3S0PA

Copper-reconstituted tomato chloroplast superoxide dismutase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
153
structure length
124
Chain Sequence
b'TKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDAGGRLACGVVGLTPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
molecule tags Oxidoreductase
source organism Solanum lycopersicum
publication title Biophysical properties of Tomato Chloroplast SOD
rcsb
total genus 27
structure length 124
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3s0pA00
1FUNA 2XJKA 2AEOA 1U3NA 5CU9A 3KM2A 2AQQA 2WYZA 3GZQA 1B4TA 2GBVA 1BZOA 4OJAA 2ZKYA 2K4WA 3GZPA 2WZ0A 1IBHA 1IBBA 1CB4A 1UXMA 2ZKXA 3MKGA 1S4IA 1MFMA 4A7GF 1E9OA 2AQSA 1SDAB 3CQPA 3QQDB 4BCYA 3L9YA 1SDYA 1DSWA 1E9QB 1B4LA 1EQWA 2V0AA 3GQFA 2C9VA 1PU0A 3SODB 2XJLA 3RE0A 2AQRA 4B3EA 3ECWA 1P1VA 1SXAA 1Z9NA 1E9OB 2VR8A 2VR6A 3CQQA 1OAJA 1TO5A 1F18A 3HFFA 1HL5A 1KMGA 1PTZA 2WKOF 2WZ5A 1Z9PA 2Z7ZA 3GTTA 1F1GA 1OALA 3L9EA 1HL4A 4MCNA 4A7SA 1QUPA 1RK7A 1SXZA 3K91A 2Z7WA 2Z7UA 3QQDA 2E46A 4BCZA 1N18A 1TO4A 4FF9A 2SODB 1IB5A 5KBLA 2AQPA 1OEZW 4A7GA 3H2QA 4BD4A 1COBA 3F7LA 3MNDA 1ESOA 1XTMA 2E47A 3GTVA 2WYTA 1JK9A 1XTLA 1YAZA 2R27A 1SRDA 2WWOA 2APSA 3HOGA 1OZUA 1N19A 2Q2LA 3KM1A 2AQNA 2WWNA 4A7QA 2JCWA 5KBMA 1SXNA 1E9PB 1SXBA 2AQTA 1CBJA 3ECVA 4MCMA 3T5WA 1DO5A 1E9QA 2ZOWA 1JK9B 1YAIA 2GBTA 3F7KA 1IBDA 3GZOA 1SXCA 2GBUA 4OH2A 3KBEA 1E9PA 3CE1A 3H2PA 1YSOA 2VR7A 3KBFA 1BA9A 1AZVA 3ECUA 5KBKA 2AF2A 3S0PA 1F1DA 1OZTG 1IBFA 4N3TA 3PU7A 1SOSA 3KH3A 2ZKWA 1SXSA 3HW7A 4L05A 1JCVA 3LTVA 2JLPA 2Z7YA 2NNXA 1F1AA 2WKOA 1UXLA 4N3UA 1EJ8A 1PZSA 4A7VA 1Q0EA 1L3NA 2C9UA 2C9SA 4U4IA 4A7UA 4A7TA 2LU5A 1XSOA 3KH4A 1SPDA 2WZ6A
chains in the Genus database with same CATH superfamily
2XTSA 3SGDH 4KXZI 4CVZA 3OAWA 5CGTA 1S7TB 2WKGA 3CXHJ 4H1LA 5F70A 1WISA 1WFTA 4PJEF 1JGEB 2WD0A 1HDMA 1XAUA 4JLRB 1FFPB 4D8PB 4A6YL 5KVGH 4YFEA 3VXRD 3LKPA 3AMKA 2DWSA 4I1RA 4M3HA 4UM9D 4J39A 3UTTA 3ZKXB 1KCKA 3CH1B 2DLFL 5DC2A 1XGQB 4JRXA 1IBZA 1PG7H 1QHQA 4RDQG 1VFBB 4WI7A 3ROOB 1CFQB 3QUYD 4UT6L 2QR0B 1J7VR 5IB4A 4B95C 2NY3B 3CSPA 5I5IA 4R2GC 1ZDQA 1NPUA 5JPMC 1ZTXE 4ADJA 5LKNA 1CG9A 3T4YA 2JVUA 2X1XR 4TLTA 1L7TL 2PYEB 3BIKB 5LAXA 1XL4A 4XP1L 1XZWA 3UIYA 5TFSH 2CUHA 1M05A 4W9CC 2FECL 5AOZA 1V5JA 4KU1A 5CR1A 5E4OA 3VG9C 3C6LB 1JXFA 3P4NB 1YN6B 3AFLA 1RK7A 4UAOB 5FHBH 4HS8L 3VXPB 3F7VA 3S88L 1W9XA 2XA8L 1KJ2H 2EDXA 4ZS7L 3UTQB 1P5UA 2WLLB 1KJ3L 2PNDA 4Q0XH 1R3KA 3MV8D 5EZPA 2WZAA 3B56A 2KKQA 1TJGH 3FKUS 1FL6A 1E28B 1T0MB 4AIZB 1XR8B 4D0BB 5KZCD 4Z0BH 1C8PA 1OWWA 1B6DA 3T2PA 2OCFD 4IRJC 3ZE0F 1UH3A 3TEWA 2QELA 1FL3A 1OZUA 1YVLA 4LVEA 4OM1H 5HHQA 1T83A 3PWPE 1U3JA 1CLZL 2EE3A 4NQEB 1A21A 5KJRH 4ODBD 5E0QA 4W9FC 5A2BA 2VDOL 1G7PA 3K3QA 5DRNA 5H8DA 2EYTA 2XZQL 4LASH 5IG7B 4BFIB 1FSKB 3KLKA 4PWIA 4EPSA 3C5JA 3A24A 1R17A 3H55A 3M46A 1WPCA 4UAOC 1F90L 5FO7B 1SLVA 2CHDA 1U95A 4PRNA 2JK5A 3WN6A 1L3WA 1IBFA 5HHMB 2BVPB 3OAYK 3LPGA 2X28A 2MQGA 1AGEA 2FJHB 3OKNB 4GKOA 2X5PA 1MHPL 5KANG 4Z3TA 2DH2A 5JW5A 4P46A 1WV7T 1IKNA 3BD5A 1KCVH 5JPMB 3FW6A 4BCXA 3UJTL 5DHVB 1DVTA 2YKKA 1FWXA 4R2GD 3UTSA 2CIIB 4APQA 3L45A 5JDSB 4WNQB 5CU5A 2AQQA 5I1LA 1Q94B 3LPWA 1RU9L 1A0QL 2AERT 2YRPA 5BV7L 2NTFB 1XGTB 3ATBA 2NW2A 3VMPA 3MBXH 4P23B 2JSFA 2A9AA 1JS4A 3HE7B 1GHFL 2FD6H 3DTXB 3SPGA 1FFRA 3MRRA 1EXHA 3ZGIA 2IANE 4HD5A 1KYAA 4FQ1H 2GEQA 2Y07L 3TIDA 2HUEA 3CC5B 2B16A 4PJHA 3I02B 1KJMB 2VR9A 2YEVB 4G8FB 4L1SA 1RK0B 3QEGL 4QLWA 1U36A 4HIJB 3P77A 4YAQA 4M93C 4BDVA 3KPOB 4UT6H 3P4MA 1RURL 3FO0L 4J3OD 4JO3H 2DQMA 4M5YL 3BT2L 5DFTA 5GZOD 1U8LB 4LMQE 4A38A 4P23A 4OLYH 1CGWA 4GIPD 5EF2A 3RY5A 1G7LA 4MCNA 4JFFD 3GS0A 4YHYB 1BCIA 4D0CB 4Z78A 4PRIB 3BCFA 5I8KL 2AJSL 5T3ZH 3UZVA 4AIEA 2FL5A 1TO4A 2NSMA 4K7FB 3CZFB 1RLBA 4FERA 3WE6B 3FO1A 4DO4A 1E6OL 2CD0A 4Z7QF 2E9WA 3KD4A 4YSDA 4D7BA 5CEXB 3REWB 4MB4A 4OQ1A 4Z3EA 3ARRA 3DARA 1LO5A 1QLFB 1U3HA 1FVCB 1OSEA 3FB5B 3NPSC 1JTPA 2H9GB 1PX4A 2VLKE 3FHQA 1AS6A 3OKOA 4QRPA 1FNLA 2ROXA 2A9MH 1HOCA 3T8MA 2VLMD 3ESUF 4R4BB 1BVOA 3OJMB 3DV6A 3FULA 4P2OC 3EKCA 4KZEL 4M6NH 4K3GA 4XNZB 2AQTA 3T5WA 3KYNA 4HZAA 5CLWA 1TTUA 3UAJD 5JHDD 4PGCB 1ED3B 3JTBA 3OF6D 1K5NA 15C8H 2IAAC 1HC1A 3GBNH 3PPSA 1ZLSL 2DI8A 1A9VA 4C58B 3MV9D 3V95A 1U8KB 3ISWA 2FO1A 3BZ4B 3KBFA 3UPAA 2J6EL 2D7PA 2HG5B 2EJ1A 4MJ6A 2LABA 3RU8H 4ZT1A 4M8QB 3RNQB 5FUOL 4X99B 3K7UA 1D5ZA 1HQRA 1Q8MA 1DVFC 1PG7X 1G7JB 2BY0A 1J5DA 3NCJH 4XCFH 1ZLUH 1KB5L 4NXKA 4CL7A 3CIAA 4OCLC 4WHCA 5ALCL 1P5UB 4NJAH 3L3OC 5FA3B 1JG9A 4RGNE 2HT2D 3MRBB 3W39A 4B7LA 1OT1A 1VESA 2D3VA 4JPQA 1Y7VA 2PCFB 4G3YH 3L7EB 2GITB 4OSUL 3DMMC 2YQGA 3UTZB 5CEZH 3Q9PA 5LXGL 1TZIA 5F7UA 4U0RB 1R46A 1NIEA 4JZNA 4YX2L 5KSUB 1IBBA 2J88L 1IFHL 3DURA 5BRZD 1JZ2A 3LRGA 1WHPA 4YHKH 1S5IH 4BK8A 5DZPA 2VN5A 4AE1A 1ZPUA 3IMSA 2FRGP 3SPHA 1OAXH 2WXQA 1ZHBA 4QO1B 3NA9H 2WPGA 2XTLA 2OZNA 3LN9A 2NXYC 3FCUB 1HH9A 4JG1H 4XNAA 5DZ9A 4U4BA 1MFBL 1BG9A 4WO4A 1OF0A 2OZ4L 4L9LA 4DN3H 2FYVA 1I9JH 4AIZA 3EGDB 4I0PC 4TNFA 4F33A 2PKDA 2Z7ZA 1M4KA 1OKEA 5HYIA 2F0CA 4QY8B 1CL7L 2PPCA 4N0FB 43C9B 2WKLA 3QWRA 3V5DB 4HGMA 3QCVH 3JWDL 4LOUC 4GKLA 1T0MA 3HMXA 1CGSH 3L4XA 5KSAD 3EYOB 2XTJD 4AQOA 4PJXF 2OMZA 4NWUH 3U4EB 3NDYE 5BMFL 1OT4A 3DXAD 3VU1A 3PP3K 1TCRB 3O6KH 2ESVE 2YRZA 4EKJA 4LSQL 2OYKA 2EO1A 4M7LH 1TJIL 4PJGF 2FYYA 1LGVA 1KUMA 3HE7C 3VGEA 1EGJA 1VEPA 3MRNA 3O0RL 3V0DA 3F01A 4XWOD 3TGXA 3MOBH 2NY1B 5KYYA 2V8LA 3I3DA 9PCYA 1IAOB 4WF7A 1E3ZA 2R0WH 2R23A 2ZCHH 1YDPB 4GO8A 5D2NA 5IGXH 3ULUD 1YEJH 3IWVA 4N5EC 5TQ0L 43CAA 3IDMA 4G7RB 3CSFA 5JNYA 3PLYA 4H8HA 4GMTL 3T0EA 2K3TA 2CRYA 4PJBF 4DO5A 2F58L 2Q87A 2W5PA 1UZ6F 3LQAC 3ZL4H 4KBPA 1AKJB 4LIQE 1XCTA 5FGBA 4GKSB 2DQCL 3BDXA 3WIAA 1QFPA 1VA9A 2W81C 1AHWB 3JWOC 3P54A 4FLQA 1ID5I 2F18A 5A1AA 2G5BA 3MJGX 1Y6KR 4ODVH 4QXUH 3CIQA 4BFFA 5IJKC 1I9RL 2L0DA 1I7RA 4WQOA 3QR2A 3QUGA 2G60L 1YA5A 4O51A 1TVDA 1LO3H 3D69A 3MJ9H 4JE4B 3T0BA 2C9UA 2CK0H 5J56B 4WFGD 1ADQL 3BN9C 2GSGB 3OB8A 1F00I 1INQB 1IQDA 5E8NA 4TRPL 5J6GA 5ICXB 3MV9A 3EDEA 4N8VA 1A65A 2UY6A 3QFJB 5E1HB 1HHJB 3FT3B 3HZVB 4HUCA 2FX7L 1FDLH 3N9GL 3PAYA 4NQDA 1IIIA 2YAFA 3KCPA 4OR1A 1AHKA 3ZZQA 5HI4D 1Q4NX 5IK3B 1MFMA 3T4AC 2KQNA 3BVNA 3H0TA 5D7IB 1IBYA 1PL3A 4Y16A 3APMA 4LGRB 4P4RA 3HN5A 5C0BA 1NGPH 1GYWA 3RVVD 1UUNA 1B0RA 1QO3B 1BXXA 3BAYA 1CXLA 1PZ2A 2DTML 1LWJA 2P5EB 3BWUF 3NRPA 4H0GA 4NP9A 4MB5A 3RZCB 3WIIL 2NDGA 4HWZA 3RWFA 4A2EA 2WV3A 2H6OA 4DKAA 4OLWL 5T5FL 5KYWB 1Q0XL 1DBAH 4MD4B 5C7ZA 1J5OH 1WCQA 2Y06L 4MNQE 3D34A 3CFKB 4Z7OB 2JI2A 3L3GB 2FUTA 2FHCA 4TQPA 4CMMB 4WI5A 1WS8A 4FJZA 3BAKA 2BNRA 4MSWA 1QSVA 1IGTA 3FQNB 4ODWB 3C5ZD 2ZUWA 3O3DB 4HUXB 5KYXB 4OBRA 3S35L 4NQCA 3QIBB 5IW1B 1DUZB 4XBGB 3AADB 4PAZA 5BMFH 2AITA 1T7VA 3QPKA 2BNRD 2JQMA 3SDCB 4UOW0 1Q38A 3MNDA 4J4PA 2ZUYA 1TDQA 3OAZH 4F93B 2CO1A 4LLUA 3KLAA 3IKCA 4UMSA 3TS8A 1SLWA 2JQAA 2Q2LA 1RHFA 2AV1B 2H0JA 2WWNA 1AIFB 3MCLL 3V52H 4YSRA 4WI3A 4HLJA 3N1PC 4GPVA 5D71L 5GHWL 3V0EA 3KLSA 3RDTA 3PQYB 4PQXA 2WSPA 5TQ0H 5BW7C 1QZ1A 4ELKA 2ZF8A 4LPVA 3JTSB 3WFDL 2EDBA 2NYKA 4ZMLA 5INCA 4MJIB 5C0AB 3T3PE 1VACB 2YEQA 3O6FA 3QUMH 4LGSB 2J73A 4QTFA 3BO8A 3O4OB 1YJDC 5MEND 2F54A 3W3BA 4GQPH 5AKVA 3BZ5A 5GPRA 5FW8A 3I85A 4IDJH 5I2IA 1S7RB 1XBRA 1SXSA 2KS0A 2WNKA 4TTDC 1NCUA 4OZIA 2WXPA 3UTSB 3MXVL 3QDGD 1AE6H 1Y0LB 2ZWNA 4J1UA 2I9LA 1U95B 2ZIDA 1JXGA 2GFBB 1QAWA 3NH7H 3KGRA 4JJ5B 4PRID 4B5ZA 1E4KC 3INUL 4WFED 1UA7A 1WQVT 5GISH 3CSBA 3TIDB 2J57A 3SGKA 5AW7B 3L8QA 5D6DA 5FR3A 2GBVA 4FQCL 4GFXA 3TZVA 5JA9A 1N6QL 3KWWA 2X4NA 4IBLT 3CGTA 1A6ZA 3ZHDA 3U0WH 2IDCA 1QEWA 1CICD 5I1LB 1J8HE 3ZE2E 5EBWA 4PVNA 3UAJC 3IS0X 4X7SL 1ZIBA 1E4JA 2W65A 5E1IA 1IGYA 1GTNA 1CE6A 1EVUA 4Z7IA 3O45A 1KIPB 1N8OE 2JKIS 3ETBJ 3VD2A 3KYKL 3ZE1F 3EUDA 3IDIA 4WK2B 3VD5A 5EF3A 1OK0A 1SZNA 2HX8A 4MS6A 4R7LA 2A1WL 2AXHA 3DJ9A 1Q0YL 4JCMA 5CIPA 4P5MA 1NLDL 4MQXD 3O3BA 3SYAA 4XHQA 4D94A 5KS9F 2ZCLL 3S3CB 2HFFA 4KQ3H 3SDAC 4LEXL 1SJHA 3CVHA 4ZFZA 4YWGH 2ARWA 4YZFE 1ETZB 2P5WB 2RA1A 1CFNA 2AEIT 1KJ3H 3H3KA 2FHFA 5MHSE 4M03A 2XSKA 4Q2ZA 3BHBB 1NBZB 2A0LD 1CE6B 4K2UL 5A2FA 4GKSA 2K6YA 4F7EB 1MRCH 4EUPG 4LBEA 4Y19B 1COBA 3ZDYB 4JFPA 2VUYA 1C5CL 1IM3B 1ZTMA 3GINA 5AW8B 5GZOC 3B37A 1RAMA 5JHLA 2Z31A 4PJEB 4XP5L 1ZLUK 1DP0A 3MYJB 4IDJL 4LKXA 43CAB 4OUUB 4AVKA 3MFGB 5JIDA 2IMMA 5DRNB 3GBML 1OAKL 4QD2E 3PL6D 2XVLA 5ETUA 2ZWYA 4OUOA 3DECA 1SVBA 1IC4H 4N0UA 5F8RC 5C9JA 2XN9B 3PYCA 3DX6B 4PLNC 4HGWA 2E9JA 1PD6A 1G6RA 4PGZA 3LKOB 1AXIB 3TN0A 4IU2B 3D3VE 3LKSA 3QC6X 1YJDH 3A6BL 2Q3XA 2XWBA 3LHPL 2DEWX 3TYGH 2F6AA 2OJEA 4PV1C 4FYSA 1N0XH 5HHOA 2IPTL 5I8CB 3SO3B 1ZSDB 5DMJB 2E75C 3QCUL 5C08B 1KENL 2A99A 3NRFA 5FV2A 4NOBA 3UDWA 1QACA 4A7TA 2ORBH 3KH4A 4WVRA 4Q2ZB 5MENB 1XF4A 1V55B 4ZMZA 2G30A 4PJAA 2WBJB 5D2LA 2R2HA 4U6VH 4AUJA 1L9NA 2QSCH 4PVMA 4PJDF 1I8LC 2QFPA 5HHNA 1JRHH 4ZO6A 1U3YA 4LFHD 3HC3H 2L7EA 3TESA 4FP8L 5IB4B 4Y5VA 2Q3ZA 4YWGL 1Y1DA 5IFAH 1SMOA 4L4TE 3CLEH 5C0CD 4ZMXA 4IGBA 4Z6AT 2V0AA 5K9QI 4XMLL 3O3DA 5KYXA 3CSGA 5CFHA 2ZX5A 1CTOA 3VFWB 4PRDB 4HXBH 3KS0J 3B5HA 5D96C 3UAEA 2WNGA 3WKQA 4WI0B 3GXUB 4MCZB 1KB9J 3SOBL 4X6CF 3KDPB 1KIUB 1NGYB 3KYKH 3LN5B 5EUOA 3HAEA 1QHPA 3ZUNC 4X98A 3HTLX 1IC5H 2BNUB 4QWWC 3RB5A 4RISH 1W8OA 4HS6B 3E6FA 4U3CA 4Y4HB 4FEIA 4JL2A 1A6AA 2J88H 4YDVA 3UC2A 1EJOL 1OV8A 3DX7B 1NANH 1NC4A 1F1GA 5FKAA 4PBDA 3E8UL 1D9KC 1S8DA 2P46B 4P0DA 4TXVB 5DZLA 3ETSA 3VXUA 3RA7L 5DWUH 1XGUA 5AVUB 4XCEA 4DGWC 3K1DA 1GGBH 3ZOAA 2GVYA 3DWTA 4JJ5A 3M1BA 4MNGE 4LCCA 2KH2B 2WAQA 1UTDA 2HFEA 3ARWA 3LEYL 4JZJC 4KX8A 1J05A 4NGHL 5FGSA 4FQCH 1VADA 4IK7A 4B53A 2HRPL 2WXOA 5J8OA 1FH2A 2O6FA 2ZE0A 4HUWB 1OB1A 3UGEA 3K6SA 3AXLB 3MUGB 3SIKA 3V8CA 3HNSH 5EDXA 3SKOB 4L3CA 4HHGA 4Y2DD 3POHA 2IQAB 4R97C 4J2XA 1Y07A 1Q9KA 2FWOA 2VWEC 2CPUA 4UDTA 3T2NH 4ERSL 3TCLB 1ITCA 2E86A 4FL4B 3FU9A 4WU5A 2B1AH 5EN2A 1IC7L 4ELDA 1AIZA 1HHIB 2PR9A 1MIEH 2ZAIA 4XP4H 5E8PA 2BSRA 5I6XC 2W07A 3PS6A 4OLEA 1B0WA 3QO1A 2H32B 1FE8H 2GG1A 3LJ3A 4AG4L 1FYTE 3FT2A 2D31A 5LUMA 3ZTNH 4YFDB 3T65B 3WGUB 4OM0H 5JR1H 2NXZD 4LHJB 2DKSA 1OE2A 2EDFA 3PNWB 2KQMA 3LHPH 3W9DB 4AMWA 5DDHB 5IGXL 2VH5L 1GIGH 4PSRA 1XD1A 3BZ4A 2NY7L 4BINA 4PLJC 3RUGB 4H5SA 4PV8B 4G6KL 4HBQA 3V6OE 3QUMB 2Q6WA 1OL0A 2LU5A 5DRXB 3KPNA 3EF7A 3DTXA 3QNFA 4NAQA 5ITBL 3UP1A 3VGFA 1Z0MA 2BC4B 4KH2A 2KLSA 4G9FE 4UF7C 2WN2A 1I1RA 2EE0A 3CDGA 3FQXB 1PSKH 3Q5YA 3QXDA 5DC4B 3GNML 3ABMB 3E8UH 4MMZA 5FLVA 1NCNA 5IR1A 2ZKXA 1QPKA 3ARDB 1VSCA 3HB3D 4D3CH 1A8ZA 3EO0A 3T8VA 3B2UD 1WG3A 1E7UA 2DKUA 3P30L 4OD1L 4FHJA 2ZXQA 2QVFB 2VXSL 4N0RA 4X9YA 1KFGA 1F2QA 1UOLA 4QRUB 5KSBF 3MOQA 4U31A 4ODSL 5D6CB 1KBGL 5DF0A 3P4OB 4F15C 1CDYA 4Y8DC 4NC0B 2D8KA 2WXJA 4ZOEA 3TZVC 4DTGH 2WQUA 1N70A 1E5ZA 4L8CA 3OKEB 4XNXH 1JVKA 2QQKH 1GW6A 1XB6A 2VAAB 2HKAA 2QADC 3GNMH 2DJSA 4NFDA 2NX5A 3GBLA 4NKIH 4OBSA 3MV8A 2BMKA 4IGBD 3QIBC 4HD9A 5DD6A 3TF7C 2BNRE 1Y6MR 1KT2A 4Q6IC 2F5AL 3J7HA 3MTXA 2CRMA 1N5YH 2BJML 4O9HL 1RPUA 5BS0A 3LV3A 4I18C 2AQ1A 3F7LA 3CVIL 2ZOOA 4Q6YA 4QHMA 1XDTT 2ZUXA 2J44A 3GI8H 3PABA 4TMPA 5IHZA 4NHUB 5EOQH 5KSBE 1OLZA 2QQLL 2X4PB 3IJHA 1QZNA 3SGJA 5C70A 2OR9L 2CDEB 2OAAA 3TO4B 5E2TH 3ZHFA 4MCMA 2DBJA 4U1KB 2CLVB 4M48L 5AB2A 3AABA 3SSGA 5GRYA 1AGDB 2P44B 2ZCZA 4L0ZA 5BPPA 4PWGA 1ZJBA 5EZLA 1KJ2B 3I6LD 1FORL 4L0YA 1XF3B 5I2IB 4P4KD 4YBQC 5HHOB 1T2QL 4QRAA 3CZLA 4X5LA 1MAJA 4HS3B 5A16A 1RUQL 5IBUG 3U36B 5KTEL 4MVBD 2L7UA 2UY7B 3P02A 4CSPA 4F24A 2BXYA 3JVGA 3L1OL 2ITEA 3WY1A 2Y69B 3CSYB 1YQVL 4JRLA 4HAKA 5FO7A 2WXNA 1RZKC 3GXTA 4LLQA 4QRTA 3PXHA 3BP5A 5L2JA 2Y36H 2AXWA 1CZ8H 3LXUX 4JPWH 4QXVA 4U2ZA 3VX1A 2ODIA 4LEOA 4PJIE 1S7WB 4U49A 2AXJA 3DJZA 2R7EB 1QFUL 5JIHA 3P73B 1M9SA 4LLYB 4ENZA 5HSFA 1A6TB 2YPLB 3KJ4C 3MACH 1A7BA 1MVUA 3ZR6A 2RBLA 3ARTA 4P59H 2O30A 3O8XC 2XWTB 1NCTA 1PSKL 2OJZL 2X9YA 2ADYA 1ORSA 1AGFB 3EYSL 4YQXL 4AQAA 2BSTB 5T1KB 2AEQH 4L9LB 2EIDA 4EQ2A 4PW9A 4UNUA 3UERA 3L2NA 3NK4A 2Y36L 4HWUA 3IS1X 2CXKA 2CRIA 3UTPD 2VXSH 3GSXB 2VXVL 1NFIA 4JN1L 1LHZA 4P2OB 1HXYB 4K23H 5IROD 1B3JA 5GS1C 5KBPA 2B59B 4K3HA 1DJHA 4XNUH 1AQDB 3MCG1 4RMWA 2CCVA 2Z6FA 1QFWM 4ZMOA 4QXGL 3SKUD 1OALA 3VI3B 5AW5B 3MV01 3N41F 1KB5A 1BGXL 4P2RD 5B39B 3V5KB 1N18A 2PPFA 3ATFA 4KMTL 4NKIL 2C3VA 3VGBA 3QXTA 3MLPA 5DUBA 3ZQ9A 4YUEH 2AHIA 4ZG1A 5DO8A 3QDHA 1UH4A 2IWKA 4FQXD 4XBEL 1MHHA 3GC3A 1HSBA 1UCTA 3QNYA 5MERB 3SYCA 5AVVB 4NM4L 2EXWC 2C1PB 3FQNA 3CVIH 4LLDB 4XNUL 3CHRA 4LU5L 2M8XA 2X70B 5F89B 3QH3A 2PP8A 5EOQL 3K2UH 4YGVB 2W07B 5EOCJ 5B1KA 4N6QA 4QYAA 1BG1A 2JI3A 4UV7H 2IBGA 3D25A 1YEHH 3I02A 3O6LH 1YYMH 2VB5A 1T80A 2NR6C 4JFHD 4PJBE 4I4WB 1KXVC 1R75A 2HCZX 1C5DB 1YNKH 1AP2A 2XQYG 2EYRA 2MWCA 5A7EA 5F7EH 1B6UA 1JV2B 3HFML 3MODH 4G6AC 2EDMA 2P9RA 4OFDA 4TLUA 4XNXL 2R0ZH 3PWUA 1G1KA 2IBZX 4MQSB 4FFYH 1AQDA 4PS3A 1OAKH 3L48A 4FQLH 5I82A 5KSBA 3RWEA 4LP4A 3MXVH 1QI5A 3PP4H 4TQIA 3OGCB 3TF4A 7FABH 1QYGH 2ZD0A 1K5WA 1F4AA 2EKSB 1L5GB 3DJSA 5DXWA 1HYSC 3MGOA 4N68A 2WWMD 4FA6A 4Z7WF 3FO1B 5PCYA 1NAKL 1IVLA 3PWVA 4FTDA 1YY9C 4G83A 4XGZB 2KZBA 1T66D 3D2TA 4NJ9L 4U1GC 3QB7C 1YJDL 2CPCA 2FK9A 3NPZB 4DGIL 3L3KA 5F1IA 1LK2B 5G4OA 2UZXA 5JW4Q 5LO7A 4FG4A 3GM0A 2PXYA 2WUCL 1F97A 4PGDA 4MCYB 2A6KA 5C0EB 4WI0A 1JHLH 4JZOB 3FT1A 3KPQA 1QSFE 5E4EB 5IROC 4U1IB 4DNLA 5DS8A 4NQEA 3IFNL 4GRWH 3HI6L 4MLSA 3L3OA 1A6AB 1R3KB 1HTYA 3TFKC 2HMIC 4XPGH 4I2XA 1Z9NA 3PNRB 4MD4A 3BE1H 2GUOB 1WD8A 5D7KD 3ZDYE 4F7TB 2IOIA 4RIRB 2FATL 4UT7H 3RVWC 3VWKB 2AJUL 5HYJD 2K1MA 1OP4A 3HKZA 2WC7A 5CWSB 3IJYB 4KGJA 4E9XA 3QBTB 1LNUB 4V2CB 1CFSB 4AV5A 3LH8A 1XH2A 4KMQA 4KJWD 5SWSD 5I66B 1Z32X 3O6LL 1QNZL 2YD3A 4H7VA 1PX8A 2JKWA 5KJ4A 5BO0D 3VFTB 2NOYA 1FH5H 4YPGA 1J1OH 1OSPL 3PV7A 2XN9E 5DQ9B 3WMQA 3LSOB 4K9EL 4K71B 4APXB 4R7VA 3L3HB 4HCFA 3WI9A 3MGTB 3R8QA 3IJHB 1E27A 1TLMA 3VUAA 3P3RA 4XMKL 4KTEH 2XXMB 2PO6C 3IN2A 5JXED 1DJZA 5E0FA 4JFDB 3M8OH 5L6YL 2DL2A 1T6BX 1KPRB 4X0NA 3MA9L 3FU0A 3TXAA 5KVMC 2HLFD 5IQMA 3ABGA 3ZE2B 1ZLEA 4DZ8B 3SPIA 1RUAH 5DJZA 4QMEA 4M93B 5LNGA 1YEHL 5LBSA 2YAOA 2H2PC 3B83A 1HE7A 2VRAA 3CSYA 2GT9B 5CO1A 4XXWC 4U1LA 4A39A 2FIKB 1WWAX 4XX5A 5GRWA 3BPNB 4P2QE 4ZRGA 3G3LA 3ASOB 4MKMA 3S48A 3UMNA 3OKMB 1J86A 4L8SA 3QYNA 1O7DE 2XN9A 3TPUA 1HWHB 2OR8A 3BJ91 3FQUB 3NK3A 1BMZA 2WIIA 2XXGA 1KCSH 1UACH 3QEQB 3OR6B 4CKQA 2Q8BH 3IRZA 3C87A 1MHEA 4MJIA 5C0AA 3KEDA 3G7TA 1WFUA 2P5WE 2ZPKL 3UZQA 5J11B 1MAKA 1Z5YD 5SWQB 2ZX8A 4LSSL 3BUDA 4R96B 2CDGA 4XMVA 3IDMB 3P11L 1L7IL 2DMHA 2WLLA 1KGXA 5E00A 2FR4A 5C0CE 4WDIB 1HYRC 3O9WC 1HEHC 3CVHH 2AJYL 2DZEA 1TTGA 2CJ3A 3GSVA 5K9KA 2M2DA 1OB0A 5A6LA 1HAUA 3DSFL 3T8XA 4G5AA 1OGAD 4OVVA 4EN3A 2J8HA 3FL7A 1ZA3B 3OXRA 4N9GB 4RFEA 5FHBL 5DJ8B 3DYPA 4YSUA 3DPBA 1NJ9A 1A1NA 4DP7X 5GXBB 1KIQB 1CFMA 1NGZB 5T3XD 1NGQH 1VFAB 4MJIE 5C0AE 3T3PB 5J1TC 3D1MC 4JAMB 4DPAX 3RGVA 4FTVB 4R26L 1DN0B 1PLGH 1HHKB 2QLVB 1UEYA 3TFBA 2P7TB 4YXLL 4GI8A 5I19L 2A74B 1AXSB 1OM3L 4N2HA 3RFRA 4JM4L 1I82A 1QO3A 4AGOA 1AZBA 1PBYA 3IU4H 3L3DA 4R84A 1KLFA 1L5GA 4L2LA 1D2PA 1MELA 1IL1B 4HU2A 3S37X 5C2BL 2GABA 4NKMA 3HZYB 4JO8A 3EJSA 1MW1A 2YZ1A 2BP0A 4UUJB 2QVMA 5DQJB 4UDTB 2W0KA 3GB7B 4Y5YA 1Z9MA 3VG0L 1ESOA 1UJ3B 1W80A 2Z92B 3VFUB 3SQBA 2CBTA 2Q20A 5BNXD 5EZJA 1M1XB 2Q8BL 4MYPA 2Q86A 4NM8L 4APQD 3FBKA 5FKPB 2APSA 4I4WA 4OJEH 1JZDC 3W2DH 1WAAF 2Z35A 4XODA 4LPCA 4L2YA 3OKKA 2VM4A 3LKRB 4FYQA 5BZWA 3ROLA 3ZMEA 3ARSA 4KHTL 4TUUA 1JRHI 1A1NB 5DD0L 2AV1A 3PV6B 2FATH 5KEZA 1F4XH 1NOFA 4OM0L 1Z6JT 5EUKA 3IETB 1BSIA 4GG6A 2HN7A 4G7QB 3K81A 4ELKB 1KYOK 2VDMH 2GCYA 4U1SA 3IFOA 3V4VH 3DVNA 5T3ZD 2LFGA 2P24B 4KK6C 3S37H 3C12A 3MLTB 4G1MA 3RKDC 4OI9A 3UJJL 2FD6L 3T77A 4K8RH 1KCSL 3EOBA 5E1AA 3UO8B 2VZ3A 1RUPL 1UZ8A 1Q0EA 3UO1H 1MVYA 1TF4A 1W72H 2R0LL 5JYLA 5E4EC 3V5HB 2AANA 4XBPB 1VCAA 2HFGL 2P48B 2AEOA 1OAQL 3O11B 5I15L 2EDQA 2VDNH 3MV11 1CD0A 3DGGB 2WINB 3QO0A 4ODXA 1D9KD 1B4TA 4YXKL 3LVTA 5C3IA 4EZJA 5DA0B 2MPAL 3FPXA 1M1XA 1QHOA 1RV6X 3PXLA 1ZWIB 1SJMA 2V2WA 1GY2A 1B0GA 4DFHA 1HXMB 4BZYA 5FO9A 4QTIL 4Z77B 3HG1A 3O9WB 4FQIL 3ERXA 1BBDH 2VLRB 1W16A 2QEJA 3L17A 2EKJA 4YHLH 5FKAB 1KV7A 1N7ML 5D1QA 1R3JB 1M05B 2R0LH 4LASL 3DHPA 3AQZA 3QFDB 1DBJL 2K8MA 3UABA 4Q56A 2GJZA 3SGEI 2PETA 3WD5H 3RAJH 2W94A 3WTTA 3VFWA 3CNKA 2BK8A 1P7QD 4PLKC 1RULH 5JPNB 1HL4A 4WU7A 4G6ML 4Y1SA 5B7MA 3ULUF 4TPRL 4JQIA 3QQDA 1Y1UA 1HILB 3WUWB 4P3CL 3GM8A 1XR8A 2J72A 3MRFB 4UI2A 5AKTA 4QJ5B 2K4AA 2JIXA 1R3IH 2BNQD 4HBCH 2UY6B 2G2RB 1RZGB 4RGMC 4LSUL 5CM1A 3MREA 2X89D 1WBXA 1DSYA 2BM3A 3L3JA 8CGTA 4M4PA 4OLVL 4N26A 4KRNA 1KTLA 5IB5B 2NXYB 4Y1TA 1KJ2A 3VRJB 2XXFA 1BZ7B 4NM8H 4OV6F 4LBEB 4P4KA 4YSEA 4ONFH 3AS2A 1NINA 3AB0B 2GSIB 1B0IA 2GB2A 4OJYA 4WEMB 5GQBA 3MCKB 2KDYA 1DDTA 1E8YA 3TN0D 4J27A 5IJVA 3W38A 1JWMA 1TZHA 3A21A 1JWSB 4XC1L 4NDMA 4K7PH 2W59A 2OMWB 3AY4A 4TNEA 4X9IA 2LV4A 3B6SB 5FHAH 3VXTA 2YFNA 4OGAC 3C5XA 5E00B 1ZVNA 4G11A 3UTSD 4TUOA 2VR5A 4FZEH 3IDXH 5GS0C 4LLYA 1MJUH 1INEL 3QUXB 5EFIA 3F7RA 5T5NG 2W60A 3S7GA 3JWOH 4B9PA 5HHXH 3CX5J 4Z95H 5J9PA 1Q9WB 1FFOA 1BVKA 1S9VB 3FRUA 4V1DB 4ZTPH 3SY0A 4D8PA 3MRFA 4LSTL 4KX7A 4ZX4A 1ZSDA 4TUKH 2R39A 3MACL 2IG2L 3PDDA 3RWGB 5EPMB 3D0AA 4LLAA 3EGSB 1AR1D 4FNPA 3CH1A 3O2DH 1IM3A 4AH2B 4P9HL 1G4MA 3EO1B 2X4RB 3RIAK 1DQKA 5FECA 4A67A 2MIZA 4F1ZA 1QASA 4YSCA 2MPAH 2XDHA 4JFEE 3GKZA 4JFFA 4MWFA 5H37H 4BFOA 2A6JB 3I3BA 4LOFA 4K5LA 3H4HA 3R19A 1LO4H 4NIKB 4XO9A 5F1IB 3K71A 4TNVK 2AK1H 1ZHNB 2WGXA 2C9RA 2XG4A 5E7BA 1FFOB 1S9VA 4V1DA 3QK0A 2D3NA 5L88L 3RY6A 1BXAA 1HH6A 3IBEA 1TO5A 4LLVA 4NUGH 4S1SL 5L2KA 1AXTH 3HB3B 5BW7A 4IBWA 3HS0C 1IAKB 2Z92A 1UJ3A 4TLSA 4MDIB 2ZX6A 3WTSA 5C3LD 2EXTA 2F54B 3UOAB 4XZUB 1G7MB 2JB6B 1LE5A 2ARJA 2Y9RT 1KG0B 1BWWA 4J3SA 5KVGL 2ZXAA 2JELL 3NQKA 3DYOA 3BVWA 2YARA 3RNKB 4Z8FL 3G6AA 2VDRL 1W72B 4MA1B 3IAGC 1MHHB 4DP4X 4JCLA 1GJIA 1N8ZB 4GG6E 3LAFA 1DQMH 4ZPTA 3EW3B 1BVNT 4OZFB 2GY5A 5IW6B 3B9KD 4XI5C 3WN5C 3WNMA 2PO6D 2JCCB 5IFJB 2Y7SA 1R5WB 3NJGA 3UTZA 3WG7B 4HCRA 2VXQL 4L4TA 5F9DC 3WS3A 2QDWA 5DU7A 4LSUH 5DK0A 1PZ5A 1JNHB 4UYQA 2APWA 2W9DL 2BOLA 4LHUA 1SRDA 2X9XA 3K2UL 4U3SA 1RSYA 1RIHH 5H35B 2WOBA 1OGAB 1RMFL 4K7PX 3O0LA 1G87A 4LEEA 3H8NA 3X1FA 2EEAA 4HIEA 4Z8FH 3MNVA 5T1DH 2NNRA 4LLWA 4Z0XA 1BQLL 4RBPH 4XNBA 2GBTA 1P4IL 4FJYA 4NZTH 5GZNA 2V9TA 4HSQA 1A7NH 1FGVL 4I0PA 4JKPH 5AAMA 3X13B 2GC4C 3FUNA 5EIIB 3L9BA 4P46B 4WGWB 1ZE3C 3IGFA 3K74B 3HMWL 3L1FA 3QJHB 3X3GH 1YMHA 3G6DL 3FB7B 4C47A 4E41E 3PJSA 5T8IA 4XX1E 4V2BA 3WJLA 4LCUA 3UBXG 3S4SA 4L05A 1JAEA 5E6IA 1V3LA 2IQAA 3X11B 4TUJB 1TQUA 5EU4A 1IKOP 2PABA 1XGUB 4P3CH 4RVBA 1GOFA 2NDFA 3ISRA 5FW6A 1KY7A 1DQDL 3C5ZC 2PPEA 4HUUA 3T6VA 4Q4IA 5D7LD 3QG7H 4MMXB 3KYOA 3WXWL 1CFTA 5EIIA 1HXMA 3QAZC 3DETD 2VQ4A 1PIGA 4URKA 5IMKA 4L37B 1CVSC 4S1QL 5A3IC 2H3XC 3OZ9L 1P4BL 3BN3B 5I1GL 4I85A 4ODTH 2GIMA 3QXVA 4I87A 1CLYL 1QNIA 4G8IB 3GJEB 4JO2L 4ONHA 2YWZA 2B2XL 4N8CH 1XIWC 1X5HA 2XG5A 4OZHA 3ZTCC 3ME0B 2HAZA 3SCMA 5IB3A 4WNJA 4WLCA 5FFOA 3ZN6A 1XCTB 2IO5A 2ZTBA 3V0WL 3GXNA 4IEFA 2BLFA 3FAXA 1TQCB 2IPKB 4MJ2A 1KXTA 3NFNA 4W9HC 3WY4A 5AWNL 4Z5RB 1GGYA 1TEYA 4U1JB 8PAZA 3VD7A 4OIAA 2ZYHA 2A77H 5IQ7L 4YO0B 1IAOA 1IILE 3RTQD 1P0SE 1ZANL 1MW2A 2JKXA 3QAZB 4HW6A 1SXZA 4O02H 3VXSB 4BKSC 1BQHB 1T7WA 1Y18A 4K9EH 4MMXC 3MRNB 1T04B 1OP3H 2ZKHH 1ECYA 4NJAL 1JHKL 3BWUC 3OZKA 4PJCE 4PJAB 4ABUA 1I7ZA 2VABB 5HJ3A 3QXAA 4K4KA 5GS0D 4KKCC 4N2BA 4OF6A 4CN6A 3N06B 4R0LC 3U6RB 2EE2A 4M5YH 4OLZL 3O3AA 4FQ2H 5A6MA 5AKSA 1I3VA 1JVLA 3FHAA 1LP9F 4HQQL 2SEBA 3TP4A 3Q8AA 1T1XB 3AT9A 5J9PB 1T1YA 1BXUA 5F7MC 3QQ9C 2IGFL 3LIZH 4NQXA 4IMLB 5JORA 4MJHA 3B8SA 5J12C 4XVTL 5DMKB 3EGSA 2JFCA 5IOPA 3ULUC 3P0YH 5DJZB 4L4VB 3L4CA 1D5RA 4S1DC 4BSJA 3VD4A 4TOYH 5M94B 1GHFH 1OZTG 1BVLA 1KGWA 1XWVA 5ADOL 2UUDH 3RGVC 5KANI 5L4MA 3CFJA 2WVVB 3DUUA 3K6DA 5D4QA 5E4AA 5TF0A 4PJCF 1JPFA 4WTQA 1KBBA 3BUTA 1J8HB 1LO2L 3VTMA 1KYUA 4FQ2L 2IALB 2CCWA 2R29A 4B96A 3HRZA 3WTUA 4F8LA 3K46A 2PR4L 3B3IB 3UTOA 4HWBA 3BPLC 3IDGA 4ZYKA 1GMEA 4P57B 5KJ7E 3OAUH 5KSAC 4AV0A 2WZ6A 4NQXB 3SN6N 4JFXA 2IOOA 3EH1A 3HS9A 3H9ZA 1MOEA 4Z77A 4O2EA 3LYRA 5E9DB 3MX0A 4JN2B 4R0LA 5I1HH 5IQLA 2C8NA 2IDQA 4OZGE 3GHEL 3RU8L 1ZAGA 2XWBB 3L3IB 4Y88A 4MA7H 4K8RD 2N4IA 4FQHA 3Q8BA 2Y25A 3KR3L 2AQSA 1RUPH 5DZOA 1ZA6A 2IAMC 4OT1L 1TVHA 3QORC 4PG9A 4YLCA 3RUGE 4GRWB 3PQYA 3B3IA 5DD5H 2ENSA 3O6FC 4IOIB 2WTOA 5FYKE 5C0GA 4O58L 3CFIC 3UTTB 4Y19E 3PWNA 5D1XB 4KTYA 3V0WH 4YSAA 3CX2A 3NIGB 4BFJA 3FB6B 2EE6A 4LT7A 4QRSB 5KUMA 4XMPH 2WQSA 5IHHA 4M7KL 3TWCL 3ILDA 1EMTL 4TULL 4P2RA 5I23A 5ANMB 5HYJA 5DDHA 2DQEH 3QJZA 1DUZA 1A4KB 4GQ9L 4JPKL 2CLRB 3W82A 1CDBA 1TYRA 3IF1A 1BQSA 1E4KA 1YMME 2QQNL 4BFBD 4CILA 5AALA 1JF1B 1MCJA 1ILSA 1JGVH 2DEYX 1HI6B 1KJ2L 1TEGA 1IAIM 5CN3A 1ZT1A 5ESAB 2IV8A 4GLRH 1XCQB 4JHVA 4PY8J 1R33A 4IKLA 2YPLE 2NMSA 3RKDD 4PJ5B 1DBMH 3FB7A 4JPSA 4M61A 4JHAL 3S8GB 2R2BB 3NEOA 2H26A 1FO0B 3TYGL 4H8VA 5EU6A 3DMMB 2XWCA 4KHTH 2QADD 2WXRA 4O4YL 5J3HD 3BMWA 1UYWL 2ZICA 1E40A 4M00A 1ACCA 1FNHA 4C57C 1PLAA 5CKAA 1KEGH 3N5AA 3BVTA 5I9QB 3KDMB 5GJTH 2R9HD 3MRPB 5D7JD 1GR7A 1A7QL 4QHPA 1Z3GL 3FTXA 3VXNA 1PG7W 5D6DC 4Z5RA 4XP9H 1ID2A 1IAII 2OMTB 2QV2A 4DW2H 5D8JL 2BP5M 4WO0A 3EBHA 3KR3H 1SOSA 4WEUD 4WWKD 2Y0SA 5JUEH 2Y7NA 1GS6X 2YXVA 1J8HD 1E30A 2AJXH 3H42H 5LGJB 3OMIB 4HSAC 1XGTA 4YE4H 5HDRA 4EI5A 2Z64C 5KVEH 4N1CA 1M2OA 3BZEA 3UMTA 2YEZA 4MAYD 4Q9RH 1ASQA 5KYUA 1IAMA 4UINH 1U33A 4EMZA 4EN3B 4PJ5E 4RGND 4KKLC 1KGCE 3EJCA 4HEME 4KDVA 4M9OA 4H8WH 4X7FC 5C09A 3ZTJH 1I8KB 1FPTL 2C7UA 3MLXL 2DQEL 1MW0A 1MSPA 2A73A 5JO5B 3IN0A 3BQUB 2H26B 1LEGA 1OCCB 1I8AA 1HS6A 5INDA 4LLVB 3TBVB 3EBGA 1PYWB 3KHOA 5JZ7D 1IEAA 1PKQB 3RZCA 2LU3A 3QORB 4FRWA 4MA3B 1PY0A 3WKPA 1J0YA 3G5XA 2IXQB 2XJLA 3LB6C 3OLDA 4KJPC 1SXAA 3O2DL 1JJUA 2MHAA 4BSVB 1W72A 4AKOA 2ZP8A 3IK2A 1F41A 5ELIA 4HH9A 3BT2H 1BVLB 1QOKA 1ZHNA 3O4OC 3FUFA 3U1SH 3FSVA 1KGYE 1I8UA 5LXVA 4M7KH 5TF1L 2J8UB 3WIHL 4R7NB 3AY4C 5G5DA 1MJJB 2YUZA 4LLQB 3GMMB 2ZWLT 4NZRH 4MTMA 4OCRL 5EEVA 1D5XB 3UG5A 1CDCA 1MLCA 3WUZA 3CN4A 2WY3B 3QHZL 5FK9A 1PZCA 2VWEE 2VDPL 4J3OF 1M6OB 2QMKA 4JFSA 2XXCB 4HMCA 3LNFA 3MBXL 2A6IB 3GWJA 3ARVA 4FCAA 4OV5B 1H6TA 1I9RH 4XH2A 4U1MA 2FJFA 4UTCA 3ZT6A 5KSVA 4FS0A 4N6RB 3CMGA 1F6LL 3RFZC 1CMOA 2B5IB 2PYFB 4EDWH 2R1XA 5CN1A 1JGLL 2CGRL 1J9TA 1ASPA 5GGUB 2H2PD 3WFDH 1NFAA 3B6SA 3PGCB 2ICEB 4AGLA 4A2HA 1KEGL 4YNYB 3QULA 3U7AA 2YGNA 4FTVE 4PRHA 4PJFB 2RHEA 4R0LB 3TCXA 5GS1A 3O6FD 1GKEA 3MTRA 3NJJA 4NHUA 5MENA 2HJLA 1GCYA 1UC6A 4HMDA 5DEFB 3KMDA 4UT9H 5T1DL 2FZ3A 3VSUA 3S97C 3WCYA 3P3SA 4QT5A 1F42A 3HBQA 4HHAB 4QHNA 1FGVH 2N3JA 1MCIA 1HVXA 4B9JA 3EFOA 3H9SE 2Q7YB 4A2MA 4AZ8B 4G8IA 4JFQA 3WN5A 1CD8A 1RURH 2FLRT 4GSRA 2WYZA 4JO3L 3GSQB 4G7YH 2HJKA 1SEBB 5T5FH 4H8WL 1S78D 2N01B 2WXKA 4DKEH 2FWLB 4OLUH 3FUJA 3M17A 5FEBA 1AYRA 1E9OA 3KYOB 3HNVH 4HKZA 2VLLA 4BCYA 4UDUA 3L9YA 1WWCA 1PGRB 5G4NA 2RMNA 1PDKA 3UYPA 4EUPB 1AY1H 2EUVA 1MDTA 3QVAA 4FEMA 2UX7A 4XXDB 2D73A 3CPUA 3RPKA 3RYMA 4B3EA 4E5XB 3L4YA 1EHLL 2NY4D 3HJ0A 4KI5E 1JFQH 3JV4B 1PQZA 4RQQB 1CXHA 3K72A 3P3YA 4KO5A 3H6AA 4HUWA 3RWJB 4PRHB 3S2AA 3EZ8A 3T08A 4OKVB 2EH8L 5BRPA 5KSBB 4X7EC 4AYGA 3UGXA 5C0CA 5ID0A 1NBZA 2FX9H 5DUPH 5ENWB 3GSUA 3WFHA 3UPRA 4UT6A 3F04A 1HSAB 4GBXC 4HGKC 3ULUE 1CD1B 4DGVH 4AMKL 3C5ZB 2CAKA 3OAZK 5E99H 4ZFQA 1H3GA 3GK8L 1B4RA 1IGMH 3QDJE 3CZSA 5J6SA 4G3YL 2ADFL 4PV9A 4BUGA 3SQOH 3LQZB 5DMIL 2X3AA 3IKCB 2DQUH 3O2VH 5L2KE 3OKLB 4HKJB 4BM7A 2BSDA 4AT6B 3WGVB 4HALA 4MXWL 4JQXA 4LSQH 4TSBH 2JXMA 5IJBC 3P69A 5FM4A 3E9TA 2IH8A 4P9HC 4OW6A 3SPCA 4F9LA 2WYTA 4FC3E 4ACPA 3FUDA 3QA3A 1F0LA 3HC2A 4NQCB 3WIHA 4I88A 2EVIA 2GTZB 5LBGA 3VI3E 4BSWB 2K9UA 1U9KA 4FLRA 4XN5A 4IIZA 5T3ZL 1RPQA 3BUYA 2JE8A 3ZL2A 3U0TA 4B9FA 3MRGB 3WEOA 4JY6B 4QXTB 1SJEA 1U8CB 5LN4A 3ELAT 2V5SA 4HIIA 1GSKA 3S2CA 4MNQA 1PIFA 3FUEA 2ZG1A 3DROA 1JCKA 1FVCA 4LARH 4ANWA 1YEGH 5C09E 1AH1A 1N0XL 3X13A 1GGCH 3F00A 1UOWA 1LEKA 2ZCKL 3BPOB 4M6OL 1V8HA 4EI0A 1JZ6A 4GRMA 3IETA 5KJRL 3NCCB 4M1CC 1HHJA 1DANT 4N3UA 3MJ7A 3ARBC 2XQBL 2X4SA 4N2OA 3A4EA 3SE8H 1RVFL 4ORGB 5GSRB 2W0FA 1FVEA 4OTXL 5FUZL 1Z9OA 3N2JA 2A73B 2DPKA 2ZUQC 3RZWA 5CEXA 5E23A 5CAYB 2KHAA 4BUHA 2YGOA 1I1FA 3SKJL 2YPVL 1JPGA 3I6SA 3NJMA 4PW4A 2VDQB 4WW2F 2IH3A 3LRMA 1OCRB 5F72S 1YEDB 2ZXEB 4X9FA 4TV3A 5J12B 2WNWA 4Q9QH 6PAZA 4N8PA 3V4VB 1NBQA 5HD8C 3H3BC 5FGCE 5FM5O 3RIFK 3HAEB 3MGAA 4ODUA 2OTUA 3NIGF 1Q9OA 3FB6A 4ES9A 1B4LA 5CZKA 1J9SA 1UZ8B 3LX9A 2X2IA 3CFDA 2CMRL 1AGCA 1DVFB 4N22A 2IH1A 4L3EE 2BP8B 3T0XA 4F7KA 3AQXA 2WZ5A 1TJIH 4HIXL 4OD2B 5TGBA 3OQRA 4PRPB 1CLCA 5T5FA 2YPVH 1X5LA 1YEIH 2E5EA 2FX8H 4M62L 1AHWC 3ZIYA 1CGTA 4P07A 2UXFA 2F5BL 4NBZB 3ES6A 2VXTL 1YC8A 2K0RA 2VQUA 4U1GB 1XCQA 2O5ZH 3O6ML 4OJDH 4Q9CA 1CYXA 4L3AA 5I1EL 2X89A 1CC3A 4A2DA 2XV3A 5E2VL 4U1MB 5KSVB 3IVKB 2F58H 4JY5H 1EDQA 4OCYL 4H0HB 2BCKB 4G7SB 4RGOL 2X41A 4UM8B 4XR8C 5HDLA 1G7HB 3OQ3B 4BKTC 2NY1C 4OIIL 3IPEA 1XTMA 4JREC 1YYLL 2E47A 1TJXA 3KXFE 2NX5D 1WIPA 5J06A 2X6VA 4F8NA 2WVUA 3Q6GL 4LSPH 4B6ZA 1RZGA 1YECL 2BDNL 5E6ID 5I8KH 5IREA 7PAZA 5F88B 2XQBH 2VZTA 4LCWA 3LKOA 4E5XG 2AEQL 4MAUL 1U8HA 2ZOWA 4L4VA 5L9DH 1KXQE 3PJLA 3S3SA 3TJEH 2IAMA 3TASA 4PVLA 1MCDA 4NLHA 3T1WA 12E8H 4ODHH 3LEXA 1AFVH 2NCEA 3LRSB 1EJFA 3FO2B 3G04B 3GSQA 4G9FA 1KACB 2BIHA 1URIA 2FO4B 1T1YB 1FL6B 4HKBB 4U6YB 4HJSA 4RGOH 2HRPH 4NENA 3K2MC 4B0MB 4DTGL 1Q0XH 2MTPA 3LD8C 4RA3A 3HW7A 4PCTA 4X8GA 4QY8A 5GRVL 1SEQL 5C6PB 4S0HA 4LESA 5I0YA 4OI7A 3SDXE 4A7VA 3RVWD 5DJ8A 4LCWB 1NSNL 3VXQA 4HDIA 1XSOA 4G7VL 2G0LA 3D4CA 4PV9B 3WHE1 2O6PA 3QG6B 3QI9A 3ZO9A 3TFKD 1AR1C 1RU9H 2G0KA 3FK3A 2WNXA 4Z76A 5BV7H 3CDZA 3FU6A 4NCC2 4YMPA 2CKBL 3BE1L 3FONA 2DLTA 2F61A 4UM8A 5ILTH 2OI9C 3EOTL 3OKDA 1FLTX 5ID0B 1EA9C 2VZOA 4JFDA 3KGSA 2VTFA 5ERWB 4JRWA 1WCBB 2Y22A 2DL9A 4GP5B 1PNDA 1UA3A 3ISYA 4RMQA 3BPNC 2WXHA 2VMFA 4OGQC 5T33L 1YMMB 4OD1H 2MQCA 1O6VA 3RHWK 1VEOA 1N68A 2YSSB 3IXAB 1WDAA 4YIQA 1FIEA 1IMHC 4DPRA 1YY9D 3L5WA 1GC1H 4NO5A 2E9GA 4LVHC 4ADIA 4NNYA 1SBBA 5EBWB 4UM9B 3UL4A 2MH4A 3QWQB 2XG5B 3T6XA 4Y4FA 4L8SB 3SKNB 5JLZB 5BUPA 3TT1H 3LIZA 2BIIA 1ZLWH 5CCHE 2NQDA 1D5ZB 1HQRB 4B9YA 2ZOKA 5TK4A 2OK0L 4UIMA 1J5CA 4C56E 4OV5A 1PKQE 1G1OA 1V05A 2CALA 3BAJA 1R3LA 2EO9A 3STZA 3DHMA 4ONGL 1MFAH 5FGRA 4OCWL 4J7RA 4MDRA 4IRJB 1IJ9A 2CNYA 2WINA 4OCYH 1JPGB 2H1LM 4IOFC 4PBVC 3HE6B 4R5XA 3U0WL 4DVRH 1LL1A 4JZNB 1K3IA 5E8PB 4PMEA 3ALPA 3H9SA 4D2NA 4NHCL 4ZO7A 4OCRH 3VE0A 3B7UX 3MYZA 5BVJA 1IZKA 2J43A 4PRIA 1E9QA 2CLZB 1FORH 2Y2YA 3O6KL 2WQ8A 2IC2A 1BF5A 2AJVH 1KPUB 1X7TA 4WWKA 3QJXA 5DYOA 1RUQH 4RSYA 4CSZA 4ZQKB 3SYOA 1JNJA 1A5FH 1F6AA 2LTQB 5A3ID 4FFVC 4LKCA 3TONA 1FGNH 3IKKA 2NXYD 3ESVF 3UBXA 1OVZA 2VR3A 2A83B 5HVWA 2B1OA 3CFEA 1N6VA 4JM2D 4JK0D 3CTTA 2D7OA 3KVDD 4LNRA 3ULSA 1M57B 3KLAB 3QO1B 4XVJH 4JO1L 5ABDE 1H6FA 4I18B 4D0DB 5DVPA 3N41B 4YLQT 4C56B 4B3VA 4TVPL 3DIVA 1D5IL 3MRCA 4M1DL 1EIBA 5E2VH 4NUJA 1ES0B 1K5NB 4R5TA 4RZCB 1NOLA 1R5WA 1EAPA 1NBVH 5MEPB 5AZEL 4MCYA 2AI0H 3QZPA 4GQZA 5EU4B 4IYKA 1SBSH 2A9BA 2F7IA 3GZKA 1U92A 4IHOA 3ZRSA 4B5EA 1A5FL 4DPBX 3CHOA 4ODVL 5CMAB 1VPOH 4KK5D 1VF5C 2ZG2A 4AX3A 2AEPH 3BGMB 5MI0B 2WZ0A 4MMXA 4WHTA 1BF8A 3SGJC 2ZUVA 4PRDA 1H8SA 1ND0B 4KO9A 4X50A 4DP0X 2R4SH 2ALWA 1IC4L 3K72B 1HZKA 4GLRI 4JR9L 1TXKA 3BH8B 3CLEL 1CO1A 3SODB 5HYSA 1EZVX 4JO4H 2QPUA 3U9WA 1FG9C 4XMLH 4ZUUB 3UPRB 4K23L 5IEKB 1S8DB 2BSTA 2NZ1A 3HFFA 4FLOA 2NT0A 3W9EA 4MHHI 4CU7A 2OMVA 4XOCA 2OMUB 3FXIC 1KB5B 2HUHA 3FHEA 3OJDB 3LD8B 3HZKA 1DJXA 1U30A 3I50H 4JFWA 3US9A 4KMLB 5EOTA 5SV4A 4ZJ9A 4MCZA 4DEPB 2V5RA 1X7QA 4YQXH 3D0VB 3NCYP 3P4LA 3ZO0A 4BCZA 3BKYL 4NWUL 3H9YA 4P5RA 3V0GA 1NLBL 2EQDA 1E42A 5GGSY 3SY6A 4LCIH 3LZLA 4FNSA 3RX5A 4H8PA 5IFHH 3S8WA 3C8DA 4PTUA 1QW8A 3IXTA 2HKHL 3B2VH 5T3XL 3D39E 5IB2A 1JXKA 4UT9A 3RI5K 1JNLH 3CWGA 3ZRFC 1SF5A 4KWUA 5JQ6H 4BZ2H 1MI5D 3T8XB 4M8UA 4GXUN 3DX4A 3IU3A 5I8OH 3D0LB 1PG7L 2CA4A 5CP7A 1BQHA 1BVKB 3HHSB 2EH7H 5CXPA 1WIUA 2Z0UA 5I6OA 5KS9A 3BP7B 4FFWD 4JFOB 4LPTA 3GMQB 3QDGA 3DMMA 2NTFA 1HL8A 1MG3C 5KW9H 4PJ7E 1KXTB 3DPDA 5SWQA 2D9CA 3AW5A 1MPAL 5FECB 1JGDA 1U8MA 2XZZA 5DURD 4A2GA 2NNCA 1UURA 4HGWB 4X5WA 1FFNB 3IPBA 3W0WA 5IEHB 4AENA 1G6RH 2DQFA 1RUML 5GIRA 1KEMH 1HX0A 1P6WA 1IT9H 3TZVD 5EU5A 2A0LC 4QAWA 2RIKA 4YH6A 2HJKB 2J7LA 4CAGA 2OMZB 4Y4FC 5IQNA 4ZMWA 3LKPB 3H2WA 4NBYB 4F2FA 2HVJB 1AGFA 5AZ2H 3NIFB 4LARL 1QLRA 5DMYA 4KVCL 2X87A 4XO3A 4EF3A 5HHPB 1PY9A 2K8QA 3SKNA 2DIAA 4LRIC 1QBLH 3B2UC 3A4DA 5F96L 3EADA 3DRQB 3TA3C 5C92A 4E5XA 4H2CA 4RZKA 3MA9H 2XTJE 4KMTH 7TAAA 2SEBB 1DSWA 2O1AA 4L9DA 1Q9LB 3QIUA 4RGNC 3Q3GA 5K93A 4J3UA 5I1AB 1P5VA 4I77L 2J8UA 3HRPA 1VEMA 3O81A 1FV1B 2F7RA 3P4NA 1PYWA 3JV6A 2LLNA 1UT2A 2NX5B 2P26A 5I17B 2RJMA 1NCDL 5AAMC 3CLFH 3VFTA 3MV7A 3QDJD 1TVBB 4IJ3B 1GIGL 3LZOA 3PHQB 3ILEA 1C1EL 1JF5A 3FTSA 3K4AA 3WYRA 5EN3A 2WGNB 2DQFB 3DSNA 1TEFA 1Q1JL 3VWKA 4GAGH 1XF2B 1AS8A 1BEXA 5B3NA 4P57A 5D7JC 2XA3A 3H9HB 3CMOH 3TM6A 2R9HC 1OGSA 1JERA 1L7IH 1SFHA 5F9AC 4TL5A 3U2SB 4FQJH 4QRRD 1IC5L 5IVNA 2YPKA 2F7QA 4FNRA 1A3RL 4MXVF 4YGAB 3O3UN 4BRJA 5J3HC 1PEWA 3R4RA 1NCWH 2BWDA 1ED3A 2V3DA 1L9SA 2ZX7A 5FHAL 4FOMA 2PTTA 2UWEE 1NFDF 3HC4H 1FNEA 4CBZA 3G5VB 4YHIB 3QUKA 2F1BA 4XMXA 3EYVB 3AUVA 1BDYA 3VQ2C 3QS2A 2XICA 3M45A 4QTIH 2EIJB 2WP3O 3L7FB 1U2HA 2ICWI 3F6JA 4Y2LA 3FO0H 4FG6C 4ODWA 1OW0A 5CSZA 1N4XH 3FTGA 2GJZB 2R69L 5HGHA 3SDCA 4DEWA 3QCTL 1BQRA 1OB1B 3D48R 1C5DA 5C0BE 3L1OH 2VIRB 3QDAA 1X7QB 3T4AA 3ARFA 2COVD 1ZHLA 2WJ7A 5D7IE 4OVUA 2BVOA 3RQ3A 4BGLA 1FFTB 4LQFH 4HIQA 1CFVL 5HI3D 1IE4A 3VXUD 4M8VA 1RFDH 2VDKH 5D1QC 4QOKB 5F7KC 1S46A 2BOBB 1ND0A 4S1RL 1WAAE 3TJHC 4KOBA 1J9CT 4JM2C 3UTPE 2PO6A 1HT6A 3LEVL 1N6QH 1J8SA 1BZOA 4JM2F 2JKLA 5JHDA 1C1EH 3BH8A 1J87A 1XXDC 2BVYA 4L3CB 1SEQH 4NKDB 1OF2A 3GJFK 5C0FB 4IS6A 3VQLA 1CURA 3CHQA 3P73A 4JJHA 3OJVC 1GAFH 1QRND 4EOWL 4DJMA 2EIZB 3ZMNA 3Q8CA 4WWPA 2QLYA 3ZHKA 2IIJA 4BFGA 1SFDA 3AU0A 4PV8A 2CJSA 5CEYA 3E7JA 4NRXB 5IOKA 2ZXWB 2KMWA 3ECWA 2HJFB 2J1WA 3S35X 4X6CE 4APQC 4OB5L 1MLBA 4FL4C 2DAVA 1E67A 1NGXA 3TVMB 3V5KA 1BAWA 4U1HB 4XMTA 1DBBH 1F13A 4YJZL 1SYSA 5F3HA 2XC8A 3BEWB 5D93B 3EOYG 1MWAB 4KY2A 3S3JA 1J9QA 4JAMA 5I9QC 2HP4A 2BNQA 2LGNA 4NZFA 4QOKD 2FH8A 4W4NA 1TFPA 1GGIL 3D9AL 3HG5A 4AY0A 5DZNA 4B60A 3IM1A 3QQ4B 5HGBA 3RHWF 4HUUB 3UH8A 1IB5A 4A63A 4JY5L 4MDJB 4QOKE 4XN1A 1C7SA 2ZOLA 2A6DA 4LL9A 4ELMB 3IFPB 4AITA 2QKIA 2JV6A 1OO2A 2OI9B 4FHKA 3SDAB 1CXFA 2R23B 5E9DA 3VB8A 4RSVA 1CDHA 1EZVY 2N7SA 1UACL 2AGJH 3DUUB 4M43L 2DRUA 5E6ZA 1R5VB 2BP0B 3PL6C 5EHFA 3NBNA 2PCPA 3L1EA 2QQQA 4IOSD 3AWEA 4YLBA 4AEEA 1A4BA 1QLFA 1U3HB 1B2YA 3FQRB 4UWQB 5E6SB 4ZYKB 1U41A 1XT5A 2R29L 2NNAB 1N0LA 5D96B 4ZTOH 2IFFH 5F0MB 4XE5B 3HS0A 3E3QE 3V0VA 1QG3A 5J57B 3EGXB 1T6VN 1UD6A 4JPWL 5LGYA 2XBDA 3CV5A 2O61B 3PFQA 4JDVA 1KC5L 2VCOA 3DK0A 2NY2B 3VXUE 4YZFF 4DVRL 4WTZA 5DRZA 3E6FB 3BISA 5F7LB 1KELH 1XF3A 5ISZA 4NYLB 2BW5A 4P5TB 4Y5XC 1JSYA 1ZA6B 3V4PA 2FO4A 1TYEB 1A8JH 3IF1B 4IBQA 5ISZD 1EJ8A 3N0AA 3FSAA 1FZOA 1G0DA 1MCHA 1WGVA 5ABAA 1IQWL 1LTXA 4ZO8A 5C9JB 2VDKB 5EZOH 1CDUA 1GXEA 4TL4A 1BQUA 3GS7A 5ERWA 6FABH 4IHBA 1JXJA 4JREB 3S3BB 2YJLA 3SO3C 3P9LA 4ECNA 2B15A 2HVKB 1CFQA 5F1NA 1OCWH 2GEEA 4LZKA 5LHDA 3ZDZF 2X4PA 4Z9KB 1QFWI 4QEGA 3BLKA 1Q94A 1H9DA 4ICXA 2XWDA 3BIAX 4JO5A 1XX9C 4NUMA 4W9JC 1DE4B 3UYRL 4GIAA 1AG6A 2CLVA 2P52A 4FE9A 4I3SL 1DR9A 4X6BA 4GP8B 4BYHA 3PGCA 3X3FL 1RZPA 2DICA 2D0GA 4N0FA 2WO3B 4J28A 1WBYA 3ZUCA 3CFCL 1PTZA 4OAWA 4P2AA 2D03L 3Q7JA 5DEZA 5DSCB 2P8MA 3F12B 4BHUA 1Z9PA 1AGBA 1L6ZA 3GXIA 2K78A 2CM5A 3LRHA 1TTFA 3OMNB 4TTGA 5HDOA 4HZ1A 1HN1A 3MRKA 3F62A 5FGBC 2VE6A 2ZUUA 2QPDB 1OT2A 3AM8C 4WHDA 1PJ9A 3NZSA 4A2LA 1SHSA 3D39D 2QTVA 4YSPA 2P45B 4PRAB 5JOPE 2H0EA 3HHMA 3C60A 1WUZA 5IHBA 2R1WA 5BUGA 2QFRA 2YAQA 1NCCL 2PMZA 3OTTA 3NQIA 4RX4A 3EOAB 4FXGC 1E3FA 4IK6A 3LKNB 5I74B 1A6ZB 2B0SH 2VOTA 3N04A 4UUJA 3LXCA 1NEZA 2COQA 3HOGA 4CVXA 3DGDA 5ADOH 5GGTA 2H3NB 1PAMA 3DUSA 2L7JA 4FFYA 4FZ8H 4X6DF 1NBYA 3FU3A 3VRLF 5C6WH 2HXAA 4QF1A 4N2AA 2ZAGA 2OSWA 1D5BB 4YUEL 3VXOA 2QV4A 4I9WD 4JM2A 1UCBH 4FFZA 2XFGB 3D08A 1EO8H 5LWYH 4LP8A 5FCUL 1XSJA 4LCUB 2XQYK 5KYUB 5JMOC 1AD0A 3VJ6B 1SUJA 3O2WH 1NGXB 1A6VH 1KIRB 3FU7A 1KWKA 1QFWL 2ED9A 3EYUL 2ISDA 5JQ6L 4N85A 2NRDA 2MOVA 1J5OL 1M71A 4JRYD 4CDGC 1BYPA 2FQGA 3GMQA 3QH3B 3ZYIA 4UV4L 4CMHB 5CCKL 3HI1B 3QNXA 1EAPB 5MEPA 1NMBL 2DLIA 3ESPA 4UTAH 5C3TA 4HPOL 3CFEB 2NZIA 5EN2B 4EN2A 4IBVA 1D5XA 3X1EA 4Q74A 3E3QC 4M8QA 4WV1A 5IB3B 4FD0A 2E7MA 2ZUTA 1UCBL 1T2QH 4NPKA 1TSRA 4NKDA 4HV8B 3OKYA 2BSRB 2NYYD 2X4UB 3GDBA 4BKLA 2R0ZL 1BYOA 2XPYA 5AVRB 2AEPL 3GBEA 5GGTL 1RIUL 3WBDA 3T65A 1WTGT 2RD0A 1NCHA 4N28A 1NAML 4F27A 2ZWKA 2E27H 2J5LC 4BDVB 4EDXB 2FWOB 2FJGB 1FNSH 5HI4C 4HWNA 5EO1B 4X8XA 4W9EC 3IPFA 2VDLL 3HG1E 2DQ6A 1MFDL 1ADWA 1NL0L 3B8YA 2EZ0C 2OBGA 2W88A 1NC2B 3CQQA 4MA1C 4WO4D 1BEYL 4WGVB 3VWJC 2YQ2A 3WNKA 3T04D 5FO8A 3SJVD 2G5RA 2J6EA 4LDEB 5KYNA 1ZTXL 2CK2A 5GRXG 1KULA 2F74A 5C09B 3E1ZA 1W6WA 3PHAA 3R06A 3U4BH 5J1AB 3R8BB 2WBJC 3CZKA 1FP5A 3CFBA 5GRUH 4UZSA 1GZHA 3SCMD 1G94A 4PR5A 2Z65C 5JHLH 2IDSA 4HHAA 4QHNB 5FM5M 3RVXC 4AEHH 3GHPA 1JNHA 3ZE0B 1K4DB 1KGCD 4ANVA 1TKWA 5I1IH 1MEXL 3WNPA 1OEZW 3CZJA 2JJVA 3X14A 2R15A 5L88H 1UWEH 1FIGH 2I26N 2XOTA 1JMZA 1AYOA 2YS4A 3TVMC 4CSTA 1F3DJ 5EIIG 2P8LB 5SX5H 3VH8G 2NT1A 3ZYJA 2LE9A 3R1GL 5SWZA 5DJDB 4ODTL 3ZDZB 4L4TB 1E28A 4AL8C 4XCYA 3AJ7A 1CBJA 4NAMA 4YDKL 3WNIA 2ZWZA 1NIDA 2ZPKH 3BW9B 2J1YA 1X5KA 4FCHA 5TTRA 2GQHA 3VGDA 1H3PH 2YWYA 4XMKH 3NP3A 2D7NA 5KVDH 2MNJB 1FFNA 1L0YA 2GSIA 4PD4K 1E9PA 3T4AB 1RIUH 3P9LB 4GJTB 4PJHF 3QWOA 1F4XL 4KXDA 1T5XA 4MJ4A 5E6UB 2Q5BA 4KKAC 5G55A 3VQ1C 5T1LD 5IIEB 4OFYD 1EMTH 1WWBX 2Z7YA 3QDGB 5IQ7H 2UVFA 1TOXA 4IKIA 3QUZC 1DFBL 4G1EA 3HVDA 5L0QC 1NL0H 2C4FU 2BZDA 4X6BB 4ZXBD 4X7CC 4K9JA 4H40A 5GRJL 3TIEA 3FOMA 4UTAL 3KLLA 5L8LB 3OR6A 3MKKA 4F7CB 2QVKA 2NY6B 1PKOA 1PQZB 4RQQA 1TQBC 5I1DB 4HJJL 2OXHA 3D39B 3VFOB 5FFGA 1DDHA 1OAQH 2CDGB 3QDMD 4FA7B 1KCRL 3AZUA 4R26H 3SY0B 2ZKYA 1MN4A 3ESNA 3EYSH 2JKTM 3MLZL 4X7TA 1QFOA 3AROA 4J4PD 4XTRD 4X0KB 3QEQA 3IB4A 4LCCC 3RRQA 3GSRA 4XVUD 4YDZA 1IM9D 3GD1C 4HU8A 6CGTA 3GGWA 1PLBA 1AR2A 4AGQA 2H32H 2ZNXA 4MD5A 4KXCA 4XXCA 1YPZA 1C5BH 4IBYA 4PJCA 2GT9A 3VFSB 3KPSA 3ASWA 4WKZA 5IBTL 4KZ0A 4AZ8A 1ACYH 2QKSA 2F53A 2IOMA 1MWOA 3F64A 1HXKA 1YN7A 3WTYA 2V9UA 2AXGB 1KCRH 4P2QD 5D1QB 3TBYA 1FHGA 4MDJA 3CN2A 2BHZA 2WBXA 3C08L 1JYWA 4E41D 2CUMA 2NY6D 3HI6H 1LM8V 1PJWA 3W2DL 4IGBC 5CJOL 4AGMA 4NSKB 3WFBH 4OZGF 4PHXA 3F65A 5EF1A 1N59B 5BZZA 1J1XH 4BXSV 4OB5H 3BESR 2RQ8A 1X6NA 1Q72L 2C5DC 4Y5XB 3MN8A 5G2NA 2HTKD 1KCBA 5IB1A 2CHWA 5CEZL 1UKQA 2VMEA 5CUSL 5F6IB 2YGPA 3C8KB 2I07A 4IKKA 5AWNH 2EVHA 1PAZA 5IFAL 5IJVB 3SGKC 2QVTA 3ZTEA 1Z7JA 2FSDA 4KJPD 5SWSE 2P47B 5I1JH 3DVGA 1C16B 3DDFA 5IMLB 2V9RA 1KBWA 4PJDE 1HQ4A 1MI5A 4BK5C 4EE2A 4WSJA 2G60H 4ICWA 2XN9D 3V0HA 4BBWA 1JK9B 1V7MH 1ZVSA 3PIQB 1F6FB 4QDGA 3GSNL 5JW4R 2QVIA 3F7KA 1ADQH 5EWIH 3F7YB 3WFBL 3C60C 4MAYA 2PW1B 4KAQH 4OH2A 3PL6B 2A9DA 4QAMB 1T2JA 4NLAA 5TE6L 3MLZH 2I9LB 1FQ9C 1KGJA 2WB1A 4I48B 4FNQA 2E6JA 3FUIA 1G1YA 3M86A 1RZFH 3FN9A 3GMMA 4Y9GA 4HK0B 4TVUA 5E9AA 2JKNA 1BPVA 1UOVA 2QMJA 3OAUL 4PLJD 4FDWA 4NZRL 3PRZA 4H20L 4AIXA 1LDPL 1AG0A 1QI4A 1N3NA 1X5AA 3H7BA 4WWKC 2BY1A 3Q43A 1E4WH 2WUBH 4DGIH 3C6LC 1GPOH 1HWGB 2OPCA 1H6UA 2PF6A 4MA3A 3N40F 4TOYL 1HOCB 4QR7A 3WD5L 1V7NL 3LVEA 4ODXB 3T77B 3B34A 4TVPE 3VGAB 3QJUB 2YZ8A 2JIXD 1WAEA 3MLYL 3HR5A 2I60L 1HNYA 4XPTH 4EZMA 4ZD3H 2YC1A 1DJWA 5MENE 3GJEA 3O9WD 1AP2B 1OAJA 4YDLB 1BD2D 4OJFH 2CLRA 1Z9SB 2A74C 2CO7B 4CU8A 1CTNA 3KBPA 1OTSD 5L4IA 4CMMA 9CGTA 3P0VH 4MNHB 4KKBC 4MS8D 4PJXB 4PJBA 4TS6A 2EICA 3KW8A 4AL8H 1QRNB 1S5HB 2EDTA 5DZAA 2DS4A 5JW3L 1UATA 5IW1A 1CF8H 4UQ2B 2N56A 5IMMB 5TDOA 3OZLA 4Y8AA 4U1KA 5LCVH 2BRQA 3N85L 3FTYA 4FLHA 3UDWC 3P9MB 1L9QA 1Q9OB 1G7MA 2JB6A 4JGMA 2FR4B 5HYSB 2NZ9D 2A7BA 2GJ6E 4FA8A 5JDSA 2VM3A 1DBML 1VLXA 4QUOA 5AUMA 3VXUB 1PZ3A 1T0PB 3HPLB 4GEJA 4GNKB 1H15A 3OR7B 3ARGD 4KKAD 2FEEL 2BIQA 4GUOA 2EE9A 1FDLL 3KG5A 2UWEF 4B0MM 1KCVL 1D9KA 2LHAA 2W9DH 1CIUA 1ZT4B 2DF3A 2EVFA 2XRAH 1N12A 3LKSB 5IKCA 2G4EA 4G42A 2XPGB 1YPZB 1BZ7A 2JJWA 4JPVH 2CHNA 4JZJA 4N0CD 3ZKSD 5F9JB 2AFNA 5AYTA 2Y7OA 4HWEH 3TA3A 5E2WL 1QSFA 2ESVD 3RGVB 1CXIA 3EYVA 1MVUB 1YEFH 5E1QA 3B7RL 3Q05A 1DBKL 4RWYL 1K72A 3VA2C 4AQAB 1VZIA 3IJSB 4M5ZH 3V79C 2O4EA 2P8PB 2Z8WC 4K3EH 5A2CA 1QQDA 2Q7YA 3GRWA 4AC2A 4YE4L 3PPEA 1XFPA 1TETH 1HINL 4NNXB 1ZGLP 1WT5A 4JFVA 1U8HB 2FVNA 3DK2A 3LSOA 4APXA 4X5WB 3BP4B 5IR1B 2ESVB 4KKPA 5C08A 4JPVL 3RGVD 3QUXA 5IT2L 2DQUL 3WTVA 4PJ9D 3DI3B 3TWCH 1E4WL 3NEXA 2OLDA 3JWNH 4DO6A 4H0IA 1AI1L 1RIHL 4MXQD 2K4WA 1U4EA 4OZGA 1S3KH 4PCSA 5F3BA 3SKMB 1ZDSA 2QZQA 2A1WH 2DEXX 4L1HA 3OZ9H 2BERA 5FIEA 1A14L 4DAGL 4KRMB 3OHXC 4KO6A 3QQ9D 1IAIL 4IEFB 4P2OA 1SNRA 2HRHA 2HZHA 1RXLA 4JQIH 1QMUA 1S7VA 5EU5B 2Q8AL 1BF2A 1MW3A 1RJLA 1TQWA 1LEIA 1G9MC 2HFGH 4ZS6D 4JKKA 4KRLB 5E03A 1SJHB 4F8TA 3WU1A 3VXSA 3PWJA 5MP6H 1J48A 4G9FB 4HKBA 4IRSA 1REIA 1F4YH 1OTTD 2W65B 4LRIA 4MB1A 4W4OA 4ZSOE 5LAPA 2L3BA 5DQDL 5E8OA 4K07A 4AJ0A 2LU7A 1FPTH 3I6KB 1E3XA 4QCIB 1C12B 2XRAL 5JW3H 1QQDB 3AAZA 1MFDH 2R1WB 3FSOA 4MMYB 2N7BA 3WHXB 4HULB 1EFXA 4QHMB 1LE9B 1RZKL 4PYHA 5DVMA 1NCBL 4M1GL 4ZUVA 4F58H 3IXAA 1JZ5A 1JZEA 3D4ZA 2MCAA 4UQBA 4XOBA 4D9LL 5F3FA 4J8RB 2VC2B 2BINA 3ECBA 4R90L 2GK2A 4GXUM 3WHE0 4WUKL 2XKSA 4CW1B 1URLA 3F6LA 4W6YB 4ZW7A 5I6KA 2R27A 3SJVB 1BM7A 2JELH 3CN3A 1I3RB 4L3EA 4HLEA 2YBGA 5HJ3B 2AAAA 4KI5F 3BGAA 4U6HA 2G75A 5A16B 3VXRA 3LOWA 1A2YA 3NCXA 2CA3A 4UOW1 5K9JL 1F11B 4ORGA 5GSRA 1EPFA 1MUJA 1E43A 2ICEC 3BGFC 4GAYB 4CC1A 4QHKJ 3QZBA 1EUTA 4KJYB 2GITA 4KROD 1BQHG 5HHOD 5HYJE 2KLRA 1UWEL 2ZYRA 1IEHA 4PJGB 1ZIAA 1QFWH 2VC2H 3CXFA 4ENED 1DLFH 5KG9B 3DETC 4Y5YB 4GXFA 3K8KA 2OTWB 5DHYA 4TVPD 1A6UL 1ZRUA 3QQNA 4U3XA 5CSZB 5DEGA 3KPNB 4ZTEA 3UPCA 4C56D 2WANA 4XRCA 4JQXC 4HS8H 2WAHA 5TE7L 2EDNA 2BOCA 2VR4A 3FJTA 1I8MB 3ROOA 4HC1H 1HILA 3WUWA 2H6PB 1XAKA 4NQTA 3JUYA 4MLIA 3QP3A 4NN7C 3W9DA 3VDAA 1ZVYA 5GZOA 4M3JA 4EZLA 4TSAH 5SWZE 4Q6IA 3TBWB 2OULB 1CQYA 1G5GA 1LK3L 3KPQB 1UA6L 3FPYA 1USZA 2I7SA 1NIBA 2Y1ZA 2NY0C 3CXDL 1KXQA 3QJOA 5EOTB 2IBBA 3SJVE 4XN7A 4H1LG 4LHUB 4U1SB 5JHBA 3RL2A 1S3KL 2Y3NA 3GRWH 4AK2A 1S7QB 1IEBA 5C0JB 3GMLB 1CR9H 3VNYA 1XV8A 3G6JF 1Y0LA 5JOPD 1THCA 3EHBC 3V6ZA 5CP3A 1BZEA 4GRLB 3D85A 2F74B 3CD4A 3VI3A 1OAXL 4ENEC 3EJQA 5DYOB 5GSVB 3RPIB 3MODL 4G72B 2IVFC 3EO0B 4WUKH 4DP9X 2RCSL 4S1QH 1ZLDA 3RJDA 3OR7A 3F5WB 1VRSA 4JEGB 1KBPA 1ZT7B 2EIKB 1KTJA 1DJGA 3EXLA 1RL1A 2EVJA 4Z3JA 4A7SA 5ESAA 3KPLB 4AYSA 4HAFA 4M6OH 2LQRA 4R96A 1XR9A 3QI9C 3Q5TA 4QRSA 4BWTA 5I71B 1ZMYA 1ORQB 3K6SB 4MVBC 4WUUE 3V6ZB 3GKWL 4UOJA 1IE5A 1HU8A 4H13C 3EIFA 1RZKH 1R3IL 4LNVA 4K55A 1NEZB 5J6GB 2PXYD 3GMOB 5IT2H 1E6OH 5HJBA 4FI6A 2VE6B 5CZVL 1B9KA 3C6EA 1U92B 4IHOB 5GGVY 4OZHF 1YY8B 1ZXKA 3ZTNL 5DUBB 1JK9A 1XZ0A 1AO7B 1UUSA 2E76C 1NBCA 1WT5C 3EOTH 4UT9L 3HC0B 4DVBB 1FVDB 1S7QA 1HSBB 3IFNH 4XE0A 5C0JA 5AW2B 5DVNA 4HS3A 2NXZB 5AFAA 3MRLB 4ZMVA 1KLGA 3TPKA 1M7DA 4UIKL 4UBDC 3GXDA 3DX1A 2BH0A 2BVTA 4N2KA 3MMEA 1ZLSH 4NO2B 4OFIA 4LL1A 2H3NA 2QKIC 1GYUA 3KBEA 4HH8A 4WU5B 5J5EA 4X6EB 1DLHA 2P5EA 3GI9L 1UM6H 5DHVA 5JLZA 3DOHA 4ZXBA 1J10A 1ZK9A 2XU9A 4NO0B 1QFHA 4FQQA 1A3LH 3HCVB 4LCWD 3NFPA 4PJ5D 5C07A 4TQ8A 2JLPA 2FCBA 2X88A 4UZUA 3G6AB 3Q2NA 4YHPA 4R8WH 4JRYA 4FQ1L 5C07D 2CKBA 4NKMB 2WLMA 2WLYA 3N91A 5I26A 2IV9A 5HDQH 1XQ4A 5JNYB 3STZB 1P5VB 4JR9H 2CK0L 4PS4L 3BPCA 2C3WA 4JY4A 3I75A 1FZJB 2JJTC 4L8SC 4GH7B 3I74A 4GQQA 3T1FB 1T20B 3BDBA 5B3SB 2UYLB 2XBTA 1F8TL 3EFOB 4NFCA 4KZEH 4M7JH 4QCIA 1NFDB 4O2CB 4LSPL 1EXGA 2AK4D 3IAPA 3OC5A 4ZUVB 4X7TB 2W60B 4WW1A 3RDTD 3BSZH 3QFGA 5DT1L 4RFNC 3NH7L 4TNWF 3DRTA 3BPCB 4JVUA 3QNZB 1KMGA 2VDMB 4X6DA 1CD1A 1H3VA 3PWLA 1Z5LB 3CHSA 2XKUA 1VGEH 3INUH 3ZRCC 5ESVB 3HE7D 3QQ3A 3P2DA 4LF3A 5TDPB 1V10A 4HK3N 3IJ9A 3N3EA 4P2RE 1AAJA 3BWAA 4POZC 2C4XA 1F58L 3VXMA 2ZUQB 5ECJE 3QEQE 1WBZB 1OGAE 2Z91B 4AGNA 2ARJQ 3RWJA 2W92A 2YMXL 4IRZL 4XVSL 1MAMH 1PEZA 2Z7WA 1PLCA 3KPPB 4GSDH 4E2OA 2BSCA 1HKLH 4RAUA 5E5MB 3DHJA 3IJYA 5HI3C 4GSXA 5DJCA 3VQMA 2VDQH 1TUPA 4M1DH 2Z3FA 4KXBA 4J8QA 4G7VH 4NQQA 1LMKA 3EH2A 3WEBA 3II1A 1WGOA 3MLRH 2MQ0A 5HPMB 1UT9A 2DWDB 1AQKL 2NY0B 1RHHB 5CGYD 1O0VA 4X6DB 4DP6X 1TZIB 4G5ZL 3R7RA 4YR6B 1T20A 1ZWIA 2C9XA 2ENQA 5I1JL 1NPNA 1IJNA 3M1CA 1UFUA 4ZZKA 2O26U 4I3RL 5TD4A 3SE4C 3PV6A 1VIWA 2PW2B 1E9PB 4MRCA 1NEZG 3JQOB 4OI8A 4PP1C 1BMWA 3QYMA 3H42L 5T33H 3ME0A 4Z7WB 4X42A 1A7NL 4JKPL 3ZZ1A 4OZFH 4NQED 3U48A 4ZUTA 5EBMA 2P8PA 4E9SA 2CGZA 2VR7A 3EGDA 5F7WC 5A43C 4Q9RL 2GKIA 5B22A 3R7QA 1TTCA 1CL7H 3FOLB 3KL0A 4JFDE 3UGUA 1W8NA 2VLJA 3DBSA 5F9OL 5CZRA 5KWYC 2VERA 1QLEB 4XC3H 1UYWH 3BFWA 1X5JA 3FMGH 2Z1KA 3GKWH 3SE9H 2FNBA 2XV6B 2K70A 4GMSL 2TRYA 5HGBB 2RAMA 2FB4H 4P99A 2MSPA 4RRPA 1IGIH 1JI2A 1NLBH 1RZJL 4NPYA 1DJIA 4ODHL