA 2R27A 5A2FA 1JZFA 2FZ3A 5ESVA 2A6DB 2HVKA 4X6DF 3QJUB 4CNIB 1DR9A 1IGFH 1I8AA 4J3OD 2TRHA 2I9LB 1FGNH 3DHMA 2FX9L 4YDLC 3C6SA 4K8RH 3TO2B 4BFRA 4G1EB 5CZVL 1YAZA 3CFMA 1MRFH 4J3OG 3GSNB 2ZUUA 3WJJC 4BGLA 5DSCB 1G43A 2EDYA 3NJGA 3UROR 3ZSTA 3VWJC 3QCVL 1TZIA 1YN6A 3CV5A 4LRNH 3LVEA 4O2CB 4PV8B 5EZJA 4BEIA 4CN4A 4DK3A 4NQDB 4AYMC 1JZ8A 5TFSH 2QMJA 1FZKA 2YJQA 3CSFA 2CCWA 1PGRB 2XCMC 5IHZA 2QVMA 2GJZB 2JF1A 3ZZLA 5AVXB 4OZHF 2VR4A 1BFSA 2KT6A 3DGDA 1HDMA 2Y1YA 2FJGA 1BQUA 1ITBB 2EXSA 1T20B 4OZHA 4P2RD 2EKSB 4M9OA 1SHXA 4RIRA 3H9SA 2RAMA 1UD8A 1P0SE 2WQAA 4P23B 4JW3A 2XWDA 4I9XA 1N6VA 4O2FB 4LCWD 3SJVE 1HYSD 4OD3H 3ULVL 5F8RC 1C7TA 5C7XL 1WICA 1K5NB 4ABWA 1MCOL 3V5HB 2LLNA 4KDTA 3FUJA 3ZYJA 1FYTD 1HIMH 1V05A 3DX9A 1J9QA 4GW1B 1OALA 3MJ8B 3T2NL 2C8NA 4M29A 4DUVA 4DZBB 3NCYS 4OLVL 2XV6B 4OF5A 4MAZA 3IMUA 2JJSC 5FGRA 3DO3A 4XC1H 5F7WC 3V2AR 3T1WA 5KAQF 2QDVA 1ZLUH 1OOAA 3ZDZF 1LWRA 2H6PA 5B1KA 5EU4B 5HHOB 2IAMB 4FA6A 3P30H 2C7UA 3P3TA 4ODXB 4F2EA 4HC1A 1BSIA 4X8JB 1XF4A 4FTVA 1PZSA 3KDMA 3RPIB 1BHGA 2ICEA 3M07A 1SDAB 3B37A 1OPGL 3MRQA 4FQ1L 4K5MA 5DCCA 3UC0H 4PAZA 4LCCB 3UABA 5DS8B 2QSCH 4HH9B 4AMKL 4HUNB 3D39B 1A02N 4ENED 5IG7A 1IGIH 3MFFB 3IDYC 5EU5A 3EOAA 2KUTA 1YZZA 4KVNL 3HPLA 3LNEA 1YNKL 4CN1A 3KPRA 3DTXA 5GISH 5HJDA 3KPMB 3EFOA 1U95A 1IGML 3ZKNC 1DSFL 2X4RA 1R3LB 5KSAD 3ROLB 3ZO9A 3DKHA 3IRCA 2NQDA 3KWVA 3QUHA 4G1EA 2QSVA 4X6CB 2E4FA 3AC0A 4L2YA 4AQ8C 1DLFL 3VGEA 1AC0A 1OF2A 4M4RA 3RE0A 3TBTB 3T09A 4ZW3A 4XCYA 2PYED 1U2YA 2F18A 1YYMH 4UBDC 1Y18B 5LB1A 1MCKA 1KCRH 3NA9H 2Z4TA 3VG9C 3A4DA 2FQGA 2QHLA 1ZCRA 1TQWA 4PS4H 1T4KA 2CCLA 2ICES 3PFQA 4CU7A 2F08A 3HG1B 1DN0B 1VHPA 1J48A 1B0WA 2AJUH 5AQ0A 4IOIA 5IEKB 1T1YA 3ZBMA 1JWSA 1OO2A 1QBLH 5I6MA 1ZT4B 1P9MC 1ZK5A 4ZOBA 2VDNL 2DQDH 3QUYD 3B3IA 1Q72H 5INCA 2O72A 3L81A 4YGAB 3WMSA 3PY9A 3SYAA 2IPTH 1IEBA 1D7FA 3EGSA 3T6WA 4OR1A 3TV3L 2OL3L 2EVJA 2XWTB 12E8H 3MA9H 2DI7A 3QWRA 2AZUA 4G8GA 3PWPD 1BEYH 1UGKA 3GRGA 2EH7H 3MJ8A 4WSGA 1BVKB 2Z31A 2IXQB 4NUJB 4DVBA 4ZTEA 3S4SA 2NY3D 1I1AD 1R3IH 1JYXA 2B2XH 4IJTA 4N2LA 4MXQC 3SKMA 3ZK0A 4DN4L 4L9LB 4AXWB 4AEHH 1XV8A 3P4MA 3CLEL 2FECL 2B77A 4MDIA 3CVHH 2IAMA 2ZXBA 3K2UH 2C7UB 3OKNA 4JR9L 4POZC 1UUNA 1EJOH 2NY4B 3MV8D 1KENL 1HOCB 2VLKE 4JRLA 4AIZA 5IVNA 4H5SB 1BAGA 2GTQA 5FYKE 2AQPA 4G6MH 3OL2A 5I6KA 3RZCB 4JKWA 4N68A 4LQFL 5FXCH 5HGGS 4RZCB 5FKAA 1Q0XL 1NDGB 5I6LA 1MCLA 5D93B 5DJ0B 3BLPX 4RISL 5SX5K 3VFUA 2MCAA 3WY4A 5I18H 1TTCA 2DKUA 3F7YB 4AZ8A 5I2IB 3EYSL 1J9TA 1S3KH 2OP4H 2X9YA 4KZ0A 3BPOB 4S1SL 2KYIA 5G4OA 3UYPB 3BD3A 3CZEA 4Z7OB 1N0XH 3FB6A 3CGTA 5JOFA 1BGXH 4KO7A 4U6XA 4L8SB 1MHHB 5HYJE 5LNDA 2Y72A 1XIWA 2H0PA 4S1DD 2JJTA 2J71A 4F92B 3MC0A 2MOQA 3FN0H 4XO3A 1B6DA 4WEMB 2P5EE 1JYWA 2ZCHL 4FNSA 3AXHA 3K72A 1LHZA 2DJSA 1E27B 2YQGA 3K2MC 4OH2A 3S0PA 4QHMB 1JPFB 1TNNA 1A65A 4NERA 1BIIA 4HWBA 2F7QA 4L8DA 3D08A 5F3BB 4KQ0A 4XZUB 5F8QC 4X6CE 3BI9X 4ZAKC 3U1SH 5C09D 5EWIH 1CFVH 4KITB 5J11C 4D0CB 2P8LB 1U4EA 3UTSE 1WUZA 3LKRB 1PIFA 4LAQL 1PAZA 3K8KA 4HPYH 2FH8A 3CHQA 4P8QA 3BUTA 3OZ9L 2LT9A 4GRLA 3H53A 1IAOA 1MI5E 3S36X 3S5YA 1NDMA 5GS0L 1FN4A 3WENA 4A7SA 1DJYA 4PJAE 3QXDB 3X3GL 2GT9B 1NGWB 2OPCA 2R2BA 1U8NA 4P3CH 5DS2A 1NTDA 3U46B 1QPPA 2CJUH 3B1TA 3X13A 3VJ6A 1EANA 2OK0L 1GGCH 1U21A 4AUYA 4FQQA 2DQTL 4U1KA 5GRZA 4ZW5A 5I8CA 4POUB 1J18A 2HJKA 2J8UA 4J6RH 1IRAY 4ZPVB 4JO3L 1YEEH 1AZNA 5HTSA 3BKCL 3TA3C 2YGOA 4YR6A 4YSQA 5DDHB 3MZTA 4LPVA 2J6WA 4Q0XH 5BZWB 2VC2L 3HRZC 2OZ4H 4MXVF 1E3XA 3WEXA 2APFA 2L8AA 5DGQA 4TL4A 4KHTL 2X4SA 3Q6FA 1LDSA 4S1QL 4QRSB 4MAYC 4FRWA 5KG9A 3V0JA 3RB7A 4D9RE 3OKEA 5T1KB 5KS9B 4HLZH 2P8MA 3WMQA 2AEQL 4WI2A 1L0YA 3P3SA 5I66B 3ML9A 2ROXA 3GBDA 2VM4A 5EO9B 4UTBH 2DOCA 3WXWL 4KFZC 1GCYA 4OFPA 3PP3H 1GZPA 1DBJL 2A4ZA 3F00A 3F83A 1NGYB 3BH9A 1FIEA 1R0AH 1KJMB 1BREA 1CDCA 5EF1A 4PBXA 1PZ5B 1OLLA 4JFYA 1N9PA 2JLPA 5EWIL 3SGEH 3C8KB 2XT1B 5K59E 3Q06A 1RUAL 4PJ7B 4WW2F 1AR1B 3N43F 3D85D 3POHA 3V4VL 4X6EA 1CYGA 1B90A 4L8SA 4OZGF 5T5NG 4R0LA 3MLYL 4MCNA 3RIFK 3RGVC 2WINB 3KD4A 5C0BE 2QZ5A 4K4KA 3P30L 2WLKA 2FJSA 3MCLL 4WI3A 5L4JA 1NFAA 1O0VA 2ZSVB 3Q8CA 5ICUA 5G5DB 3MO1B 1FNEA 2CZNA 3ABKB 5HPMB 3ARDC 2CD0A 4PJGA 3DRQB 2FUQA 5C0EA 3R06B 3SZ6A 5FAAA 2MMXA 1FYTE 5DJCB 3QUKA 3VNZA 5C0BB 5DVMA 4TULL 5DXWA 4A66A 4QT5B 2FL5B 4X7FC 1F6AB 2YLHA 1EZLA 3WXVL 3SKJH 5IBTH 2YO3A 4F8QA 1XT5A 3M1OA 3AUWB 4QI3A 5DK2B 1FQ9C 2AI0L 3IDXH 4WWPA 3SGJC 3X12B 1KZQA 2ARJQ 2G2RA 3N3EA 1H5BB 2B20A 3FHAA 4HQQH 1Q0XH 4IM8A 4NGHH 1DQML 3PGFL 5GGVY 3AU1B 4WUUA 1P2CA 4D0BB 1TSHA 3B3BA 4U6TA 2F9BT 4KZDH 1PLBA 4HEPA 5M7QA 1VF5C 2QR0A 4NJ9H 4NQSA 1MG3C 4MNGA 3DXAA 1WISA 4EDWH 1UM4L 5JIHA 4L0ZA 4DNLA 1UZ6F 3U6RA 3VH8A 2A0LC 2Y7OA 4PGDA 3FUNA 1L9OA 4LCIL 2EXWC 1TZGH 1LD9B 4WO0A 2Q8AL 3P0VL 2OYKA 3WJMB 1TITA 1DFXA 4XNUL 4OCRH 4DP0X 3BISA 5E5RB 3NCWA 5H94B 4AL8L 4PJ8B 3NPSB 5E6ZA 4G8FA 4NUPA 3A3YB 2XVBA 4LSTH 4YVUA 3VQMA 1R3HA 1M56B 4L9LC 3L3DB 4N24A 1PVHA 3NH7L 5I1DA 5DS1A 3E80A 5C0FA 1IL1B 4NQQA 4OQTL 4FQHB 3MLRH 5I0WA 1KLGB 1TJMA 1A1OB 2JIXA 2MQ0A 4JQIL 4YAQB 4MJ5A 4PLNC 2HT2D 3I6GA 3ARGC 3MRIB 1S6NA 2W5PA 3GO1L 4YZFE 4RAUA 4W9JC 4WI9A 1W0WA 2NY4D 3DYPA 3BXNB 1I3RA 3QFJA 2WLZA 3SDYH 5AUMA 2CHWA 5HYIA 4GI9A 3AAZA 4OGZA 2DQFB 4PREA 5D2NA 4UT6L 4ELMA 4DKFL 3G5YB 1A4JA 1RERA 3MRMA 5GRVL 5KZCB 3U0PA 3QPXH 3B7RL 4K55A 4OCNC 3HE6A 4PJ7A 3T0BA 4BFNA 3IXTB 4MXQD 5DMKB 3GIVA 1QA9B 5T3ZL 3CZNA 5A2BA 2ICWB 3VFNA 3WI9A 4I8DA 3KLAA 1RUPL 2VLKD 4HZAA 5AYUH 1E9QB 3BZFB 1RURH 1ZA3B 3C60D 4AWJC 4D9QD 4QLWA 3LQMA 4U6VL 1P4BH 3DRQA 3FSZA 3ILDA 1N64H 3R06A 1ZS8A 4L8BA 2FR4A 1SJMA 4YO0A 4L1LA 1FVCB 1KBPA 3C60B 3LIZH 1CN4A 1VFAA 1EBAA 4PD4J 4N2KA 2GABA 2TSAA 1NUGA 4ANWA 2VZOA 3QORA 4KX9A 1P4LB 5JQHC 5DK2A 1VDGA 3DSFL 1XGQA 1TTUA 3N41B 3FHQA 3EH4B 3AJ7A 3H54A 2HJLA 5AW8B 1NEUA 4XH2B 1TQBB 5BZDA 1DQIA 4YHZL 4I0PA 5DO8A 4NUJA 4W4NA 2HVBA 5IOKA 3DPBA 1OAJA 3DXAB 5FYKL 4QRTA 2UV3A 3H2WA 2YPLA 3W11C 4G7YH 4O00A 1SJVA 4Q9RL 4IIQA 5DMJB 3SYPA 3MLVL 2W9LA 5F1NA 2IGTA 1FFPA 4MJHA 4CL7A 3N44B 2CKBH 3BWUC 5F88A 2D3JA 3MUJA 3EFFA 4NEHB 3MRKB 1JHLH 1CVSC 3GB7B 4PJ5A 2CAKA 2I5YL 4X6BB 1W8OA 3NCBB 1WF5A 1J8SA 2J44A 4FI7A 4FGMA 5EUOA 5DJZA 5HI3C 4ZO9A 1F3DH 3X14B 4XP6L 3Q5TA 1HSAA 4U49A 1D5ZA 1DCLA 3CZKA 2X1QA 1CDUA 1NDGA 3QA3B 2A4EA 3V9FA 1I7ZB 4E9WA 2FT7A 4PRID 4P5TC 1ZLWH 1SOKA 1XAKA 2HSIA 3C09C 5L88H 4M7ZB 4APQA 4KKCD 5FV1L 3O3BA 3CK0L 4DN3H 4S0TD 1SOSA 3GBMH 4L05A 2AJYH 4MXVE 1EXUB 2VXSH 1QQDB 1RK0B 3RRQA 3FSVA 3B3IB 5HDBF 1VGKA 6TAAA 2NNXA 3RWHA 1JOIA 1PFCA 3ZIYA 2HRHA 1HHJA 2JVUA 4A04A 4LLDB 4K5OA 3QZLA 4U1GB 3QXUA 3MUGB 4O58L 3AS0A 4FMKA 1BIIB 2OMYA 4UIMA 4Z7VF 1DO5A 1CICB 2XQBL 3FYEB 1YEWA 2X6MA 5HHVH 4GS7C 3P0VH 3VFOA 1U3HD 4P5TD 4H1LH 1U8HB 2ESVA 5I1LB 2ZUWA 3FU9A 4I77L 2VLMD 3KYMB 4MCMA 4TSBL 4JHVA 1R3KA 4OBRA 3HB3D 1A6AB 2VDKH 5IF0A 6FABH 5D7HA 4IJ3B 4G42B 3MBWB 2L4OA 1SUHA 4G9FE 4DP9X 1XGPA 2F5BL 2FO4B 2BOCB 4B9PA 4OCXH 1CI3M 1URZA 1INQB 5AEAA 4A63A 2NXYB 5CJ8A 3ZYIA 4JFHD 3EUDA 4N20A 2J5LC 3B8YA 4ONHA 3K4DA 3TA3D 4A67A 3V8OA 4DERA 2NLJB 4WI4A 3DOIA 3BDYH 3GTNA 2W80C 3RHWK 2FGZA 2J8UB 2AQ3A 3KWWA 1T0NB 2Z3FA 4D9RD 1FP5A 2ERJB 3RVTC 4NAMA 2R69L 3CDCA 4AITA 2EUZA 4FXLA 4IRJB 3MRGB 3RUGF 3GDCA 4PRNA 5I0XA 3BT0A 4M1DL 2ZX9A 2IV9A 4NO2B 2BRQA 3O45B 2AF2A 4PLOB 1MN4A 1MWAL 1AGCB 2JQZA 5DWUL 3VI4A 2D3NA 1UC6A 1FAIH 2X87A 3C5JA 3L1FA 4I85A 5EOQL 4ZUUA 1ZHLB 5I17A 3D0VB 1YRKA 5AWNL 4NAJA 2BOLA 2VE6A 1VFOA 3MOBH 5G4MA 3VVVA 3HZMB 4YEFA 3GB7A 4PJ5B 3QNYB 3LHPH 4ZUVA 4OSUH 4U4BA 4KMTH 2CH8A 3EYUL 4HGMA 3LXCA 4Q4EA 3B5GA 4U1NB 1SBBA 3DXAE 1FH2A 3TN0D 1N0LA 1IX2A 4EOWL 5IVXB 2CIKB 3BSZH 1OGTA 4FG6C 4LBAA 4U7KA 3JUYA 2GKIA 1SQ2N 3HN5A 2EEDA 4F3FA 4PRHE 3DGGA 5HYSB 2M1KA 2WZPD 3FCGA 4ES9A 5DJAA 3RWDB 4PY7A 5GRUL 4JHWH 3NSYA 2W0KA 1D9KC 4FD0A 5E4EB 1EO7A 1X3DA 1IKFL 4NJAL 4ZODA 3IJHB 4LLVA 1G7PA 3U4EA 3RWHB 3E6HA 3DYMA 4NRZB 5ALCL 5DRXB 2ZUTA 3VXSA 3QUXA 1DVYA 3TLRA 3QQNA 2HKFH 3D87B 3SCMB 3HS0C 2PPFA 1RURL 5C0BA 2QPUA 4ZPVA 4JLRA 3RI5K 5DK0A 2AMGA 1ACXA 4WEBL 1V55B 1P7QD 3RWFA 3X1BA 1LP9A 5DMIL 3SB3A 2XV2A 5CWSB 4KI5F 5E6ID 3D1MC 5JIIA 1YYLL 4HSAC 4OF6A 4ODWA 4YLBA 3FH8A 1H5BA 5DYOB 2X4SB 3Q6FB 3VFWB 1E43A 4CKQA 1IGCL 1TYJA 1MREH 4FKKA 5LDUA 2J6EH 2GFBB 4UV7H 3IGFA 3WAJA 2OYLA 3O2DL 1WWCA 4PVLA 3QQ9D 5F1SA 3QJSB 1NGPH 5CIPH 4J4PD 4P2OD 3LKOA 4YLCA 3KPPB 1SEQH 3GMMA 2HVKB 2A4CA 4IBUA 3I6LE 5CEZD 3OSVA 5DC0A 3I6LD 2V5TA 1BMWA 2C5DC 1YQVL 4WHYG 5E95B 1PZCA 1G1OA 4Z7OF 2J57A 2YAOA 3PV7A 3OX8B 4J3SA 1L0PA 4OCMC 5BRZA 2OTWA 5DSCA 2H3NB 3DMMA 3FQ2A 5E9DE 1NFKA 5C0FB 2WBXA 4E0RA 3D0VA 2X40A 2LU7A 4ONFL 2VE6B 4C47A 5C9JB 2J1KA 5D9SA 3CQFA 3RDTA 1J8KA 1JHKH 2BW4A 3HAEB 3T6VA 3UAFA 2Q8BL 3UAEA 3LIUA 4YDNA 2ADFH 1KTBA 3BZ5A 2FBJL 2EKJA 3K0WA 5FYLL 5AAPA 1BXUA 4TUKH 4LLQB 2OCCB 3VXUB 2FGWH 3QEUA 5EZIL 1BJMA 3X12A 4F7MB 5DMKA 3QG6A 1QA9A 5HGHA 1K5NA 4MAUL 4XZ4A 2XWBA 1HNFA 2GTWA 5EZPA 1B0RB 2QLVB 4O02B 4H8WC 2CM5A 5FO2A 5IB1A 4YPJA 1BM3L 2DLFH 4E36A 3WKMH 2XG5B 2AK4D 5EEZA 4GMSH 5DHYB 1XR8B 3B43A 1H6UA 3U25A 4NN7B 4X8CA 4OLUL 1NL0L 1V5JA 1WP6A 2Z93B 4NQUA 4HWUA 5T1MB 4DZBA 4FULA 1UH2A 4LEBA 2IH1B 4O5LL 4FNUA 4W9KC 1DBBH 1FGVH 1CGXA 3QIWC 1L9PA 1DN2A 2EO1A 1E4HA 1UKTA 1YMHA 3GI8L 1G7JB 2CUMA 4KY1L 5FYJU 2IBZY 2WQUA 3QEHA 3U4BH 2FJFB 4Z0XA 5JW3H 2R0ZL 3C5ZA 2O1AA 5EOCL 3CSTA 2JMRA 4U3SB 1MVUB 4X8JA 3NRFA 2OL3H 4TUJB 3VGAB 4X4KA 1M3IA 3WTSA 1O7SA 1XF1A 1OTTD 5KSUB 1I7UA 2BZCA 2OSLB 4NQED 4XWGL 2BNRA 4HU8A 3NGBB 1H3GA 3IE9A 1EHXA 3ULVC 4K3JL 5DMYA 4GSDH 1A6VL 2KZBA 2EILB 3HS8A 3EOAB 3RVUD 2B15A 3T3PF 2DMBA 1YC8A 1DEEB 3BSHA 3U9WA 3GSXA 2FJHA 1SM3H 1OK8A 4IHOB 5IROC 4UU9B 3PP4H 3L3OC 4TTDC 2OZNA 3T0DA 3GRWH 4ODSH 3EHBC 1FFQA 1I1FA 3O3UN 4FQ2H 2ZYSA 1U93A 3H3PH 5ERWA 3U2SA 5MENE 4TQEL 4B9JA 1U30A 3VRJA 4LSDA 3SBQA 3CZSA 4JFDE 4AE0A 3NDZE 1CFNB 2IG2L 1I8MB 1F4WL 1W8EA 5DD5H 1U8IB 4JO3H 4XPAH 3VNYA 2ZOOA 5ACZB 5ALCH 3UDWA 4H0HB 2G9KA 3FYIB 1EFXD 5E6SB 3KGTA 3WG7B 1TUPA 3LDBC 4KJPC 4N8CH 2KPNA 3HG1E 1QSFD 4PVMA 4F80A 2BSBA 1KG0B 2GHZA 3H42H 3ARFD 1ES0B 4ALAL 3W11D 4OFQA 1UXMA 2JI3A 1ROWA 4PJCF 4CMHB 1DTUA 1MI5B 1U91A 1BXAA 3NESA 1M4KA 3EYOA 1QRNE 2WWMC 4NKMA 1BQKA 3VSTA 2NQCA 2PPDA 3ZE1F 4Q9QL 1RJZB 2O61B 5I0ZA 2J72A 4IRJC 3COOA 4NZJA 3UTTD 1BZ8A 3UTZB 2AJSH 5IIEA 4V33A 2JE8A 1MRCH 4GQQA 3IS0X 4HJJH 5F7AA 4AYEC 2XOTA 1OKEA 1QO3B 6PAZA 2JLLA 3BVTA 4K9EL 1SFDA 2DM7A 2Y25A 4MA3B 1TQBC 2H2SD 3BAXA 8FABA 5B8CB 2WWKT 3H9SE 3TT1H 2B8OT 4ZTOH 5ICYB 2IXQA 1RP8A 2VR9A 3BMVA 4WHTA 3SD5A 1YDPB 3L9BA 2WXIA 1TPXC 3PAZA 3KYOA 3TBVB 2NX5B 4ANKA 1YMHB 2WCGA 2YRPA 4WSJA 3WIIH 3ZL2A 5J1AB 3QIUA 1IEAA 3ZDWA 1G9HA 2AQTA 5F9OL 4NKIH 1A5FL 3MRQB 3OKNB 3STZA 4QO1A 4TV3A 2P5PA 5CCJA 3BT2H 4BCXA 5FOBB 4LVNC 5IOPA 2VLKB 3EYSH 2VITB 3MJ7A 3HZYB 5HVWA 5JHAA 1JGIA 4HGKC 5C7XH 1ZVHA 5ETUB 4ATTA 4CDGC 2DQ6A 4ZFOL 4HBQA 4KFMA 1SPDA 2Q87A 1T1ZA 5J9PA 4O4YL 2BRRL 3KPRB 2YQ2A 3OXSA 4KUZL 4PBDA 1KWGA 5DJ0A 3VFUB 5K9JH 3IWVA 3H3BC 2ZXAA 4H25A 5B38B 4V2BA 3KGUA 4B3EA 3L3HA 5INDB 3B6SB 2WXPA 3D3VA 4P9HH 3WFDH 3I9AA 1Q94A 2DJMA 2YBRB 2L04A 4HUWA 5E70A 4P2RE 4JDZB 3SODB 1Q0YL 1Q9LA 1F3JB 3CIQA 2X6VA 4XVUD 4HOMA 1HTYA 1U33A 4ZYKB 1R3IL 4LCWE 4O2EB 1PAMA 4ZG1A 4I88A 2CKBB 2UY6B 4CU6A 4MXWH 4C8XA 1UFUA 3MACL 4MAYA 2EDRA 3SJVA 4IU3B 1AXTH 3AU0A 4HT1H 3L17A 4UNUA 5D2LB 4J2XA 2QT6A 2VAAA 3IJEB 3BAYA 4JHAL 1E9PA 1A6TB 2BNQD 5HI4C 4AVHA 2WXFA 4HS8L 2DMGA 1G6VK 5JMOC 1UZ8B 3VA6A 4RFOH 5IMKA 1AO7B 3P2DA 5L7XH 2DQDL 2ZCLH 1BLNA 4AT6B 1DP0A 3OHXA 2LABA 1SOXA 2FX8L 3ZQWA 2AV7B 4LCWA 4UQEA 4TLSA 1H3PL 3KW8A 2H1LM 1URLA 3GEFA 5DVNA 1QO3A 2XKUA 2B1OA 5I1AB 3N50A 1KF9B 3ZVVA 5DEFA 1A6WH 1CLOL 3NIGF 4HC1H 5GSRA 5JHDE 1PU0A 4PS4L 3GJEB 3UZQA 5ESAB 1J9CT 4ZPTB 1QRNB 4MZRA 3US1A 1A1MA 1RULL 1QLEH 1E5YA 4KRNA 4G80A 4LNVA 5JA8B 1QEWA 4P2QA 3STLB 1TJHL 3O4OB 4E9QA 5I5IA 5JHDB 2X4NA 3G9VA 3S5LA 3DVNA 4NO0A 3MNWB 5IY5B 2K6ZA 3O0RL 2PCFA 4ZUVB 1T83A 4WHDA 5AOIA 5DQJA 1CVRA 1W0VA 3WTXA 4BWUA 2MCMA 3V6OE 2ZOUA 4MBOA 5L4FA 1W72H 2VLKA 3K4AA 3PCYA 3AG3B 1OTTC 1JZ4A 3P9LA 4E42B 2V8LA 1CC3A 1XIWC 2GITA 1SXNA 3LS4H 1R9FA 5FGSA 4F8LA 4B97A 4TLKA 3RWDA 1T4WA 2Z31D 5C6TL 5H37H 3DBXA 2Q2EB 3B6SA 5E5UB 3FFCD 3N43B 3HI1A 5AKSA 2R29L 4TSAL 2CBQA 4LKCB 4OM0H 4WI0B 1RFDH 1X9RA 3FQXA 4U1MA 4R0LB 1MIML 4NRZA 5DRXA 3VXSB 1OAXH 5GGUB 3S96A 5BV7C 4U3HA 3ESMA 2C1OA 4C4BA 2FQDA 4HJUA 2BRRH 2PWHA 4Z7VB 2DIEA 5DJ8B 1F4YL 3MYJA 2EH8H 1Z3GH 3OLDA 5CN2A 1T0MB 4I87A 1TDQA 2KQNA 4W9IC 4ODUB 2BSED 3RWFB 1LP9B 4F24A 3G3LA 5H37G 3RIFF 3SIKA 3KLHD 4LDOB 4JVUA 5CFAA 5F9OH 1M7IA 2Z7WA 4HH8A 5ESQA 2DQEL 4CW1B 4D9LH 1A21A 2G9HB 1WFMA 2VLJB 1CI5A 2VQ4A 3NEEA 3WHE0 5LGHH 3RUGE 4KTDL 5DO2D 2G2RB 4BQCA 2HTKC 1WZLA 3H3KA 4GBXD 4HF5H 3B2VL 3RYMA 3PWJA 4WUUB 4XO9A 3S36L 1AACA 2WVVB 3ENEA 1W72B 6PCYA 3DIVA 4ERSH 4K3DL 4CDHA 1P53A 4N2GA 2WQWA 5AVUB 1ANUA 3DJZA 2XWJB 4OF7A 2IH3A 4YBHA 3KR3H 1SXSA 2HT4C 1KSRA 5E8OB 5IHUH 1HAWA 4DWHA 3BO8B 5F7YC 5C0CE 1DVFB 3VRIA 2O93L 5DFWH 1TQSA 3DV4A 3SPCA 4FI8A 4Y19A 5C0CD 5I1CL 2ESVE 1I8KA 2OX5A 4R7XA 1SQMA 3UXFA 4X5WB 2GJ6B 2ESVD 1YECH 5KG9B 5DUPL 1E4XL 3QQ9C 5C9JA 2Q6WA 4JDTH 5I1DB 2W9DL 1J12A 4XVJH 5BJTB 5LBSA 2W0FA 3WFBL 5I74C 4BH7A 1R5IB 3FH7A 5FM8A 5IJBC 1MHCB 3EJPA 4OD1L 4XBEH 2HVJA 2GUYA 4QXVA 5DFTA 1NBVL 1CFQA 4FXKC 4PJIA 2ZXDA 3I74A 1AR1C 1CFTA 1T0PB 3C5XA 1AZUA 3U1QA 5JO5A 3GM0A 3QFJB 1E2VA 1I3RB 3F84A 2IG2H 5D72L 4KXCA 2WAHA 1T3FA 2XKSA 1WK0A 3F62A 2YWZA 3NP4A 3OMIB 2IDFA 2EH8L 4UINH 1F4YH 1LO4H 3DX3A 5IP4A 2K9UA 5DT1H 5LLIC 2MRYA 4FJ6A 3IJ9A 4LSPH 5LUMA 3OLGA 4UQ3A 1IEHA 1HILB 3HBQA 4PJDE 3MBXL 5GGUA 1QSEE 3S96B 1CURA 2D9QB 2X2UA 3BP6B 3REVA 4CRPA 4OLWH 3VCLA 5B3NA 1HE7A 2YS4A 2CG9X 5HJ3A 4JPWH 2EZ0C 3BZEA 2A74C 1J88A 3K71A 1NIAA 1ORSB 2DW5A 2WMPA 2ALWA 1DJWA 2HKAA 4L8BB 5FUCC 1N5AB 4EUPG 2A5UA 1EAOA 3DGCR 3MJ9H 4P99A 3GHPA 1FVCA 1LO3L 4Z0XB 4JDVA 2KL6A 1FSKB 3CFQA 5EU6A 4FI6A 4H8WH 5HYQB 3IPFA 4FC3E 1HYRC 3WDJA 2C3WA 4V1DD 1JD9A 1NKGA 2V6HA 3M6DA 1V8HA 1P2CB 3UO8B 3CD4A 1XGQB 2I69A 3GWJA 1UOLA 1N8ZB 4UF7C 2BNRB 3H42L 5AVTB 2YIHA 1TMCB 2ODHA 3T71A 1EVUA 1S78D 3MNVB 3LIZL 4QRUB 4PR5A 5CEYA 1UB5B 4XWOD 3LZRA 3OKMA 4GG6E 2WCSA 2YSTA 2FATL 4XODA 1U8KA 3Q9QA 3GSUA 2R23A 4JY6B 3P73A 1AQDA 4FLOA 4PJEB 3UTQA 3ETBF 2C4XA 4PRBB 3QUYB 1LD9A 2HTKD 3LB6C 4YX2H 4P3WA 4BA0A 5JDSB 3J2PA 4ZD3L 5FFLA 4I3SH 4MNHA 3CXHJ 1J0KA 2HRPH 4HALA 4E5XA 2R2EA 3S35X 5LNGA 3A6CH 1D5XB 4RGOL 1ZD6A 4LLUA 3VSQA 4U3CA 1ZDSA 3ABZA 4L4VA 4NC1E 5GSVB 4YBLB 4QXUL 2ZYHA 1F2QA 4NM4L 3QZWG 4NM8L 4W9HC 4AL8C 5AFAA 5B7FA 1E40A 2H2PC 2XU9A 2JB5L 3D7PA 2ITDB 4K9EC 1JGEB 4HMCA 1UCTA 2YAEA 3MROB 5HHOE 2UZYB 5KTEH 4EBQL 4IMKA 2OMVB 5CBEA 5E99H 2F53A 1V54B 3RTQB 1OSYA 3PWVA 1A2YB 1P1VA 4IIZA 3D3VB 2XWXA 3UCRA 2JKRM 1AGEA 1CK0L 3EYOB 3MRFB 1KDJA 3QG7L 5FDWB 1T3FB 2FVNA 1TU2A 3P69A 1HQRA 2DM2A 4S0SD 3PG2A 4OCWL 1ED3A 2CUIA 4GLRI 4U0RC 2VKWA 4YFLI 3B5HA 1MLBB 4YZWA 1VGEL 2D03H 3DURB 2ICWA 4MA3A 2YQ3A 3ELAT 1ADWA 5HDRA 1PCXA 3JT0A 1DQJA 2AJXH 3REVB 3NIDF 3WFDL 4EIGB 2HN7B 4LCVA 4PY8J 3LPGA 4M7KH 5KTEL 2E7BA 3LPOA 4EKJA 2XPGB 3OMZA 4MA1C 3RNKA 2E7LA 3SBWA 2YGVA 1YUHA 3EADA 1OM3L 1R3KB 3T6ZA 2WLHA 2DBLH 3GBNH 2BVOB 2K1MA 1BF2A 5TPWH 4XXCC 2XXGA 2KPWA 3NPZB 2YKKA 1BEXA 3SDXB 2YUWA 5EFIA 2X2IA 3D33A 3EKCA 3FB5B 4BUQA 3A67L 5DEFB 1D9KA 2KERA 2F54A 5K9OA 1MCBA 2ZWLT 5DUBB 3EYVA 3G5VA 1S7XB 2IFFL 2LAGB 3D25B 3OGCB 4E9VA 4KZCA 1FZJA 4LB8A 4IIQB 2WN2A 3FS9A 3IFPA 2NX5D 2CGRL 4P2QB 1FFPB 3STLA 4NO2A 4WUKL 5EDSA 3Q2CA 4Z9KB 3MZGB 5CS7A 1ZWIA 1DQQB 1Z2KA 3WN5A 3DX8A 2X44D 4P2OC 3IT8D 1A14H 4XOAA 4RGNC 1QVOA 1X5XA 2EH7L 5A6LA 2VDRB 2F54E 5HVFB 3EJSA 2FSEB 4FLSA 4HD9A 3X14A 4B9FA 3P9LB 5BQ7B 5IQ7H 1E5AA 4PJ8D 3ROOA 1PD1A 1NWPA 5DZJA 3GBEA 2Y1ZA 1R0AL 1HT6A 2D73A 4KNTA 1FA4A 3PL6C 1IC5L 2ZWKA 3W5NA 1PKQA 2B1AL 1E2ZA 1XGZA 3MROA 2VERN 4WTZA 3A5VA 2NSXA 5IR1A 1UADC 2YRZA 3SDDA 4XVOA 1H19A 1ZLDA 3O4LE 1BG9A 3FU3A 2AGJH 5J12C 2Q10A 1E7VA 1HH6A 3ASOB 1T2QH 5BZXA 3QK0A 4IGBB 3DBXB 1D7CA 1EXUA 1MCCA 4F2MB 3ULUH 1CD1B 2WKOA 5BMFL 5ITFB 1EAJA 4JMNA 7FABL 3CCHB 4F1SA 2P42B 2GSMB 1VZIA 5CLTA 2ATKB 1S9YB 2AP2A 3FK3A 3RILA 3FO2B 4Y7OC 3DIFB 5JPMA 3Q44A 1R5VB 3ZHLA 3ZZ1A 3WJJA 4YNYA 5L2KE 1G5AA 4POZD 1H9DA 2R1WA 3P11H 3H4HA 1FWXA 4TQEH 4C55A 4Z3HA 1UTDA 4XN4A 3QQ4A 5HYJD 2LV4A 3GRWL 4ODSL 5ISZD 2H1XA 3CH1B 1JL8A 1ODUA 2C9SA 1NC2B 1WT5C 4MHHG 4XPHL 2FEDC 4APQD 2CRZA 1HEJC 3SKOA 5CWSA 2VLJA 3S5LB 2IMNA 3TH4T 3MRNB 4N6RB 3ZT6A 2R0WH 1F58L 1WBYB 3TPUA 3AADB 5L2JA 1IKNA 4BK5A 5BW7A 2E7LC 1TJGH 2F68X 1BD2D 1YEDA 3IFNH 3DWTA 3WHE1 3QUGA 3W3BA 3F6LA 1OCZB 5EA0L 5HD8D 3PL6B 5F6HJ 5SWSB 4YHIA 1T7VA 5TE4L 4F58H 2AJXL 5CM1A 2KBGA 1K3IA 2NLJA 1F97A 3O3EB 4PW4A 4E42A 2E56A 4BD4A 3MGTA 5K9OB 5CR8A 1FNGB 2VDPH 3L3KA 3ALXA 1EIBA 5D1QB 4DP2X 5EU7C 3G6AB 5CR1A 2J6EA 2HFFA 1T2XA 3HKZA 5ENWA 3U36A 4P07A 1LO2H 3GHEL 3QULA 1Z5YD 2YZ8A 3V6FB 2HG0A 1WITA 3PUCA 3D30A 4K3DH 1TZAA 4G9FA 4X7DC 3ARFB 1FZMA 2YPKB 1ZPLA 4JFEE 2X4UB 4S1RH 3RU8L 3QDHA 3TBSB 4BZ2H 2A0LD 1WHOA 5T1KD 2OMZB 1FO0L 3MDJA 3O6KL 4EMZA 2OCJA 2AJYL 3HS0A 3OR7A 1KGCE 3AZUA 3S9DB 1I8IB 3Q8EA 1G7LB 3C08H 3QAZC 2ICWI 4K23L 4K71C 5D9SB 4I89A 3RDTB 5DJ8A 3IPEA 2X6UA 3MRHA 2BVQB 2YEQA 4JHBA 4YDZA 2WTRB 5EEXA 4L3CA 4WGWB 1PZ2A 2HYMA 4UAOB 2FEEL 3TZVD 1BQSA 2AHIA 1WLHA 4H7VA 3UADA 2NXZB 1GY1A 4ONGH 5D96C 4PJFE 2A6KA 2GBTA 2WW8A 2G5UA 4QHKI 1JNHB 2E9BA 2RMNA 3VG0H 5B3JF 5AB2A 4MD0B 2ZCKH 3X2QB 1IBFA 2K4WA 2FJUB 2V2WB 4QWWD 3T1FA 3TN0A 3B1UA 5F7UA 5KYXB 4DQAA 2PUQT 2EVFA 3NFNB 4Q2ZB 4OJDH 4GIOA 4ZS7L 1M2VA 5F96H 2X38A 5HJ3B 5TE6L 4ICXA 3KR3L 2YRLA 5IFAH 3CH8A 3LNDA 3WMPA 2ENSA 3OMAB 4AJ0A 4H26A 3BN9D 2XBDA 4CC4A 1GGTA 1AQMA 3ILQD 4F20A 3IN2A 4OT1H 3FXIC 3BWUF 4ELDA 3GS0A 4HSQA 2BDNL 1XD1A 3MRPB 2HRGA 3QDME 4ODWB 3QEHB 3G9AB 4IBQA 4KJQC 2BS71 4OJFH 4GI6A 1QSFA 3MRNA 4N6RA 2IPUG 1DDTA 1WDAA 3FN9A 1MCEA 3QIUC 5JXAH 4E9XA 1BMGA 1W15A 4HS6A 5EIQA 1ZLUK 1VACA 4JFZL 1TJHH 3CN3A 4WO4B 5E1GA 5DYFA 4N0FA 2Q86B 2AJZA 3WNIA 3WJLA 4FX5A 3EYFB 4TVPE 1E9OA 5DFVC 5ES4B 3QRFM 3F7PC 3ZTCC 1J1XL 4R2GD 4WKZB 3UJTH 4B9CA 1XL4A 3Q8AA 4R4BA 4RIRB 3HN8A 2TAAA 5DVOA 3GSRB 4WFGD 5E1IA 5DR5L 1G84A 4LGSB 4NUQA 3VXMA 1I31A 1TTAA 4LLUB 5I0VA 5GSVA 5I30H 1L3NA 5ERWB 2XA8L 3FT9A 3U2SB 1R24A 4OFDA 5IJCC 1GZHA 2EO9A 3OMNB 4XP9L 3SDYL 1XH0A 4IBLT 3ZHDA 4Z7IA 5JW4N 2QVFB 4BUGA 3HAEA 2K7QA 5MEOA 1EHKB 3BLBA 3RTQA 4LIQE 4UOQA 4DCQB 5C70A 5D7JA 3PWNB 3QH3A 4G1MA 4JQVC 4L3CB 4KNQA 3PAVA 2VXVL 4LLAA 3T9WA 4UAHA 5CLYA 4AKOA 4LHJB 5EU4A 5HHOA 1Y7VA 3L5WA 4P5KB 5AL0A 4LPYA 1BXVA 4AIOA 3MBEC 1RJZA 2O61A 3DIDA 2I7OA 1I7RA 1JI2A 5LKNA 1AHKA 1H3WM 1XSKA 4NB7A 1XF2A 3KJ4B 3LEXB 4PPTA 3CUPA 1XDTT 4KXBA 4L8CB 2IVFC 4PJ6A 2ED9A 3TN0B 4G8GB 3SDAD 1ZV5A 4HIHA 1OPOA 2NDGA 5JXED 1IM3D 4HIJB 1EJFA 1TCRA 2VGLM 5ICZA 1B4TA 2HN7A 2Z93A 3S36H 8FABB 3AREB 3APDA 5HJGA 2R23B 4L5FE 1T66D 4L3AA 3O8XA 5D71L 4OB5H 3L9RA 5D1XD 1ZT1A 2IOIA 1OARH 4N8VG 4L9LA 3SCMC 3GHBL 3GMOA 2DWYA 4NCC2 1R3LA 5HHNB 1MW2A 2ALAA 3ROLA 3FSAA 3DDFA 2EUXA 2JB6B 3F2LA 3D0LB 2X12A 3VQ2C 1D5XA 2NY7H 1C8PA 4OV5B 4Z3IA 5DC4B 4OCYH 1MFBL 4RMUA 5CCHE 2NY7L 3SDXA 4HJTA 4M6MH 4K23H 1UXWB 2GUOB 4N2AA 4EZLA 1NMCB 2VM3A 3K5SA 3WNKA 1HSBB 5E9DD 2ZF8A 1COBA 3EXJA 1MAMH 1ZSDA 4XHJD 1E28B 1E4XH 4IEFB 1E4XI 3I75B 3WIHH 3BH8A 1AXSB 3K6DA 2EUWA 3WAKA 4GBXA 4GUPA 1P5UB 3QDMB 1RFDL 1S8DA 3C6LB 3LRMA 1HXYB 2IGLA 2XTJB 2J1WA 4R8WL 3CLFL 3UMNA 4H13C 1E8WA 2BSRB 3MOQA 4HKJB 3RGHA 1OCOB 1RJYA 1KIRA 2NPLX 2P47B 2VT0A 4AL8H 3DJSA 1Q94B 2G60H 2YRBA 4EQ3A 4BKLA 5SV4A 2BP0B 4UTCA 2JCCF 2NW3A 2PPEA 5C0AD 3MLSH 1JGLH 4KO9A 4FG6D 4M1CC 1PX8A 1T04B 1X4ZA 3T3MF 4BFKA 3GZQA 4MZ2A 2YXFA 2VR7A 2EP6A 1PCSA 2HLFC 4QRRE 1E8YA 4Y4HB 4PTTB 1G7MB 3IEAA 1L3WA 1CG9B 2Z8RA 4JO2H 4PP1D 5KW9L 3S5ZA 4AMXA 2CR3A 1E65A 1MPAL 4YXLL 5E9DB 4FYRA 2P8LA 3V6ZB 2H4EA 5A43C 3PAUA 1YJDC 4AXWA 4JHZA 4R7LA 4MX7A 3W0WA 4FCAA 1SLXA 2GEEA 4J3WA 1RK1B 1C08B 1KTLA 3D39D 3ARSA 3MLXH 1RULH 3DMMC 3LRKA 5IROD 3EDEA 2JFCA 1KJ2A 4M8QA 1N5YH 3QCUH 5KSBF 5B38G 1K72A 2QPEB 3HBPA 3NFPB 4PTUB 4KWUA 1U8NB 1V3LA 4OCSL 3ES6A 1X5GA 3PWUB 1NAML 3F85A 1NPNA 1SYSA 3FFCA 3GKWL 3QQ4B 1L6PA 1BD2E 3PXJA 3QI9A 2EYTA 4PHZA 4XXWC 4YDIH 2AV1A 5LBSH 4JFXA 4F2ME 1A3LH 3D69A 3L16A 4I1NB 4M9PA 1Z5LB 2P43B 2VLLA 4PG2C 3W0WE 4DH2A 1QR1B 2Y7QA 2EYRB 5C0AB 3UX9B 4ZSOB 4UNIA 1PD6A 2QDWA 4YPGB 4DW2H 4WI8A 4JO1H 3CN1A 4QRPB 1G0XA 5CJ5A 3CQPA 3RPBA 4Y16B 1HHGA 3L1OL 2NY5C 1YPZB 1HQ4B 1IAKB 4HA1A 4Q9QH 1YNTA 5TF1H 5IM7A 4Y1AD 3MACH 4JFED 5LG1A 1RIHL 2G2NA 4Y4HC 5EU6D 3OAYK 2R56H 5F7KC 2C1PB 3VXOB 5J9PB 2OMTB 5ENWB 3U36B 5TE6H 4K2UL 1DBAH 4GXUM 4N28A 2CGRH 2VDPB 5EEWA 2VR5A 2A83B 5A16A 4S1QH 4PJGE 2X05A 1P5UA 3QDMA 2CO3A 3FQ1A 1Y07A 1N7ML 1WYJA 1ZGLA 1GJWA 1JWMA 2X4OB 3ZE0B 1NAKL 1DVUA 3VDCA 1KGIA 4MWFB 3T0XA 4PRAA 5H8DA 1N12A 1T1XA 3LNHA 2ZP9A 4ZQTA 3D52A 2P5EB 1UM5H 2WYIA 3C9NB 4F57H 3FU7B 5EBMA 1QRND 3AXLA 3EZJB 4MD5B 5JW4R 1T6WA 4IDJL 1CE6B 1G0DA 2CHNA 4P4KD 4XI5C 1JPSH 4FFZL 4A2MA 1RIVH 3ZHNA 4D94A 1BBDH 2Z9TA 1YMMD 1HHHB 4XNDA 1SGKA 4ENZA 5CEXB 2DIAA 5TDPA 3MXWH 4F9LA 4AE1A 4AC4A 2SODB 3N0AA 3HC4H 4XWGH 1A6UH 2O4EA 1VPOH 1JGVH 1TYEB 5IMKB 3Q2VA 4XN2A 3OHXB 1AY1L 3E1ZA 5AOMA 5JDJA 1EXHA 5GS1C 1CXIA 3SE8H 1YEDB 2BOBA 5B4MD 1A1NB 3TP4A 2YC1B 5FPIA 3P0GB 5K9QG 4M02A 2HFEA 1BVLB 4RQQB 3T5WA 4KJYB 3FTUA 1J0IA 3QZNA 5CGTA 3GHEH 3IDJB 4MNGB 3VXTA 4Y5XC 3GJEA 3UZQB 3V55A 4ZPTA 2V37A 4OF0A 1CK0H 2WN3A 2XWCA 3P4LA 4ELKA 1IQWL 4F93B 5KJRH 4KTGA 2DYRB 1CU4H 3L4VA 1HX0A 1VPOL 4NO5A 2EICA 4NT6A 5E0QA 3UBXB 5FLVA 2OW7A 4J3XA 4FADA 5BS0A 1WBZB 2MHAA 4ODTL 5KBPA 2PCFB 4BFIB 4KUZH 4WTXA 5LBVA 3BAEL 1WIPA 4W9CC 1I8IA 1RIUL 2IEPA 2FGWL 4PJAF 4Q7DA 1IAKA 4FL4B 4ZX5A 4NM8H 1YYLH 4MJ6B 5G5DA 5CO1A 1A1OA 2X3AA 1EQWA 1UFGA 1SHMA 1Z9PA 4Z95L 1AVAA 1EDYA 2X70A 4LQFH 1J9SA 4LT7A 3CFUA 3KJ4C 1TTGA 5F6IB 3QHFL 4LCUA 4F57L 1M53A 2HVJB 4CBZA 4JM2D 1E4KA 3SCMD 1CFQB 3IKKA 2CXGA 5DI8B 1X6LA 2DD8H 4K3EL 1KENH 2XICA 4X99B 1XZ0B 5KYYB 5TK2A 5GQBA 1D9KD 3L3GB 3BUQA 2IGFH 3G5YA 3AREC 1ZTXE 5C71A 1FO0H 3JTTB 1I1AC 3MAWA 1AIFA 3GZOA 4NRXB 5CF3A 3FPYA 3FQXB 4U1MB 2VR8A 5I16B 3S6CA 3ULUL 1IGMH 4IRSC 4OAWB 1E9QA 1F00I 1A0QL 4MD5A 4NBYB 4Z7WB 2QHRL 4G83A 2ZICA 4KTEH 4Q58C 5F7DA 4JKKA 2ADJB 4EDXB 3QJTB 2BP5M 2PO6C 1CFSB 5B7MA 3JV5A 4TUUA 2VW6A 2IWKA 1T0MA 2JKNA 2O6PA 4QRPD 3CFEB 4Y8AA 2OI9B 1IC1A 3PS6A 1TQUA 1UXSA 1ORSA 1TEYA 4DP4X 5FV2A 4MA1B 2APSA 2JSFA 5ILTL 5EF2A 3S98A 2XJKA 4HUMB 2Z0BA 4NN6C 1U4FA 1TO5A 3BW9A 5GGRY 5LCVH 5B39B 1LVEA 1H3UA 1XGRA 4Z7NE 3MREB 2UUDK 4IOSA 3W1ZA 1EFQA 1W2KT 4M56A 4XC1L 3BEWA 5F6IC 3LKNB 2DJ4A 4OLVH 5D4HA 4KV5F 1KV3A 1UWXK 3TZVB 4NQVB 3ZYOA 4S2SB 4X9GA 1OL0A 5BCAA 3SDDD 1RVFL 1KCRL 1RZFH 3HR5B 3GMOB 2WXKA 2K3HA 1KB5B 5BOPA 4U6YA 4N5UA 4PH8A 4KBPA 4NKDB 4CADB 4RMSA 5GS3A 4YIQB 8PAZA 3EFFB 4HDIA 3DVGB 2AW2A 1SEBA 4YHNB 4NI6A 1OM3H 3C2AH 1M7XA 4JHWL 4NN5B 2EDFA 2BZ7A 3MV7B 1MQ8A 1WUNT 1WV7T 4FS0A 3ARBA 3FFCE 4M6OH 4PS7A 4BH8A 4I48A 5BXFA 3KG5A 4AYID 4GT0A 2FLRT 1NPUA 3DX1A 1FVEA 3B9KB 4WJ5B 4W6XB 3LY6A 1S8DB 3VQLA 3BSZL 3D9AH 2F53B 3HI5L 2EDJA 2B39A 5CBEB 2GCYB 4EI5C 1AZBA 1CWVA 2BY0A 3UGUA 4AOFA 3IU3B 1QZNA 4KMTL 5BV7L 1NCCL 1XZ0A 1RZIA 1NC4D 1A22B 1P5VB 3Q5YA 4N8VB 4QXGL 4Y5YB 2EQDA 2C9UA 4R7DA 2ISDA 1QI4A 2YAQA 4GG8B 4KRLB 1VB9A 4AQAA 1LXMA 1T04A 2G5BB 5I6XC 1UOWA 5JYLA 4DTGL 3D39E 4OAWA 5C07B 4I0PB 5E8NB 1N3NA 4GW5B 1GOGA 4D9LL 5E00B 5JQ6L 2J6EL 3BAIA 3WN5C 5MEND 3VFSA 4WWOA 3GYRA 3ZE2B 5E2UH 4GKOA 5I9QC 2MSPA 4MMZC 5CNHA 2JB5H 2DAVA 3GJFA 2EIEA 3SE9H 3TO2A 1LO0H 3AB0B 5F88B 3GSNA 1Z3GL 1Z0NA 1CXHA 1UEYA 4KK9C 2CHXA 4JE4B 1KYAA 4Y5VB 4CU8A 2Y5TB 3FRUB 4I3GA 3SN6N 5CBAB 1DE4B 1ACCA 5HGAA 4EE2A 2RA1A 3DLQR 2J5WA 4DGWC 3RFRA 4EO5A 4KGJA 4HLEA 1OZTG 2AXFB 5HYSG 2Z8SA 2LAAA 2NYYC 3MV9E 4M7LH 3TTYA 4DSYA 5SX4I 3T6XA 4TSAH 1T0NA 2CK0H 4EUPH 1WGOA 1L9SA 2WLMA 3D50A 3V8CA 3FQWB 2FATH 1DBKH 4PRDA 1BJ1H 2OTPA 2KZ1B 4WDIB 1SLVA 3D2TA 4AEHL 1KIPA 2L3BA 4HG4J 4AM0Q 3UYOD 1YY8B 5AAWA 2B2XL 5C97A 3L48A 4NX0A 4HK3N 1QLFB 3IKCA 1FNLA 3VFGH 4L4TB 5FHBL 5I17B 3U7WL 1B3JA 3BCFA 3X1GA 5KVEL 4J1UB 2C3VB 3Q9PA 5LWYH 3PHQA 1KPUA 1WZKA 1UZ6E 5H2BA 4HMDA 2DDQH 3QYCA 5DEGB 3IGKA 3RA7H 4H4NA 4PIRF 4YWGH 4L4TE 4DPAX 3AQDA 2AITA 4WW2C 2EC9U 3C60C 4LSRL 2ZXQA 4PJBF 4PGBA 4AQOA 2NZ9C 5IB5A 2DYPB 4NSKA 4TLUA 5BOZG 4G2AA 4KI5E 3TVMC 5FA4B 4YFLF 2IQAB 3W39B 5IR1B 3T08A 4XNBA 4DO4A 4LRIA 2VC2B 3ESNA 5C2UB 4GKSA 1CD9B 5D96B 5JR1L 3UACA 3ZUNC 2QV2A 4GRWF 1FG2B 1YMME 5GPRA 43CAA 3QZPA 4XHJC 3IJHA 2E76C 1MCFA 4L29A 2HAZA 1PG7L 4AGQA 2VW4A 3ARDB 3ABLB 3SPJA 3KPRE 2JJUA 5HDBB 3NZUA 5E5MB 1M05A 2F53D 3TJEL 2TSBA 2FHCA 3BDYL 3PP3K 2QQQA 2CBOA 3OB8A 4HIQA 3I9PA 2VN4A 3NIDB 1DJHA 5EOTB 4N4YB 3F12B 4PRHD 3SGKA 1GZQA 3K8MA 3C09B 4DP5X 5IFJB 5AKVA 3I50L 2IAMC 2CLVA 3RNKB 5KS9F 5DUJA 2VJ8A 1T7YA 2JK5A 1AMYA 1W9XA 3E8UL 3IJ8A 3T4YA 4ZTPH 1AXTL 2ZYRA 1YECL 3OXRB 3RVVC 3S2AA 2G3XA 3D12B 1XGTB 3M17B 3QPQD 4AYFA 4U4IA 1KCLA 1JV2A 1KB3A 1FO0B 5FHBH 2Y2WA 3HC2A 1IGIL 4QYAA 5DTFB 4CC1A 4TNVF 4CVXA 3MJ9L 1QW8A 3WUWG 4DEUA 5HJBA 1L7TL 2MNJB 3FT3B 1C8QA 3JYCA 1OTUC 4NIKB 2OMUB 2YMTA 4UQ9A 1ONQA 1WZ1L 3VXTB 3A4AA 5DJYA 5FB8B 3RZCA 3PF2A 3ARFC 3EYUH 4JFOB 5FKAB 3RTQD 5CSBA 3MX0A 3GMMB 5D1ZD 3OHMB 3EDDA 4L2LA 1CTOA 2X28A 4QOKB 2OMXB 4CGTA 3Q05A 1AQKH 1WCQA 2YUXA 4L3EE 4DKEH 3WFEH 1U9KA 5F7EL 3T3PB 5HHOD 1AXIB 1OAYL 1MG2C 4HU2A 2NY5H 4KZDL 1JWSB 1PL3A 3OPZH 1ZT4A 5JOFB 4A2HA 4C4UA 4PWEA 1CCZA 4P46C 5H4ZA 3ZL4H 5IMOB 1TOXA 4HV8B 3LRSB 1B2WL 1U8PB 4L3EB 3OR7B 3TWCH 4G8IA 4DGVH 1TTRA 2YSSA 4G70B 4GW4A 5C0DB 4W9GC 1U58A 3L95B 4DGUA 3KE0A 4ZAKA 4L5FH 4QHMA 3F5WB 4UTAA 2WXLA 5C0IA 1TETH 2GPZA 4HEPG 4OJCA 5CEZE 1I1CA 4L0PB 3II2A 4LKXA 3V7AE 2BM3A 2HFTA 3RDJA 3TJHD 4PGJA 5D7KD 5KSAB 4P23D 4LNRB 1IVLA 5D7KE 4PWKA 1MIEL 4PGZA 3WFEL 4ZTOL 3P4NB 2APWA 3HTLX 4CUCA 2DPKA 3O6LH 1JGUL 4YLQT 5D1QD 3FRPA 3S48A 3P1VA 4FXGC 3IN0A 1R5VA 2WBJB 3IF1A 4ZO8A 1OHZA 3KW7A 5HHMB 5IMLA 4QGTA 3V4UH 1IE5A 3B9EA 4XXWA 4Y5YC 3Q5OA 4M03A 5F7DB 4CSPA 1YEFL 2A6DA 3F58H 4I18C 4FFWC 4LRNL 2OA9A 5T1LB 2IH1A 2R59A 2IJ0C 1QSZA 1JXDA 3BQUD 4H44C 4NZTL 3VGAC 3VM7A 4M6OL 5L9DL 2A7BA 1PX3A 4U1LB 3B2VH 4F7TB 4A7GF 4NT6B 5LXVA 2Z7UA 3O0RH 1KYOJ 5E08L 2NY6C 1SDDB 1AI1L 3QFJE 4K9JA 4H8UA 3CX2A 3OXRA 4TUJA 5FUZH 5IK3A 4BFBD 5JIDA 1CDHA 2H8PB 4HIEA 3R7RA 5E2TH 2AEOA 1F11B 4E0RB 1OT4A 3TM6A 3CC5A 3ARBC 5JIKA 2W60B 2OZ4L 4Y8DC 1JVKA 2EEXA 3I6KA 4NQVA 2XA3A 5C09A 5DR5H 1OW0A 2RQEA 4JFOA 2J25A 2H1PH 1NUFA 2MCPL 2H3XC 4OKVB 3PNWB 4WCYH 5AW6B 3KPSD 3CVBA 3FRPG 5B1AB 1SJEB 4R4BB 1P5UC 4LE8A 2P80D 1JWUA 5KOVC 4RBPK 4HDIB 3AT0A 4NCC1 1JF5A 3LKRA 4ZQKB 3LDBB 4QRAA 3MLYH 5AZEH 1G87A 2AGJL 4I5BB 5DD0H 2QGBA 3NUKA 4N0CD 5HGHB 2DIBA 4I9WD 1ETZB 5L7XL 7CGTA 1YEJL 3FHEA 4FABL 2IADA 4JFDA 1L9NA 1SMAA 2LLGA 4Z7WA 4FFVC 4M4PA 2FYVA 4TRPH 1JV5A 1S9VA 4EDXA 4HD5A 1AAJA 2UZIL 1U58B 2R15A 3L95A 4ZAKB 2PP7A 3UPRA 1DEDA 3CBKB 4OW6A 4YBQC 3K6SB 2CDGB 4JFFA 2A77L 1T0OA 2X7LB 4E68A 2BNUA 3D2UB 1ZKAA 2JKWA 4MB4A 4N8VA 3T8XA 1CZ8H 3HMXA 5DZLA 5JNYB 4FXGA 4HX1A 3VWJB 3O9WA 3SO3C 5EORL 4HS3B 3P4NA 3VB9A 5C0RH 3RX8A 5IIEB 2UY7A 4XVUC 1KB5H 4MMYB 2IALA 1QHOA 2L7QA 2ZSWB 4ALAC 4FA7B 3DV6B 1OHQA 1IV8A 4XAKE 3S3BB 4JRYB 5HDBE 3D06A 3BEVA 4L0YA 4WF7A 4UI2A 1TTBA 1J5IA 3JQOB 4IRSD 5I66A 1KPVB 3IETB 3LZLA 1UQSB 4WHTB 1M71A 1I8UA 1QFPA 1U8CB 3H9HB 3KXFA 3MLTA 2PKDA 3L08A 4CC0A 2PP8A 4B53A 3EZ8A 4KJWD 4YQXH 4X6CA 2FT6A 3QI9C 5HHNA 2CO6B 1MFCL 4YIQA 2Z35A 1QSED 4PJFF 1QMUA 4PJDB 4ZUTB 4YHLL 4RGMC 1KC5H 2VMDA 1C5BL 4YHYC 4YHOH 1TVDA 3WKPA 1XF5A 4TUOB 5HDLA 4NZDA 1OP4A 3O0LA 1UCBL 1YEHH 5J6GB 2VDLL 4D0DB 4JKNA 3VB8A 5KJRL 3LEVH 2M26A 4G3YH 3VXNB 4A38A 3HG1A 1JMXA 3TEWA 1OSZA 2XN9B 3CFBA 4PFEA 5DQDL 2NY3B 1QFHA 3IE4A 4KKLD 4PJGB 1KGCD 1VGEH 5F70A 1JERA 3FF8A 3I6GB 4OLYH 3N2JA 3LKPA 1RZJC 2JKTM 1YQVH 1NFDF 2ZXWB 3KPLA 4G7QB 4HFUH 3NCEB 5EF0A 1SHWA 2JCWA 4UDUB 4EI6A 4IRZH 5INCB 5D70H 1CLVA 4ZUWA 4MQ7B 2MPAL 2K45A 2Y6SD 2BX5A 3DUSB 4XCEA 1I9RH 5TJWK 2F8VA 1Q9LB 4ZQKA 1NIBA 4K73A 1PQZB 3FQTB 5DLMH 3V4VA 2OTUB 3PE9A 2CDEA 3FUFA 3T0EE 3T3MB 3NQIA 5K9JL 3UO1H 2R1YB 4IU2B 4OZGE 2DYPA 4I0PC 2AEQH 3W57A 3S4SB 2JWYA 3AGWA 5SV3A 2EXTA 1S9VB 1OD9A 1DQMH 4NM4H 1MY5A 1TZHA 3KPRD 5ICYA 2F8IA 3I9GL 1JCVA 3BQUB 2OQJB 1ORQB 5I8EA 4IS6B 5IBUB 5DMIH 3WKYA 4Q97A 4UTAL 5CCKH 4NAQA 4WEBH 3GD1C 3ASWA 1NWOA 2HPTA 1I75A 5IHHA 1D2OA 4XHQA 4KVCH 1ZTMA 4NKIL 3NN8A 4KH9A 1OT2A 4PLJD 2YOAA 3OVUB 5JNYA 3IDGA 3L6FB 4XNMA 1HXKA 1NAKH 4JB9H 4UT7H 4GO6B 2F1EA 3MRDA 4A6YA 5FOBA 2EUVA 1OQXA 1EO5A 1YEKH 3QDMD 4JFQB 4JUTA 2VH5L 4N9OB 3NSXA 5D7JD 3FTGA 3G04A 3GSQB 3T2LA 1IIKA 3HC3H 5EOTA 4DN4H 4RDQF 2MFNA 4XI5D 5L4IA 4NI3A 4UQ2B 3TXAA 5CEZL 4ELME 1A64A 4OZIA 3GPSA 3QGVA 4YAQA 4MJ5B 1G1KA 4NP4H 2EAEA 3QUZB 3HUJE 1SN0A 4GKLA 1BYNA 5D7LA 3AUVA 3L13A 3B7UX 4IMLB 2XI9A 3ILQC 3FULA 3UC2A 3D0LA 12E8L 3MA9L 4YDKL 2B0SL 3EJZC 1IFRA 1UJ3C 3S8FB 1TZOA 4YPGA 2WXNA 5F0PB 3WY1A 4YDKH 1G4MA 4P05A 3ZR6A 3OQ3B 4W70A 1YPZF 4L3ED 1W0VB 3PREA 1ULVA 3K3QA 4KTEL 2CBPA 4DGYL 2VDML 5DVKA 2JXMB 1DQLL 1IKNC 2CNYA 4R7VA 5BO0D 1XBRA 4WUUD 5CEZH 4F7KA 3HR6A 3TEYA 3R4RA 4O5LH 1KCSH 4NSKB 1ZA3A 5EH1A 1PX4A 1JMZA 4OLUH 4APQB 4IBVA 3B2UD 4WWKB 3EAKA 1MWAH 5DQ9B 5D2LA 4GUCA 2YJLA 4BQ6A 3FTXA 2WZ6A 4Y1SA 1A6TA 4XCFL 1F4WH 2J8HA 1GJIA 4HFWB 2NNRA 3FOLA 1I1YA 3FTWA 4MKTA 5IT2L 3ULUF 4ZOAA 1G7IA 1UM6H 4JNXA 1B0IA 2G5RA 3QE5A 1NDMB 4NBXB 4PJCB 5LN8A 1FJ1A 3Q1SH 3DUSA 4XCEB 1RCYA 2WB1A 2Z1PA 2R83A 3QORB 2MJWA 3QNXA 3SOTA 2AV7A 4LCWB 1NEPA 1MKFA 1NFDB 3V0GA 3ASNB 1WD9A 1MFAL 2CDFA 2JELL 4TXVB 1GGYA 3U0TB 1VCBC 3KEHA 1KJVA 3DX7A 4W9FC 2DBLL 3GBNL 3L9EA 4ZFFB 1JG9A 4ZMVA 1XTLA 2WV3A 3PXLA 3Q8FA 2X89D 3F12A 3DYOA 2WJ7A 3LYRA 4TNGA 4IGBD 2H26A 1C9SA 1WHPA 3N40P 1FE8L 1A1MB 1U3JA 3MRCB 3NSDA 4MMXC 4ORGA 3JV4A 4GMTL 2A9NL 5F1IB 4QHNA 3DOSB 4NQEB 5HHVL 1IE4A 4MJ4A 1CUOA 3WLWD 3KBFA 1XGTA 3CDZB 3VD0A 5I76A 2F6AA 5TFSL 1XGPB 3VM5A 3TBWB 5I28A 3U0WH 2D03L 4U1HB 2XY1A 1JYVA 3L6FA 4XNMB 3ESOA 3QZMA 4MJIA 4XWOC 5HVGB 2ZKHL 4J3OC 3UPAA 3PGCA 1I9JH 1OW0C 1BMZA 1YEIH 4FA8A 4BELD 5LQBH 2FX9H 2ZG3A 2R9HC 3OAZH 1XH3B 2W38A 4XCNA 1XSOA 3MRGA 1QABA 4GQPH 3GMNA 3V5DB 5FYJD 1NCWL 2FB4H 2W65A 5F7HA 1MREL 5I8OH 4JG5A 4YHLH 4BQBA 2GC4C 3KPQB 2N01B 2XV3A 5FS5A 1MFCH 2VIRB 2WUCH 3GZKA 5IMOA 2YOCA 4B9GA 1MCSA 2MIZA 2Y1AA 3DRTB 1NBCA 3LHAA 4W4OA 4XP6H 2WVUA 4S11A 1JPSL 2G2PA 4LSUH 3VXQA 2Z34A 3A6CL 2J1ZA 3RX7A 1HNYA 4QMEA 1WEJL 4QOKD 3WN6A 3GI9L 5GGSA 2ZAHA 2BHYA 2FIKB 1AP2A 3LZFH 4NBZB 4DKEL 1QFUL 3VFOB 3BIKB 1AO7D 4A37A 3AITA 1P7BA 2CIIA 3TURA 1KPRA 3KPOA 4LL4A 2V33A 1UJTA 3TO4B 1OLZA 1KFAL 3HC0A 3AS2A 4NJAH 5GZND 4GEIA 2DTML 1G6RH 3LN5A 3RBGA 1FHGA 3LS4L 4WU5B 4N90E 1USZA 3APMA 5LNEA 4F7CB 3WFCH 4DEPB 1RPUA 3DHPA 4ZFZB 4KVNH 1MRFL 4YSRA 5CILH 5TF1L 4NZUH 5JIMA 1IQDB 4RDBA 3RI5F 2QL1A 1Q9KA 4IRSB 2XG4B 2WWMD 2ZX6A 4RGNE 3CHOA 4P9ML 4QTIL 4BJLA 3D2UA 2DM3A 2DQGH 1X5LA 1CBVH 3UTPD 1KCUL 1ASPA 1P1ZB 4JVWA 4IJ3C 2PTUA 5EBLB 1PDKB 1Q72L 3AM8A 2A73B 4R83A 5FF6B 4OSUL 1R34A 3ZTJG 4DEWA 3BFOA 4F33A 5AZEL 2VDRH 5EG6C 5E23A 1ILUA 1A7NL 4OGYH 4K94L 5DC2A 4ZXBC 1LNUB 4WKXA 3EJJX 4BRVA 5IEHB 4WI5A 4PVNA 3ZKQD 3N0PB 5GJSH 1CQYA 4PG9B 2A9DA 5DZ9A 4HIXL 1A6WL 4HC1L 2WJ5A 5GGTH 3UG3A 3B9VA 3IB4A 3PLYA 5JR1H 2XZQL 2P28B 2J7LA 4AMWA 3KXFB 3MLTB 4FNQA 2R4RL 1SF3A 2OMWA 3RIAF 1XX9C 4EVNA 1IJ9A 1XH3A 3AABA 3V0HA 3ZKSD 5E94A 3LMJL 3D8MA 5LDSA 2NT1A 3UG4A 5A40E 4XBEL 3MODH 2PWEA 2XHNA 1AI1H 3UBXA 1TZIB 1YN6B 4Q6IC 4OCXL 2DQGL 3HE6B 4UUJB 1I3VA 2Y69B 1V27A 3WE1A 3HMXH 3TYGH 3LXAA 5GRUH 1G7PB 1MFUA 1CFMA 4R2GC 2ITDA 3QQ3B 5E1AB 4MXWL 1JBJA 1FNSH 1YNLL 3V4PA 1XGYH 3GLAA 4KQ4L 4L37B 4W4OC 2X70B 2UVFA 1EEYB 1YPZE 5DD3L 3QEQA 2QSCL 5LGYA 2KKQA 2CDGA 3CG8A 4JFFB 4M93C 3UC0L 2R2HA 3FQYA 3X11B 4JLRB 5DK0B 5E1HB 2Q8AH 2IWGA 2FT8A 2AZAA 2OXGA 2DWDA 1QSEB 3O81A 3E6FB 2BERA 4H20L 2EDTA 5HY9B 2K8MA 1KYFA 4Y5YA 4AX3A 2UY7B 1F90L 3KDMB 3RPIA 2OTUA 4WK4B 4Z0BH 5D4QA 4HIIA 2XSKA 4WLCA 2OJZL 4BWWA 1IGFL 1NCJA 1MXDA 2YPVH 4YHML 2IF7A 5FM5O 4KX8A 5AW5B 1MJJB 2ZOLB 1BP3B 5TE7H 3TJHC 4LPCA 1KPVA 3IETA 3OQRA 4U31A 1D2PA 1M71B 1U8CA 3BT2L 4ZO7A 4NQTA 4CAGA 5DURB 3TWCL 4HUXA 5HHPB 3HLAB 4FQXC 4GFTB 1U42A 5I8OL 1NGXB 2GI7A 1UD3A 2VZ1A 3H7LA 4NZ8A 4QNPF 3JWNH 4XBPB 4BXVA 4EXKA 4JM2A 3UZVA 2P5WD 3GEWB 4DTGH 3O6KH 4OUOA 5ITBL 4BHUA 1OF2B 1T6BX 4BZ2L 4KNUA 4LSSL 1XF5B 1CB4A 1TJIH 1MVFA 1C5DB 3BPCB 1I9JL 5ELIA 1I7UB 2OSLA 2ITEA 5GJTL 4XBGB 4JGNA 3T8VA 1JGEA 4ZAKD 4ZMPA 3LKSA 4F7PB 1O6VA 3DTXB 4HHAA 1HWHB 3G5XA 1QYGH 4PIBA 4EIUA 5C0GB 1A7RL 3O2VL 1NSNL 3QUZA 4RX4A 2DMKA 2LVCA 3BZ4B 2NUPB 4O58H 3JTSA 1JP5A 3ZKXB 4NS0A 4DQOL 2PR9A 3NTCH 3SYOA 1HE8A 3IWUA 5FDWA 4M4RB 4JG1L 1Q0EA 1BF8A 4YXKL 1A4BA 3QPQC 4K5NA 1WS7A 1RH8A 1JRHI 3FQTA 1FIGL 4UQAA 5HP5A 3WCYA 4KXDA 3NG5A 1I8MA 4DPCX 1ADQL 3NOIA 1B0RA 5K1JA 2UXTA 2IO5A 4KKAC 2I60L 2JIXD 3TOPA 1DN0A 4HK0B 4P57B 4H88H 1SLUA 2QPDB 1HC1A 1HAUA 5IB5B 3BQUA 4JN1H 5I8EB 4AVIA 3PWPE 4U1GC 5FW6A 4E41A 1OE3A 4FFZA 5F0JB 2W07A 1QACA 3LRHA 3X11A 1V3JA 1RZJH 1OVZA 3WTTA 1TJXA 1JPGB 3DO7B 2Y07L 5EO0A 5C8JB 3EGSB 2F7RA 1E6OL 1QWUA 43CAB 3VYNA 4GEJA 3NA4A 1OGSA 4RESB 4ZSOE 4MQXD 4F27A 3ARDA 3PGDB 5K39A 4RRPA 4YNYB 1OT1A 3KHOA 5LHDA 1D9KB 5JMRA 4ILDA 1PPIA 2G3MA 3HPLB 3L5JA 2GSGB 3MV8E 4P5TB 4PJBB 5ILTH 1DVFD 2WSDA 4QHLB 1WIOA 1QFWI 1OE1A 3WGUB 1GGBL 1I9IH 3MRCA 1O6TA 3D4ZA 4PJ7E 1KN2H 4QKXB 2FHFA 5CSZB 1X5YA 5H35B 3TVMA 2R8SL 4XAWL 1JK8A 2HT2C 4D8PA 1T89C 1QI5A 1RZKC 4EZKA 1TVBB 2XRAH 3TONA 1LDPH 2HG5A 4WIQA 2AJVL 5ADOH 1HOCA 2IANA 3EO1B 1OTSC 1AKJA 2ICCA 4PHXA 4WJG3 3LS5L 3P2BA 4KKAD 1FH5H 4LSQH 5FHAH 3GXFA 5HI5D 5TQ2H 4BCYA 5KBDA 1KFAH 2P48B 5BQ7A 3FN0L 4DP1X 3CXDH 4TQHA 2YZ1A 3CZLA 5K9KA 3VXPB 3RWCB 3CHXA 5KN5A 2YPLE 4AZ8B 1BGXL 5IWLC 1B9ZA 1RZQA 4JFFD 3CVCA 4PY7B 2UUDH 3IFLH 3A67H 5F3BA 3K4ZA 1VKXB 2NUPA 4GSXA 2X0VA 3T3PE 1ZJAA 3NFSL 3BMWA 3TA3A 2CUAA 2ZX7A 2YPKA 1KCBA 4HZ1A 3O6MH 1OP9A 1FC1A 5ITFA 4QOKE 5C6PB 2XY2A 4HQQL 5KWYC 4H2AA 4FXTA 1ZHNA 4GG6F 1IEBB 4MCZB 4Q4IA 4G6ML 1ID2A 1IAOB 1NFDA 5IVXE 2DLTA 1GHFL 5SWZB 3KM2A 2PWDA 2R7EA 3EOBA 1S7QB 1K4CA 1K4DA 3NZ8A 3HAEG 4UQBA 4OZIF 2QQLH 3CPLA 5C1MB 2IFGA 3S3DB 4DVBB 5F7NC 5FA4A 1IQWH 3S5LG 3KBHE 3QIUD 2AJ3B 4GQRA 4CVWA 4Y2OA 3HOGA 4JRYE 3K6IA 2MOVA 4H1LG 3BUYA 3B56A 4PJFA 5DRNA 3SKOB 1A8ZA 3FCTA 3HZKA 3ILPB 4X0KA 4OLYL 5I1GL 3SYCA 4HUKB 4JQXA 4XRCA 1ZY9A 2PR4L 5JORA 4LO9A 2R2CA 3RJQB 2WWKO 5TK4A 4HJEA 4MJIB 1MFEH 3ECVA 3TASA 1KTCA 2EDOA 2QJDA 5FW7A 2AXHA 3D9AL 3HI5H 3PGCB 3SE8L 3V52L 4HAGA 5EA0H 5I15L 3FB7B 3QDJD 3FTYA 3WUZA 3ELQA 3ZE2F 1QSFE 5E99L 1T89A 1M7UA 5B3SB 5DMGC 5F7FA 4PJAA 3LZOA 5L2KB 1BIHA 5CN3A 2P3YA 3IVKA 1EAPA 2ZX5A 3GBLA 4KQ3H 3THML 3QQDA 2A73A 4Y4HD 4F33B 4QWWC 3U9UA 3MV9D 3SQOL 1TKWA 1V7MH 2YD3A 3PDOB 1Q1JL 5CSZA 5FKPB 5H35A 3H7BA 3EGXA 2DRUA 3ARFA 3SO5A 5B38A 2V2TA 1QEWB 4D8PB 5F7MC 3FUMA 3BGMB 3ZOAA 2X53A 3PABA 4BFFA 2KI6A 4PG9A 2AXGB 3RBSA 4DPRA 2BIOA 3EJTA 4K94C 4YHYB 4MAYD 3UBHA 1BJ8A 3JSSA 2K0RA 5DQJB 5JZ7D 2V2XB 2Y36L 4ZYKA 4FTVE 2WBJD 1RQ5A 2XTJE 2YKLL 3EYFA 2DYPD 1BQHG 4KZEH 1X5KA 1XCTA 4XMKL 2F1AA 5C0BD 2DQMA 4Z7WF 4NLAA 2NY1C 4QY8B 2Q7AA 3FU5A 1KGUA 2Q9OA 4NKQB 3EBAA 1SM3L 5IVOA 1KJMA 3GSOA 4LLQA 7FABH 1KPRB 1SMDA 3HZ3A 1P7QA 1A4KA 3MJ9A 4LL9A 4Y9EA 1JK9B 1E9PB 4FQPA 4TNEA 4MB3A 5ID0A 1CDYA 4NUGH 2P5WB 4ZUSA 3VVWA 1KBWA 2CGZA 4KXAA 4MD0A 4FOMA 3AG4B 4MNGE 3SE4A 1X5AA 3LRSA 2WWOA 4X7TA 4Q89A 3ZGHA 3I85A 4RRPG 3VMNA 2NOYA 3N42F 5TDNA 4FABH 5MEOB 4Z3GA 3PQYB 1I53A 5B1BB 4DCQA 5CUSL 3QH3B 3QNZA 1BWWA 1DJGA 2ZIDA 1GY2A 4KX7A 4B60A 3EFDH 1IZKA 3VSVA 5ABDE 2OXGB 3ATAA 5FF6A 3M7OA 4LSPL 3AY4A 1S7UB 3BKJH 1QFWH 5HHME 4AQEA 1M9SA 3ML8A 2HLAB 4BKSC 3PU7A 3EH1A 2NCMA 4ZMYA 5E2VL 3TCXA 2R39A 3ZRFC 2DD8L 4K3EH 3G6DL 2R69H 4R4NC 3VUAA 1NLDH 3PYCA 2F8XC 1VEMA 2WVVA 3QHFH 3MGOA 4M00A 4H88L 4HWEL 4HXAH 4YDJB 3AREA 3NIFE 3V5KB 3RJDA 3I9GH 2E8YA 3EW3B 4B0MM 1N2RB 5E08H 4A55A 4RAUB 1PLGL 1DFBH 2BY2A 3FBQA 5EF3A 2E9JA 1ACYL 5EIIA 2RACA 1ZE3H 3MTRA 3GXNA 2YAHA 1UB6B 4OV5A 3UPCA 2BNQA 3EGXB 5GGVL 1WWAX 4M7KL 3RWIB 5I1CH 1CBJA 1IL1A 3X3FH 1NMAL 4OF8A 3QJHA 3WUWA 2QEJA 1WWBX 4X6DA 3CLEH