3S0PA

Copper-reconstituted tomato chloroplast superoxide dismutase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
153
structure length
124
Chain Sequence
TKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDAGGRLACGVVGLTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical properties of Tomato Chloroplast SOD
rcsb
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
molecule tags Oxidoreductase
source organism Solanum lycopersicum
total genus 27
structure length 124
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3s0pA00
3KH4A 3SODB 4A7SA 4BCZA 1SPDA 1OALA 2Z7UA 1OZUA 2WKOF 3K91A 1JCVA 1XTMA 3GTTA 1BA9A 4L05A 2WWOA 1CBJA 1L3NA 1SOSA 3CE1A 1F1DA 1PU0A 2APSA 1SRDA 2C9SA 4N3TA 1E9OA 4OH2A 2E46A 4FF9A 1JK9A 1YAZA 1HL5A 4N3UA 1YAIA 3MKGA 2WKOA 3GZQA 5KBMA 4U4IA 1COBA 1SXAA 3ECVA 1B4LA 1N19A 3KH3A 1EJ8A 2E47A 1AZVA 3H2PA 4A7TA 1E9PA 1EQWA 2AEOA 1E9OB 2Q2LA 1SDYA 4BD4A 1JK9B 1IB5A 3GQFA 1SXSA 3GZOA 4B3EA 3S0PA 2WYTA 2NNXA 1KMGA 1DO5A 3T5WA 4A7QA 2VR6A 2VR7A 1RK7A 1U3NA 3HFFA 1E9QA 1OZTG 2Z7WA 2ZKXA 1E9PB 3KM2A 2AQNA 1MFMA 3KM1A 4A7UA 2AF2A 1F1AA 1SXZA 2ZKYA 2Z7ZA 3QQDA 1N18A 2WZ6A 4MCNA 2VR8A 1QUPA 2WYZA 2AQPA 3RE0A 2V0AA 2ZKWA 1E9QB 1P1VA 1Z9PA 1ESOA 1SXCA 2GBVA 2XJKA 2XJLA 2C9UA 1XTLA 3CQPA 1IBHA 4BCYA 4MCMA 1XSOA 2K4WA 4A7VA 3MNDA 2WZ5A 3PU7A 3GZPA 3GTVA 1S4IA 2C9VA 3KBEA 1IBBA 1CB4A 4OJAA 2LU5A 3HOGA 3HW7A 1FUNA 2AQRA 2JLPA 1F18A 3L9EA 1UXLA 2GBTA 5CU9A 1PZSA 3H2QA 1SXBA 1BZOA 2WWNA 5KBLA 1IBFA 1HL4A 1TO5A 1OAJA 3F7LA 1YSOA 3ECWA 1Z9NA 4A7GF 2GBUA 2AQSA 2AQQA 1IBDA 3KBFA 5KBKA 1SDAB 2R27A 3QQDB 3ECUA 1UXMA 3F7KA 3LTVA 1OEZW 1B4TA 2WZ0A 1TO4A 2AQTA 2Z7YA 1Q0EA 1DSWA 3L9YA 4A7GA 1PTZA 2JCWA 1SXNA 2SODB 3CQQA 1F1GA 2ZOWA
chains in the Genus database with same CATH superfamily
1TZHA 4N2LA 1KPVB 4TULH 2J5LB 4WNJA 2IWEA 2J71A 3DGCR 2Z7UA 4HFWA 5JO5A 3MRRB 3LQAL 4ONHB 3IVKA 1F90H 2ENPA 2FX8H 1QNIA 4L05A 1RUPH 2EIMB 3WFCH 2OMUA 3EBGA 1T21A 4QRPE 3KLAB 2C3VB 1LO5A 4JZNA 5DJ2B 3ZQ9A 2UY6A 3DVFA 3DSFL 1L9OA 4W6XB 1WF5A 3U4BL 3CUPB 4NM4L 4X5PA 1JIBA 3CSBA 1AZCA 2X88A 4KROB 1K6QH 4EI5A 2H47C 1QA9B 4JHAL 3S6CA 1J11A 1NGZA 3I6LE 1HCZA 4UQCA 5TE6L 4Z77B 3FBQA 4N8UA 3IDXH 5EORH 1I1FB 2JF1A 3C5ZD 4KVNL 3BKCL 4UM8A 5E1AA 2AV7B 4UQIM 2DQCH 5E9DA 3P4NB 2A38A 5KUMA 4TSBL 1FL5A 1MKFA 1S7QA 3GXUB 5JDSA 3HHMA 4Q9QH 4LAQH 1PZAA 2WP3T 4ZMXA 3GNMH 2AEPL 3DX7A 2E59A 3VNZA 5IFJB 32C2A 4V11A 4OFPA 5TQ2H 4J3XA 3IXAB 3W0WE 4XAWL 1AGBB 1QFOA 1UZ8A 2HJFB 3TIDA 3P3TA 4C4KT 3EYQD 1K5NA 1ZHBA 3G7TA 3BCDA 4JO2L 1XTLA 5ID1B 3WIHL 1UKTA 4QLRA 1EAPB 4FFYL 4LCCC 2VIRA 2XICA 1HFUA 3H9ZA 3M8OH 4CJ0A 4DEPC 4RSVA 4JX0A 5D2NB 1MHEA 3L3IB 4PTTA 4ZFGL 2CO2A 3K80A 3V0GA 1AOHA 3CMOL 2HG5B 4ZPTB 1LE9A 2EVGA 2IBGA 1N5YH 3SQOH 2AQRA 3EFOB 4H8HA 1S78C 3AXIA 5KG9B 1F2QA 1E42A 4UQDA 2K3HA 1CLOH 5CU9A 1YEJL 4LVOC 5FYJU 4LEXL 2Z4QA 1EH9A 3NTCL 3BAEH 3RDTC 1IBFA 3CGTA 1AMXA 1LL1A 2Q7AA 3V5KB 1DJWA 3MOAL 1M7IB 3D3VA 2MHAB 1ZT1B 3BE1H 3QQDB 3AC0A 1N10A 1CK0H 4D9RE 4ZSOA 3G9AB 4PR5B 2X9XA 1SJXA 3MV01 2HTLC 3SE8H 3CK0H 1XV8A 1QFUH 1KGUA 1PTZA 3GYRA 3BDBA 1S9WB 3A4DA 2J2ZB 1CT8A 4LVEA 4WVRA 4M3KB 2EINB 4UAOB 2WSPA 2MH4A 4OZFH 1SDDB 2BIQA 3JWNE 3E3QE 5D7KE 4NP4L 1FVCB 2J6EL 4ANUA 2RR3A 3TJEL 1C5DB 1PD0A 1DSFH 1MHHB 2ENQA 4FZEH 2D0HA 3B5GA 5K59F 4TVSa 5I71B 1XR9A 4MAUH 2NW3B 4R2GB 2R0WL 3BVUA 3MLWH 2IWFA 1JHTB 1J5CA 5KEZA 3B3IB 3KL0A 3FCSB 3QEGH 4N8VA 5KVFE 4HS6B 4JRYD 4MCYB 1NBCA 1N68A 4MMYA 1ZS8B 4R7DB 5FUZL 3S88H 4ISVB 2Z92B 1QVOB 2OSLB 4U1SA 3SB3A 5FGRA 5EN2A 3VRJB 1OGTA 4DP8X 5D4JA 4O02A 4PJFB 2EDDA 4LQ1A 4A7QA 3SPCA 3Q01A 3PWNB 3EUUA 3O4OC 1D9KC 2R69L 2IFGA 3B43A 3GBNH 1N3NB 3L5XL 4K5PA 2EUWA 1CICA 3CFDA 1T0PB 2EIEA 3V6BR 1F1AA 1MG3C 5ID0A 3WFDL 3ZT5A 4CU6A 2Z0BA 1KYDA 3LNEA 2O30A 3MLSH 2P42B 3VWJD 5I0WA 4DP4X 1HJCA 3V0IA 5CZVL 2VC2B 2CPCA 4RRPM 1DUZA 1SXCA 1W80A 1FNSH 1UM5H 3KDMA 3GO1H 4XX1G 3OAUL 3BLKA 3WEXA 5E0QA 1IC7H 4PWGA 2ZYIA 3HVDA 2W5PA 5LNEA 1OW0A 4ONOA 2Q3ZA 2X9YA 1P7QD 1C8QA 5BRPA 5LGHH 2XA3A 5DZVA 5SX4I 4YXKL 4LCCA 1DLFL 4L0YA 4UUJA 1XGUB 2J72A 1IGTB 1VFBB 8FABA 4MDIB 5JW4Q 1WZKA 4MNHB 4FQ2L 2F19L 5F7YC 4XPAL 3T0BA 5KZCD 1BFOA 3GSUA 1DVFD 1HQ4B 2J3SA 4P9HL 1H5BA 5MI0B 2WLKA 4L4VA 1DUYB 4MD4B 1NBYB 4Q97A 2R59A 2WCGA 4B50A 3GD1C 1E8YA 2Y9RT 3KEHA 5D5ME 5E6SB 5EBGA 5HHNB 5C3TA 3RDTA 2CUHA 2W60A 3GMLB 4Y1AE 5D55A 5IVXE 3CFIC 3FUNA 4H0LC 3U79A 4P2CG 3KPTA 3TJHD 3W9DA 1B4JH 4H8WL 4M9OA 1QTPA 5KVMC 1ZGLA 4FCAA 3RPKA 2G75B 4X99B 3WY3A 2JCWA 1S9XA 2X6VA 4Z7OF 1A02N 1F1GA 4UMSA 1JGEA 5FFGA 4ZMYA 1F41A 3DTDA 1NCTA 1JYWA 5DUMH 1L0YA 5DFAA 3OX8A 4QAMB 3AG1B 4I0PB 2MMXA 4A66A 1KTLB 1MF2L 3MUY1 3WAKA 3TT3H 4JM2A 1VGEL 4FF9A 5L6YH 4TV3A 3ZL4H 3QFJB 5D1QB 4FMKA 1YYMH 3AROA 4FNUA 4OLWL 4AUJA 2EDJA 3GMOA 5MEOA 4HV8B 1A4JA 1Q0XL 3HKFA 4NRZB 3T1FA 1NFKA 3BGMB 4KRPD 3ZGHA 2ZWKA 3QUHA 3MRLB 3UC2A 3QIUD 5K39B 1OPGH 3IKCB 2VMFA 3IK2A 4FX5A 4ZOBA 4F3FA 2MFNA 3SJVB 2X42A 2AJZA 2DLGA 5FYKD 4HKZB 2NYKA 3ARBD 3ZTJG 3IDMA 4HHAA 1EZVY 1B9KA 1A6ZB 1NC4B 4NPKA 4OFKA 4L3FA 3CBKB 4IRSD 1BXVA 3WJMA 1MFUA 2RACA 4QF1A 4TQ8A 4IMLA 1WICA 2YFNA 2DBJA 1DFBL 1JRHI 1T4KA 3EDKA 4XPBH 4GRLC 4YHIB 4Z0XB 3QG6B 1XFPA 2X4PB 3C75A 1AR1C 3QXUA 4LFHD 4G8GB 4YE0A 3GS7A 4H25A 4PRNB 2E27L 3FQTA 5J13C 2Z6FA 2WAHA 1B0RA 5DJZA 5IB4B 1R5VB 2J5LC 3Q06A 3PRZA 4H8VA 3CZJA 4NI3A 3WHXA 4HYTB 3L4WA 1E3ZA 1OT4A 2P7TB 4PJIB 4YGAB 5AOLA 4UWQB 2PWFA 3MLTA 4E41D 4YHOH 3O2DA 2YD8A 2F6AA 1RPKA 4M5ZH 2VXTH 2OZNA 1F6LL 2XWBB 4KH9A 2VUYA 2WZ5A 1XGPA 5EEYA 1B6UA 1ED3B 4BYHA 1FFNA 3MX0B 2AGJL 5E6ZA 4BH7A 3NIGE 4G8EA 3I9GH 4KROC 1KPRA 1QBLH 3QAZC 5INCA 1GCYA 3BT2L 1URIA 4OF6A 4ZZFA 2PABA 3QYMA 2VN5A 2GY7B 2VDKH 1NAML 2FR4B 1UT9A 2OMTB 2OPCA 1P84K 4GMTH 5D72L 5C0CD 2O5XL 5BPPA 5AUMB 2VM3A 3EYSH 2OMZA 1FO0H 1S9VB 1WRFA 5I2IA 2OL3H 2XZCL 4HS3A 3QJFA 1BEYH 4HIEA 4N0UE 1IFHL 4X7FC 2Z4TA 4YH6A 3KLKA 3NFNB 4W9JC 4X9YA 2MCPL 1H6EA 1L4IA 1WV7T 4LHUA 4YK4B 3X3GH 1OTSC 1P6AB 1F4WH 1I8LC 1SN0A 1PZDA 1SHMA 2IDFA 3FQ2A 4JJHA 4QAWA 5KYWB 2OK0H 3OZ9L 4HP5A 3IPFA 1FFPA 1XF1A 2AJUL 3PWVA 5ISZA 3W37A 3UG3A 3QHTC 1DBMH 1N8ZA 1WAAF 5DVPA 1JHKH 3SPVA 5F96L 2FWSA 5D2NC 3WLBB 4OLZH 4FKEA 1S7RB 2F54D 3TT1H 3FYEB 3TM6A 3BZDA 4GKZA 5HDBB 3UCRA 2FB4H 4W81A 2VXQH 3MXVH 2CCVA 5I73B 2W91A 4FMVA 1CTMA 3UDWC 5E51A 5I8CB 3MUZ1 1TTGA 4WHTA 3JV5A 4W9EC 2NLJA 2RCSL 3UGEA 1FL3A 5GS1A 2X4NB 2R9HC 3NJLA 1CL7H 5ACZA 5HSFA 2FE0A 1SY6L 1QLFB 4IBSA 1UKQA 5AW7B 3VQ2C 1JHLL 2GIXA 1EUUA 3VXQA 3IT8D 4PWHA 3OXRB 1U8OA 4AE1A 2EVHA 4OV6F 4WEBL 1LEIB 2GVYA 5C08A 4D9LL 3OB0K 4WSKA 2BO0A 3T65A 3ISYA 4GAFB 2Z34A 1S6NA 1XGTB 4UAOC 4FAAB 4W70A 3W5MA 3ILEA 2NY0B 4I18B 3FB5B 4PJEE 4PJAE 2DQGH 4KQ4H 1ESOA 1TFPA 4GRLA 4KAQL 4IU2B 4KNQA 4ERSL 1A66A 1F4XH 3VSTA 1A8JH 3FS9A 3GT6A 3IFOA 5EFIB 1ZLVK 1PG7L 3I02B 1JF6A 1PG7X 4KJPC 4MCMA 4PRBB 3TVMB 3HNSH 3ZDXF 4HOWA 2VXUL 3CZFB 1YRKA 4GQ9H 2M8XA 2CSPA 3DGGB 2F5BH 4U1KB 3MRRA 4DPRA 1ZOXA 5I71C 4JPVH 2J1WA 3VRLF 2HLFD 4ODWA 4DPCX 4R2GC 4CVXB 2QHRH 5M7QA 3RIKA 3MCLH 3D51A 3KCPA 1KYUA 2Y7OA 2C3VA 1D5XA 3KLAA 2VDQH 1GGIL 1MCDA 5EULV 3UGXA 3PHQB 4HD9A 4RBPH 1LP9E 1I9JH 1R3JB 2YXVA 4NLAA 2CGRH 5GIRB 2AI0L 2X2JA 3OAZK 4UT6L 3US1A 3AS3A 4WI5A 5A3ID 3CUPA 4X7CC 4F2EA 4K2UL 4TTDD 1G9EA 2YK1L 1QTSA 2XXMB 4YHNB 1YEHH 2I27N 4TNWF 4DZBB 1QA9A 1LNUB 2BSSB 1YUHA 4YHZL 4WQOA 1KGJA 1NFDB 3RJDA 1JGDB 1Q9OB 1NCOA 3KWUA 3NYKA 1ZVHA 3L9RA 3HVNA 4G8FB 4XCYA 3LEYH 4P8QA 1IV8A 1NOFA 2BINA 4TUUA 5FYJH 2AV7A 4TUJB 3BAYA 4XI5C 4AEIL 4MQSB 1NFIA 1KIPB 3SODB 3N43B 2DM7A 5ESQB 4BCZA 3VW3H 5IM7B 1CE1L 1X7SA 3LYRA 5C0CE 2DLTA 4FL4B 5IFJA 5HP5A 5DT1L 1SOSA 3IXAA 2OP4H 3GMNB 2HJFA 3MV7B 2OLDA 2E46A 4KMTH 5HGGS 3MRHB 5DO2D 2KLSA 1N2RA 3E8UH 5C92A 4JCMA 1EAPA 2XTLA 3MJ8A 2QPFA 1H3PL 4A6YA 4ZFOL 3CSTA 3PWPB 4HC1L 5D2NA 3L3IA 1L6PA 5E08L 1PVHA 4CU8A 3EYOB 4KJWC 3UZVA 2I32A 3TA3D 4ZPTA 1EERB 4ZMAT 1CDJA 1BFVL 1K3IA 5DK2B 1ZY9A 3VGEA 2WLHA 3P54A 5MENA 4G72B 4ONGL 1SBSH 4EN2A 4DN3H 1HE8A 4UU9A 4IBUA 5KVDH 2VLJD 4ENEC 1F97A 1ETJA 2FATL 2NMSA 1Q9LB 2GYSA 3V5KA 2PXYB 2EDEA 1M7IA 4KNSA 1JF1B 1I85A 4TNVF 2MHAA 4ECNA 6FABL 5J3HC 4HS8H 3A4AA 4B7LA 4ZQTA 3QQDA 4PWKA 4PB9L 1Z9LA 4HXAH 1HZHL 1J1OH 2IIJA 1E5CA 1NCWL 2YUZA 3ARSA 1HYRC 4BGDA 1Q1JL 2YUVA 3QEQD 2ZYRA 4U05A 4LLDB 4DKAA 3HG0A 5ITBH 1S9WA 1MCKA 3PJNA 1NKRA 2J2ZA 4MFHA 2HT3C 3QRGL 4ZUWA 1HK6A 3VWKB 2DLFL 1NCJA 2A77H 3IS0X 4JFZL 4M6ML 4TQEL 4JPIB 1FCCA 1SDDA 2H41A 4GRMB 5JNYB 1FVCA 2X4RB 2DWYA 2JCCB 1I82A 5D1QC 1EHLH 4EMZA 5DUJA 5DEJA 5CINL 1P4IH 1KBBA 1FUNA 2FO8A 3D39D 2GTQA 3VFPA 1F18A 1QYGH 3MO1B 4UOW1 4NQVA 5KN5B 2B59B 2NW3A 3U2IA 1UCBH 3GBML 3HG1D 2OI9C 4JG5A 2Y7QB 4APXA 2X1QA 3B3IA 5CCKH 3IFLH 4UQEA 4HS6A 4R7DA 3GHBL 1ZS8A 1AO7B 4JGUA 3EJRA 1JGVH 3QO0B 4ISVA 1QVOA 3OWEA 3U1QA 3WIIH 4JQIH 2YWYA 3UZQB 5LBSL 4PV9B 3VRJA 4PP1D 3O2WH 4DZ8A 1I7TB 2IMNA 1PYWA 3CIAA 4YNYB 3L4UA 5JIDA 4PVMA 2KERA 4UTAH 4A39A 4OH2A 1HJBC 4KKLD 1X5GA 5DD3H 4XNDA 2K6WA 3MAWA 1XD0A 1GGBL 1JWMB 5E8EA 4HIJB 1VFAB 2XTJC 4ZW5A 1RJYB 5FGSA 4ODTH 1WISA 3UX9B 4JL1A 1TMCB 3N50A 4UQ3B 1TYJA 3BISA 3K6DA 3O6FC 2J55A 1RK0B 4AYEC 2DMBA 3QDGA 4GSRA 4HWBA 2OMBA 3HIZA 4BRJA 2BIOA 1YECL 1HWHB 5HHMD 4QWWC 5E24E 2P80D 1A7BA 2W9EH 4WTZG 5E5RB 4GI8A 1VFBA 3HR5B 2VXVL 3A24A 5B1AB 1M7DB 4W1TA 4HGWB 3EYUH 4MNHA 1P2CB 3MJ7B 4OCYH 1QACA 3IGLA 1JNNH 3NDYE 1ZCRA 1GHFL 3NJHA 1CO1A 3KYAA 1CF1A 3BWUF 1BD2B 4MD4A 1NBYA 1X5XA 2HJKB 2YQ3A 2FGZA 2QGCA 5HHNA 3VI4E 3GMLA 4R4ND 1U36A 1JPTH 3UTZB 4YK4C 1JNHB 1KLUB 5AWNH 5JIQA 2YJQA 3BMWA 4B41A 3FQRB 3BD4A 1U0QA 4XZ4A 1YEIH 4M8QA 2ZX5A 2G75A 2B1AH 4N2IA 4ZOAA 4PU2A 2R1YA 1TXKA 5CLYA 3JYCA 1U92B 2VLJE 4S0SD 5DMGC 4NP9A 1G9HA 5LAPA 3VI3A 4KGLA 4I77L 4R7LA 4DPBX 3S35H 4G7YH 2X4TA 3U0PB 4HIIB 3RWFB 5I0VA 4X8CA 2V5MA 3FPXA 4I0PA 5SWSB 3GMMB 2VMCA 2D31B 1KTLA 2B08A 1ZGLM 2ORBL 3BX7C 1TLKA 3STLB 3RBGA 3ZGIA 2GBTA 5T1DH 1U2CA 5I73C 3PREA 3DHPA 1CDBA 1LQBC 3EXLA 2MTAA 4N0CD 4A2LA 2Q3AA 3P4MB 5F70A 4A67A 4TNGA 4HV8A 4NRZA 3KS0H 4WO4D 3GBDA 2ICWJ 3Q2NA 4NKQB 3ZYZA 3L08A 4HJUA 5BZXA 3U1SH 3PABA 3MRLA 4UV4L 4ZO7A 1NMBL 3MRFB 1TEGA 1TUPA 3F01A 3O4LD 1KSRA 3ARQA 4GBXD 4PPTA 1E6JL 1X9RA 3SJVA 2WN3A 3M46A 3IJHA 5J6GB 4HKZA 3D39E 3B2VH 3VMPA 1NAKH 3WFBH 3L5IA 3RIAK 2WUCL 3GI9L 4LB8A 2QLVB 2IWGA 1KXTB 1QWNA 4KTEL 2NY0C 4I18C 5TK2A 4I7ZC 3K1DA 5FOJA 3V4PH 5ANME 4JN2B 3V2AR 4G8GA 1UD2A 4H26A 1MIEL 2XBZA 4OLUH 2QVIA 4HT1L 2ICES 5HI3D 3UJIL 1SEQL 3TVMC 5IB4A 1R5VA 3BZFB 2V3FA 3SYAA 1JGLL 3DX4A 1S3RA 4PJIA 3PGDA 4FE9A 1E8ZA 1ZHKB 2DY2A 4PB0H 4MXWH 2XXFA 2XWBA 2PETA 3RKDD 2YA0A 5GJTL 4JCLA 4RDQG 4JRYB 3WY2A 4ZMWA 4EQ2A 3DTXB 3MX0A 3W57A 4BZ2H 4UV7H 1IFRA 2F1BA 4Z3HA 5CFAA 3BIAX 3VFWA 1GH7A 3L3DB 2EDWA 4ICXA 4BKTC 2OR7A 4H1LH 3G5XB 4HUXB 2RGSA 2EE2A 1LQSR 2BZDA 3MR9B 5CXPA 4N2BA 3DJRA 2TSBA 3HN8A 4AG4H 4K9EC 4AL8L 1MHCB 1XDTT 4OJDH 4B9CA 2AXWA 3T6VA 2OMTA 3P3YA 5IT2H 4R7XA 3GMQB 2I85A 3MOBH 2ID5A 5AUMA 4ELMB 1BFSA 2HXAA 1Y07A 3V4LA 1G9MH 1CXLA 1S9VA 2IFFH 5J89A 4FG6D 2CDFB 4TOYL 1ASPA 4MZ3A 2QHLA 3QT2A 4ZO6A 4HUUA 3BPOB 2E7LA 5E8DH 5F93C 2WCPA 3GJFH 3NFNA 4YSOA 5C0EA 1OF0A 1KTJA 2EVJA 5BRZD 2NYYC 1DDHB 3S3CB 5D7IE 2FWLB 2IDCA 1RVFH 1V8HA 4J3SA 1QEWB 3BD5A 5DQDL 3OR6A 3PWLB 5IUSA 3QRFM 4OZ4A 1YYLL 1CIUA 1DBKH 1S7RA 3VXOB 4EQ3A 2EP6A 1JZ2A 4HWZB 1FJ1B 3QORC 2R0LL 2HFGL 3MU3A 2NPLX 4N2AA 1ADQL 5I8KH 2OCFD 5AAWA 2MSPA 1EUTA 3FU7B 4N86A 1HHJB 2H32B 3WMQA 3ISWA 5I8CA 1SDAB 1W8NA 2X4QB 5LBGA 5KBPA 2CRYA 3UPCA 5ES4B 1JMZA 1IFGA 2PXYC 3RWIB 5D6CA 5EIQA 4IGBB 1P84J 2BSED 1INQB 1A6PA 3TYGL 2F18A 4KKAD 4JO4L 2W9DH 7PAZA 1HHIB 4R5XA 3SPIA 1LEIA 2DKMA 1QZ1A 1UWEH 1QBML 5HPMB 3L13A 1XF4A 1AOZA 1HIML 1UA3A 4XXCA 3UJTH 3MDJA 3X14A 5FO8A 4G7RB 1XGTA 1J8HE 3VWKC 3FO0H 3QW9A 1M1SA 4I18A 3O4LE 3W1ZA 1S7XB 4NQED 2LE9A 4HGKC 4AM0B 3EYVB 1H3GA 4IU2A 4OCRL 4EIUA 2DQIH 2R29H 4X4ZA 5C86A 4PLJD 2J8UE 3BVWA 4ZDHA 1RHFA 3BKJH 1QBAA 5EFIA 4PRBA 3TVMA 5DFVD 5EZJB 3V0VA 3WNJA 1BVKA 3AS0A 1GTNA 3CZFA 2Y2YA 3DV6A 1Q72L 3V9FA 3DGGA 3HNVL 4O4YH 3FMGH 4U1KA 4ODSH 4NRYB 2Y7LA 5IQ7H 1AD0A 1ZIBA 1NPUA 4CVXA 3KPMB 3KLHC 4JHVA 4AJYV 1RIHH 3A21A 3G9VA 2H2PC 3KVPA 2QQLH 3U2JA 3PHQA 3N0AA 4FADA 1EFQA 2QR0B 3MGAA 5GIRA 3BD3A 4YDKH 3T2QA 4XPTL 2Q8BH 4JK0D 5BMFL 1AE6H 2Z3FA 4QY8A 1EZUA 3S34L 1UOLA 4YHNA 1URLA 4JREB 5CWSB 2RAMA 5AW5B 4LLVB 2VDLB 3V8OA 4MLSA 1X7TA 2OAAA 3BPCB 1FVEB 1NFDA 1NEPA 1Q9OA 3RI5K 4G8FA 3B8YA 3VCLB 3PGFH 1U3JA 2Y07L 4MA1B 4U1MA 3WS6A 5KYYB 1OSYA 4TUJA 4E41B 3TBWB 1TITA 4KRLB 4L4TD 1KIPA 3O3UN 1OPOA 4XB7A 4AIZA 4MRCA 5TDOB 4Z76B 1NINA 2E3VA 1D3CA 1I8KA 3X1BA 3QDJD 1IM9D 2A9MH 4MNQD 3ARRA 5AZ2L 4OZHB 2FX8L 3WFCL 1RUPL 3GMNA 3MV7A 1R3LB 1UACH 2DQDL 3MRHA 5JR1H 3VI3F 1JV2B 3HNTL 2NR6D 4Q6IB 3UTSB 2VN4A 2WWNA 3ZIMA 4PIBA 3HMXH 5G2NA 1UUNA 2WKLA 1WITA 3WG7B 2BHZA 3PAVA 3Q6FA 4L3AA 1BEXA 1CXKA 3DXAB 5BRZE 4G83A 1OAUL 3EYOA 1CR9L 2I9LB 4FYSA 2DMKA 4GG8B 1WIPA 1RUKH 5DR5L 4LCIL 1K6QL 5F3BB 1OEZW 5D4QA 5KSUB 3NEOA 1X9UA 3KAAA 2Q10A 3MMEA 2AITA 1JGUL 4FHJA 1HNYA 1ROCA 2AVFA 3DETD 5EORL 1MAKA 5CGYD 2N7SA 1CD1B 1OCWH 4NM8H 5EDSA 1Q9LA 2LGNA 4FLQA 4KHTH 4QT5B 1T7XA 1IZKA 1JF1A 1NGQH 2XDHA 3FQ1A 1G9NC 4V1DB 4Y0GA 3GSWB 4Z7IA 3CC5B 2JQMA 1BA9A 1GW6A 5I0DA 2NRDA 4XZUA 5ICZB 2XFGB 4G5ZH 3STZB 1DVQA 2EC9U 2N01B 1XHHA 2KZWA 1PAZA 2ZNXA 1E7UA 1OSPH 2VYRE 2F54B 1ILUA 2Y1AA 3QB7C 1IRAY 2A6KA 3QCVH 5JHDA 1N26A 4JPIA 1I1AB 1B4LA 4YQXH 2EYTB 1ACXA 1PY9A 1FL6A 2EXWD 3ABLB 2X4RA 3M8OL 4FQIH 2JCCA 2CR3A 4WWKA 4QJ4B 2IWKA 4FQQB 2QZQA 4NQDE 4PJIF 4LP4A 1MREH 5DD6B 2ZG1A 2X9WA 1S7SB 3U83A 4DN4H 4CNIB 5FYLD 3GZOA 3RUGA 2CHZA 3RTQD 4WV1B 2B59A 5KN5A 3T5WA 3B2DC 2VDMH 1XT5A 1SFHA 1SJHB 5JZ7C 3SDXA 2Y7QA 1DCLA 2FEEI 3BAEL 3ULSB 4JDEB 3K2UL 1TJIH 5I6XB 3TV3L 5KW9H 3PQYA 5EBWB 4Q56A 1AO7A 2Z8VC 1N6QL 1IGJA 2X0WA 3QZPA 3NSFA 3UZQA 3GHEH 4KKCD 5IVZB 5SX5K 3ZE1E 1I7TA 2NY1B 3INUH 4YNYA 1CFVL 2XJKA 3FFCD 4K7PL 4K7PX 3I50L 3QULA 2BCMA 5GGSB 2PCFB 3BP5B 3SE8L 3CK0L 4KKBD 1QFUL 4ZUTB 1W0YT 4I1PA 2IGFL 2DI9A 3KYKH 2DAVA 3U6RB 5E4EB 4MJJA 3N3EA 4U1LB 5DHXB 3FTSA 1YCSA 1RJYA 4KPHH 1BJ8A 5MEPB 1QD0A 4DTGH 3TO4D 3ABKB 2CIIB 4GXVH 5IBUB 2DL9A 3PDOB 2JB5L 5F9WB 2BIIA 1GOFA 5DLLA 2WZPA 2J73A 3FAWA 3X17A 2VW4A 5JIIA 3TFBA 3EH1A 4K23H 4YBQD 5CILH 4CU7A 4L4TE 1ERNA 1QSFA 4NHUB 4XGZA 3U46A 3QEGL 5CAYB 5C0FB 2GI7A 1OAQL 1AXIB 3QDJE 4RCAA 1KDJA 4Y5VB 1U8JB 3HR5A 4U49A 5DUPL 5HDBF 2GITA 1F56A 3U9PH 5ADPL 1MCNA 3ME0B 2XIBA 4X80H 2BSBA 4WTXA 1H6UA 3MJ7A 4GSUA 4K7PY 1EX0A 1A2YB 2YEQA 5C97A 1T1ZA 4A7SA 1BD2A 1LE5B 1FRGH 3REVA 1A1OB 2HJKA 1P5VB 1ZD6A 3BI9X 3WTWA 3BPOC 5ANHA 3QWNA 2R15A 1MI5B 4FZ8L 3O8XB 1YQVL 1FGVL 4NO2B 2CKNA 1A6TB 3UTZA 4MA8L 1FYTD 5E6IB 1S7VB 3FCBA 3FQRA 1TJGH 2GT9A 3IYLW 1WZAA 4N2DA 3QA3B 1OP9A 1YAIA 4QRBA 2ENYA 2HT2C 3B6SB 4KTDH 5D4HA 1U92A 5LDSA 2KS0A 4BKSC 1BZQK 3NCJH 2E7MA 3FPYA 4TQIA 1IC0A 4NBXB 1DBAH 5BJTB 4PTUB 5D7JA 5DQ9B 3BYTA 4OGAC 4POUB 4PRAB 4HIIA 1CFBA 3RWFA 3SGDI 1R5WB 3U0PA 3N44B 5EZIL 4Y4KD 3TA3B 2AXJA 1Q90A 2PTVA 1GOGA 2D31A 4WFED 5TFSH 4GAGH 3U4AA 1RHHB 5GGRB 5GRXG 2NQDA 4L37A 4X6BB 2BK8A 1SVBA 3SEPA 4Z7WE 1ULVA 4UIMB 2WO4A 1E9QA 5FA4A 4AY0A 1MCFA 4R7NB 3SQRA 3TJHC 4P5SA 5JUEL 4YMPA 4IGBC 1HX0A 3VYOA 3DPDA 2GJZB 1C7TA 3HC4H 1D5RA 4XNUL 3GXDA 5L8KB 1MNUH 4HX1B 1AZNA 1CDCA 1ITCA 1WCQA 2PYFA 5HYIA 5HGAB 2PW1B 2A1WH 5CJOH 2PR9A 3MSPA 2EUXA 2IOIA 4FFZH 2BP0A 1MJJB 4QDGA 1ORSB 1FZMA 3KYMB 1KXTA 5BW7C 2DYPD 4Y9BA 4AIEA 4EOWH 2HX7A 2GUOB 1NFDF 2CKBH 1E5BA 3HMWH 4P2QA 4RVBA 3VM7A 3ZR5A 1KCSL 5E2UH 5IB2B 1EAOA 2V8MA 1MCJA 1MNNA 3JVFC 5DUML 3BSGA 2JLPA 3J07A 3BZFA 2XQYG 1JI2A 4FYTA 4K0OA 4WHYG 4Y9CA 3N43F 4OZIE 1KY6A 4XVUD 3VXUB 1A7RL 1HXMB 1S5IH 4KRPC 2BS8A 3TT3L 3H3PL 2WSDA 1ZHKA 4GUPB 4MJHA 3CFKA 3VXME 5L6YL 3QJQB 4QOKB 5EN3A 4OAWB 3BVTA 4ORZC 1EDQA 2BOLA 3ORJA 2GSGB 3ARBC 3DTXA 1ZRUA 4RWYL 4TSAL 3VYPA 5IEHA 3BKMH 4XVOA 5INDA 4NOBA 2WK2A 4JREC 4PLKC 5HYFA 1OTTD 4OM0H 1MHCA 4JHWH 4RMRA 4LP8A 3FB6B 4OBSA 5KTEL 4Z23A 5HJ3B 3CSFA 1DTUA 4K3JL 4MA1C 4KV5E 4AGNA 4ELMA 3U0WL 3V0DA 5KSAD 4ODVH 3B9DA 1KCWA 5GS0D 4XCCH 1AJ7L 3CVDA 2Q86A 3VMOA 4BZ1H 5BS0D 1RQ5A 4FQHB 2DQEH 4M3JA 2IG2L 4NO5B 2XY2A 5HI5D 1DJYA 4OJYA 4F92B 4U4IA 4I4WB 5T1MA 1D5BB 5F3HA 2YD4A 1DDHA 4XB3A 1BQLH 3IFNH 1AXTL 1LWRA 1RZGB 2ADIB 3QCTH 4MXQD 1E9PA 4KZCA 3ZT6A 5HHMB 4N20A 4KZEL 2QADD 3L9BA 2XKUA 4XWGL 2UUDH 4WCYH 1FYTE 4DKTA 1W8EA 4ADIA 3I9GL 3THML 2XXGA 4FQCH 3BZ5A 3VXOA 4D0DB 4IM8A 4UM9A 1FJ1A 1NANI 2JCCF 2Z1PA 3H7BB 2V3DA 3SYCA 1JNLL 2X1XR 3KPOA 4YXHL 4Y19A 5EZOH 1GTFA 2FNBA 5DZOA 4TVPH 4NYLB 2H32A 4G2AA 3II1A 5B7FA 3TU6A 3K74B 4QPEA 3ZHDA 3EDEA 3EYSL 4LLMB 5TJWK 5FYJE 3RWIA 3MBXL 4IGBA 3VD3A 2ESVB 3ZO0A 3MRCB 4QRTB 1BEYL 2QQNH 3IU3B 4HPYL 1INQA 1VCAA 3INOA 3DVGA 1HHIA 4HMCA 2BWIA 1MRCH 3M07A 3PU7A 4QNPF 4CGUB 4APQB 4O5LH 4F5CE 5AKVA 2P8MB 3IWVA 1F4WL 2AANA 1QRNA 5DRWB 3MRQB 4AITA 3HRZC 2OK0L 4UDUB 1G7JB 5BW7A 1S7XA 3SDDD 3C5SB 4S1RH 4M7KL 2AJVH 4FFWD 3EYVA 4PWFA 4ETYA 3ATDA 1JHKL 3N41F 2KH2B 4KX7A 4NO0B 1MFDH 1KWKA 3NESA 1XB6A 5D7LB 4YHLH 5B3SB 4KZDL 4WV1C 4I1NB 3MXVL 1HT6A 2AZAA 3BCFA 2IH8A 3EBIA 4WHCA 1CXEA 4AYID 4GBXB 4MA7H 1OP3H 4HVBA 5I6XC 5KVDE 2CO1A 5HGAA 3L9YA 1CL7L 3JTTA 1ET5A 1UH3A 1P9MC 3T9WA 15C8H 1HYSC 3TH2T 5L8JB 4XBEH 5I1IH 2NY1C 1N7ML 2NY5C 5FDYA 4L18A 1G5AA 3QI9B 4H8QA 4MS8C 2WCSA 4LASH 3DX3A 1XCXA 5CWSA 3WKMH 3BN9C 4LLVA 1TJXA 2R56H 3LPGA 2EC9T 2QDWA 3LNFA 3BPCA 2HFEB 3S9DB 2RTTA 5F9OH 4QHNB 1KEGH 5HGHB 2XN1A 3VCLA 4NSKB 3O6KH 2XX0A 5KYYA 5E4EC 2EDFA 5FO7A 2WQAA 2JKXA 3ESMA 4KDWA 4Y9FA 5DK0A 4KQ4L 1MWAL 1TQWA 3V7MA 4Z76A 4LLYA 5TDOA 1JZGA 5DHVB 2E8YA 3AMLA 3C9NB 2NY6D 3H2PA 5F9WC 4MHHI 2F0CA 1EEZB 4RETB 2F5BL 4PJCA 5T3ZH 4JPVL 1E28B 1KN2H 3HS0B 4JQXC 4YIQA 5AZEL 3MC0A 1NCNA 5JW3L 5A3IC 2CDEA 2VJ0A 3MCLL 4OD1H 4RAHA 4PWJA 1IC4L 3ERXA 2HMID 4Q6IA 3UTSA 3GGWB 4KKPA 4PBXA 4YHKL 5BS0E 4Y5VC 5K1NA 1GPOH 4JUTA 5DS8A 1QUNB 1T3FB 2I9TB 5EV7A 1EIBA 2NXYD 4POZC 3OB8A 5BCAA 5LQBL 3DXAA 2EEBA 1ZANL 1RD6A 2I9LA 1U93A 2RB8A 2C7UB 2Z7ZA 4GG8A 4XMZA 3WI9A 4WNSA 4EPSA 1YEHL 5E5UB 5F3BA 3LN4B 3ARDD 2DWTA 5ECGA 2OSYA 5FGCB 4R90L 4PHZA 4F2MB 4OT1H 4QT5A 2QBWA 4XE0A 5E6IC 1ZLDA 4JKLA 5FYJL 5FECB 4NNPH 2QSTA 4A55A 4V1DA 3GSWA 4ZFFB 1GC1L 1MW0A 3CC5A 1L7IH 5GSRB 4PGBA 2R4SH 4XP1H 4GXFA 3IGAB 2BH0A 2YD7A 1K4DB 3HOGA 1PDKB 1WZLA 3NCWA 4PJ8A 3STZA 2KZKA 1J8RA 3GDCA 2K7PA 3BIBX 4JFEB 4JS7A 4XMTA 4TRPH 1U4FA 4KMTL 4GLRI 3WEAA 2BX5A 5E03A 1TO5A 3TA3C 1DSYA 2ZAIA 4L5FH 1I1AA 4LLUB 5HTSA 4PV8B 3WD5L 4LSRL 2OX5B 4A7GF 1FZOA 3UTPE 2AK4E 2XZZA 1RV6X 1T5KA 4FQQA 4QHUB 4YSCA 5DD6A 3OKDB 3CHPA 1HILB 3CSYB 3ZTEA 2UWEE 1S7SA 3KD4A 3QS2A 4PJ7B 5EBMA 1CTNA 2FX7L 1MH5A 3WN5B 1FG2B 4NZDA 1SVZA 4JZOB 4WV1A 3ZN6A 4UTBA 2Y6TE 5SWZB 3MGOB 1EXUA 1SBSL 2AFNA 4KFZC 3O3DB 1WDAA 1X5KA 2JB6A 2WBJB 2ZXDA 1JFQH 3ULSA 4JDEA 2A4CA 3WNIA 5EBWA 2VCOA 3A0OA 2Z8WC 3HZMB 3PV7A 3T0AA 3F5WA 4NUJB 1IX2A 5IJVA 1P9MA 3NJXA 3LIZL 1JBJA 1HS6A 3DRTB 4N4YB 4HDIA 3TZVA 5IVZA 5BRQA 5IROD 3U7AA 3RX5A 4M1CD 4ESKA 4ELMF 1WBYB 3AJ7A 4KKZA 3QUZD 4ZUTA 5F1SA 5ITBL 1C5CH 3GBEA 1KXQE 1NM4A 2B3IA 2ZX6A 4D7BA 2A77L 5EOTB 4U1LA 4NNXB 1SLVA 3MLZH 5IB5B 1QLEB 3ASOB 1LK3H 1U3YA 1RZ8B 2GTZA 2PYED 2B1HH 2B77A 1P4IL 5KSVB 2W88A 1EZLA 1QYGL 2Y5EA 3MV9B 2VR7A 5DVNA 5GRYA 3BGFC 3APMA 1NL0H 1UG9A 3KM2A 1HNFA 4G42A 1UCBL 2WGXA 4PP1C 3EH5B 5IHUH 1CJYA 4BM7A 4H4NA 4PMFA 3JSSA 1AGDB 1PQZB 3IFLL 4M02A 3IDNB 1EJFA 2HVJB 1DVTA 2DQJH 2GJ6D 1JGVL 4PY7B 3WIIL 4JQIL 4KKLC 2J1XA 3V4VL 1RURH 4WI0B 3DPBA 1SQMA 3BW9B 4N8CH 1BWWA 3D25A 3ME0A 4S1DD 2ERJB 1WWWX 3C8HA 4UTAL 4F80A 5I6PA 5EUOB 1A1OA 5CP7B 1P5VA 4X6EA 5C6PB 2BWDA 4PYGA 1GZPB 3O8XA 4TLSA 2XWTB 4NO2A 2IEPA 4JFOB 4GP5B 4N2FA 2DLHA 2JLLA 1S7VA 3WDJA 3UJJH 3LHPH 3UTTD 4C8XA 4J3VA 1EFXB 3PCYA 2G9HB 2UYLB 3H9HA 3VU2A 3QA3A 2HKHH 3B6SA 2EDMA 1KDIA 1U30A 1MCRA 3L3JB 3LN9A 3GSRB 2WJ5A 4MRBA 1CVSC 4KXZI 3RNQB 2BNRA 4PTUA 3BDYH 1KIUB 4PRAA 4JQVC 1G87A 1R5WA 3O0LA 4WI2A 5JHLL 4U1IA 1H19A 4NPYB 5GQBA 3LS4L 2PWHA 2VLKE 5GGRA 2XI9A 2NXZD 3V5HB 4BK5C 4X6BA 3R8BB 2EE3A 3OAWA 1ZIAA 2L0DA 1I3RA 4ZMVA 4UIMA 1PD1A 4N87A 1GGCH 4B0MM 1KG0B 1CDYA 1G7HB 4R4NC 4FTDA 3LN5B 1JNNL 3OKNB 3C60B 4GO8A 4D7PA 2GJZA 3ZL1A 1FLRL 4GAJL 1I3VA 1UOWA 2PW1A 1DQDH 5KSBF 5MP6H 3RWDB 5FUCC 4APQC 1Z3RA 3W56A 4ZFQA 4HMEA 4QHPA 3BZEB 1YEIL 5D1XD 1C12A 2OMVB 5D93B 2UZPA 3MJ6A 5A1AA 4U3XA 4X2UA 5IBLD 3V4UL 5DRXB 4C55A 2GUOA 1S9KC 1GR7A 2LFEA 1V5JA 5EIVA 1E30A 2RIKA 2YN3A 5IB2A 4BXVA 3I2CH 3S35L 3QPXL 5B1JC 3S35X 3VGHA 2C3HA 5KJ4A 1WTGT 2EO1A 4OI8A 3Q8BA 4PRDA 3FQ4A 3R19A 2EZ0D 3V6OE 5I75B 3VXUA 2ZWZA 1M6UA 4F7PA 3T8MA 3SBRA 1TETL 5EEWA 4GUPA 2YUWA 2B16A 3QUXA 1CZ8H 1OZTG 5I76B 4QOKA 3P30H 1WD9A 4GBXC 1MFMA 3LNDA 4QO1A 1LILA 2E7HA 2IPTH 4BGLA 2YEZB 5FHAL 4E9QA 1S5HA 3F12B 1AFVH 2H6PA 4XO3A 4OUUB 2L8AA 2VUOA 2H1PH 3MJWA 4NQXA 3UBHA 4FA6A 5BZDB 5DF0A 2X89A 1NCIA 5HHOB 3QE5A 1KGIA 5HYJD 4JG1H 3QI9C 2KZBA 2PYEE 4KXBA 2HAZA 3QUYD 3I6KA 3ET9F 1IJNA 3WFBL 2CGYA 4BK4A 5EEVA 2JKNA 2Y3AA 4N6QA 5HXMA 3CFQA 3PL6D 4I48B 5HJ3A 2ITFA 4P2AA 4F57H 4E42B 4XAKD 2DQHH 1WZMA 2BFGA 2JK5B 1AS8A 3IU4L 2VABB 2G3MA 2GJ6E 4OLUL 1UTDA 4RGNB 2LABA 3DX6B 4J6RL 1DL7L 3RKDC 5EOCL 3IBEA 4ODHH 3RGVB 2JXMB 3ZDZB 5DJXB 1Q94B 4XOAA 1RZKL 1D7FA 5E4AA 3APFA 3VFUB 4FNQA 4JPKL 1N6UA 4MHHG 1D5BA 3DVNB 4KJQD 3ZTNH 1FIGH 2IDSA 3VXRE 4PB0L 1RZGA 2ADIA 1MJ7L 4MAYD 1TCRA 4ZUVA 4AXWB 1G1YA 2C26A 1D7BA 5GZND 2DDQH 1N12A 2MNJB 3B9KA 2BVOB 4KKQA 3UBXI 3UTTE 5AOKA 2PTTB 4UZGA 4AEEA 4PLNC 4HJEA 4FTVD 1L9RA 3TFKD 1SXNA 2SODB 1XCTB 3H7BA 3ECBB 4FG6C 2E8ZA 4HEPG 4EIZC 5IT2L 3AMKA 3AQZA 4EZLA 5ETUB 1ZA6B 1HCFX 3A67H 4ZUSA 3APNA 4LLMA 5E1IA 4O02H 5F9AC 3BEVB 2ESVA 4V2CB 2AC0A 5TE4L 3MRCA 4QRTA 2X10A 1AKPA 1MVFA 3MNWA 4XP5L 4RDQF 2VERN 3LMJH 4EN3B 2F68X 4LSTL 1IEHA 3DUHA 4YWGH 5JLZA 5E8DL 3SZKC 4YFLI 2PKDA 5GRZA 4APQA 2P8MA 5KSBE 1KN4H 4KK6D 4XNXL 3MRQA 4FEIA 1XR8A 5DRWA 4UDUA 1G7JA 3C5SA 2EE0A 2V2TA 3GXIA 5HI4D 2HLAB 3SYOA 3Q05A 4IRZL 1A14L 3CX5K 4MCZB 1UYWL 1DBKL 5AYUH 2P43B 3Q9QA 4P5MA 4YLQT 4NO0A 5IIEB 5D1XE 3GBLA 4LQFH 4BFOA 3WN5C 1E4KA 1QLRB 5D7LA 3S48A 1EMTH 4XP6H 5I8KL 4ZAKD 3VVWA 1GJIA 1RJZB 4PS4H 1IC5H 4KU1A 1TQVA 2HPTA 3RB7A 5AVRB 2VZOA 5C07B 1AS6A 1KFGA 1N4XH 4OQTA 3RBSA 4J6IA 4FCHA 4HAKA 4YE4L 2WO3B 3PPEA 4OTXL 4G80A 4E9SA 3ESVF 4S1QL 4N2GA 2DYPB 4P3CH 2W9DL 4UQ2A 4HHGA 1I7ZB 2YAPA 2JJUA 3SDYL 3U48A 2LTQB 5E6YA 4QHNA 4QXTB 5HGHA 5ELIA 1VJSA 5DFVC 4NSKA 4ZTOL 1SLXA 5B39A 5A6IA 5DJYB 5HYJE 2AZUA 3FH8A 1UFUA 3P9LA 1YEGH 1TTRA 2DQIL 4PJBE 3ARWA 1JPST 4CSZA 2CD0A 2WM0A 3BKJL 2XN9D 2AW2A 3C9NA 4HH8A 3UGUA 4BH8A 1KCRL 2VLRD 1LO3L 2WGNB 4O4YL 3HKZA 4TUOA 1M57B 1IAOB 3B83A 2NCEA 2FK9A 1BPLB 1ACYL 1E28A 2AJXH 1YVLA 3HS0A 5IQ7L 2BRRH 2CO6B 1DVSA 5KYXA 1HSBA 1KELH 4KRMB 2PP9A 4U6YB 3O45A 1PGRB 3GGWA 2ZNWA 2D2OA 3FH5A 3KLQA 2XT1B 3N44F 1QUNA 1T3FA 3DHJA 4R4FH 4YDKL 2O5NA 4YSPA 4AV0A 3IXTB 2ZSVB 3K91A 1ZEAL 4RBPK 2C7UA 2ERJC 1JPSH 4B60A 4P04A 4ZNCD 3KJ6H 3AT0A 3LN4A 2MNUA 5ICXB 1MPAL 4F37F 3FQXB 4P23B 5F7DB 2QTEA 1TZIB 4HQQL 1MCQA 1TCMA 4PG9B 4AYFB 4FTVE 3G6JB 3HUJE 4J2XA 4A2FA 5IWLC 3MCKB 4Y4FA 5FECA 1MY7A 2WQ8A 1F13A 2IMMA 2P5WA 3L3KB 3M45A 4ZFFA 4Y88A 3MNMA 1INEH 4MJ6B 3HE7A 4OCLC 4AIXA 2X1WL 3FUIA 2ZTBA 4HLZG 1ILSA 1KTBA 2NQ3A 3MRMB 2WLIA 3NRQA 4O2EB 2JIXD 3FAXA 3SE6A 3CBRA 4NIYE 4JFEA 4PJXA 2ODHA 3HAEG 3NJNA 2IPKB 4ZBJA 2BIPA 4HCIA 4XMKH 2NQCA 3O2DH 5AKRA 4RMUA 2XV6B 3TC9A 2XNAB 1U8PB 3H3KA 4PV8A 4RZCB 2OX5A 4WTWA 1OLLA 3D2UB 3BP7B 3D9AH 4NDMA 4QHUA 1IGCL 2N59A 3OKDA 5JW5B 2XV3A 1HILA 2XQYA 3DWTA 5D9SB 3U25A 3WN5A 3C60C 2P45B 4U6VL 3RJOA 2N56A 1FORL 5SWZA 3L5WA 3MGOA 3QXDB 4JFDE 4C54A 3IAGC 3O3DA 3U36B 5HY9B 2E0PA 2WBJA 3QUKB 2YAQA 3QYCA 5KBDA 2L7EA 3ZU8A 3HZMA 2CHXA 4KHTL 4CDGC 4M56A 1FHNA 4UINH 5L2KB 1VACB 3KLDA 5D93C 1JWUA 2A73A 2J1KA 2X09A 3K6NA 5IG7B 1KBVA 2DOCA 3SDDB 3HS8A 2OJZH 2HP4A 4G5ZL 3D85B 3VFSB 3IDGB 4KOCA 2P3YA 2K0RA 2VWEC 1TPXB 4R8WL 1U8CA 4HIQA 3DMMA 5EOTA 5I75C 1WCBA 3QCVL 4NNXA 5KBKA 1DE4B 4AWJC 2BVTA 3PUCA 4HF5H 4YQXL 3QPKA 4U1HB 4Z7QB 2BCKA 2YGPA 3NCEB 1LHZA 2P8PB 3TESA 1F4AA 3A6OA 5KSVA 4DN4L 4B5EA 3UERA 3CQFA 3E2HB 3ZR6A 1I4FA 1T6WA 4FJYA 1P5UB 3TN0D 1C1EH 3QSKB 2VDML 4GY4A 4KKCC 4M7LT 1NAMB 2ZJSH 3MGTB 3Q6GH 4PJ5E 1RZIB 2E4FA 3D6GA 2XN9E 3NABH 5HGDB 3SE3A 1PQZA 3IDNA 2HVJA 4L3EB 2VLRE 3DJ9A 4KKBC 2OCJA 4PY7A 4MXVE 4N0RA 4AV4A 4PRHB 3GHEL 3BW9A 4LRNH 1WA1X 3VD5A 5E7FA 3C5JB 4AQOA 3INUL 4XNQB 4KVCH 3OF6A 4ANXA 1TLMA 1WIOA 2WXPA 5CEZH 2IOOA 3EJSA 5KOMC 3TO4C 3L95B 5EUOA 5DGRA 5CP7A 1WA0X 4AX3A 3DBSA 2HH0L 3KH3A 3RGVC 2YN5A 2NY6B 3KYKL 2NTSP 2XWTA 2AMGA 5HHPB 1MZYA 4M7LH 4JFOA 1UVQB 2A6JB 2ZE0A 3M6DA 4JRXB 4YBQC 1V27A 2IQAA 1J0JA 5GRJH 1LO2L 4GXVL 1EFXA 1EZSA 2CR6A 2G9HA 5D2LA 2UYLA 1JNJA 2KKQA 3Q8FA 5IESL 3L3JA 1JTTA 4NKIH 4NFCA 4AQ8A 3HBQA 1DLHB 3RNQA 1O6VA 5JIKA 1MFAL 1VDGA 2WTPA 1KIUA 2MQCA 1Q9KB 2VJ8A 4LMQI 1JZJA 2JELH 4P46D 5B22A 1HTYA 2V0AA 3ARDB 5DWUH 2FJSA 2DMHA 1AQKL 3BN3B 3PHOA 3U9PL 5I6LA 2XHNA 3LS5H 5I74B 1KG0A 1OHZA 4X80L 3NCBB 5LWYH 1RKRA 3CLWA 5GSVB 1ZTXH 4Y9EA 1FRGL 1JG9A 3QR0A 1HDMB 2C9PA 3GSNA 1U95A 4FXGB 4EN3C 1P4LA 1KEML 3RWJB 2AXGB 4JGMA 1A6AA 5IB1B 2Q8AL 3RWDA 3LY6A 1AQ8A 3S3PA 2QEJA 5AB2A 1IC1A 1D2PA 1U58B 5BO1H 3B7TA 3BZEA 2BY0A 2WC7A 1PG7W 2OMVA 4R97B 4DHLA 2OZ4L 3TPKA 1TT6A 5DRXA 3BQUA 2P9RA 3PF2A 3VGAB 2P49B 3K0WA 4XN4A 3MBWB 5CSGA 5ITFB 5CN1A 2E5EA 5K9OB 3HB3B 3FRPG 1XF2B 1UXMA 4JL2A 3KCWA 4P4KA 1IIIA 1I8UA 3L7EA 1T80A 4RLDA 3QDMD 5GRVL 1JWSB 4R26H 3P69A 2LAGB 1CFTB 1PZ5B 4TVPE 2A9AA 5I76A 1GYWA 2DEYX 3IKKA 2YARA 3CHSA 1R46A 1U3HD 2YEZA 3F12A 4H5SB 1AANA 4MNGE 5TE7H 2HB0A 3UAJC 5BZDA 3D08A 2V17H 1ZVSB 3HC4L 2R7EA 4NKOB 4BSWA 4N2HA 1K8DB 1XXFC 2YGNA 2OA9A 1NPNA 2Y22A 2YPLD 4KJYB 4L8DA 3T8XB 5CJOL 2V9RA 1U91B 3RY5A 5DA0B 3VFVA 1X5HA 1BMGA 1BIIA 4CN6A 4I48A 2HVBA 3RZCD 4E42A 1NEZA 4EOWL 1RUML 4YSAA 4XVUC 2CKBL 1O7DC 2JK5A 3HMWL 3NN8B 3L4YA 5E2UL 1CN4A 1W72B 1OGAB 3ARGD 3PGCB 1J5OH 1KJ3L 3F65A 1U4EA 4LCUB 2ZD0A 3RGVA 3OGCB 5DJXA 1UT1A 4NN5B 4LCYB 1F8TH 3VFUA 1BJMA 2V9TA 5KANI 3WIHA 4GQRA 2X53A 3K2KA 3DVNA 2WXMA 4FFYA 4KI5E 5DRZA 1XGYL 4M9PA 5IJKC 4LMQE 1D5MA 3ABGA 3K2MC 4ZFOB 3SGEH 3FJTA 1CU4H 3ZL2A 4PJXF 1OTTC 1M53A 4MCNA 4FNRA 5C0DB 1AG0A 5DA4A 1IGIH 1YEFH 1Z9PA 2BVOA 3IPBA 1QHPA 4L1SA 3BKML 3AQDA 4P9HC 3HAEB 3QC6X 4NHCH 5HGBB 2EAEA 4LOVA 1JK8B 5C0RH 1WAEA 4XCFL 1FGNL 1AD9B 3ECBA 4I13B 2V9UA 4JHWL 1Z2KA 1S3KL 3N6YA 3NJVA 4P23C 4P5TB 3EOAA 1G0YR 3O3AA 5GS0C 4H8WC 3RGHA 1ZA6A 2GTWB 4HKJB 3WKNA 3ZHNA 1CURA 4D0BA 5HI5C 4TTGA 3DSNB 1NA8A 1T5XB 3GINA 4WY7H 4XCCL 3A6CL 1BV8A 4EN3A 1SF5A 4BZ1L 5DC9B 3GK8H 2DQEL 2WIIA 3GHPA 1OARH 1NOAA 1DBBH 4PRIE 1DQLH 2BOBB 4XNAA 4PJAB 5T3ZE 1IBDA 1QHOA 4AJ0A 1EXGA 2ZXBA 1DQML 1BQLL 1FV1B 1ZKAA 4PCKA 3QCTL 5CJQL 4DWHA 2J6EA 5HD8C 4YDMA 2VC2H 3GJFK 4K5MA 3T2NH 5JXAL 2HLAA 4TXVB 3FTWA 4MCZA 4LU5L 5IEKB 3NPSB 1I1CA 3ARTA 4LSVL 4FQCL 4WSGA 4WTQA 5CCHE 2EDHA 3O6LL 4QRPA 1QLRA 1OD9A 3LRMA 4BE5A 4IIZA 1PKOA 3QIBD 5E8OB 5E2JA 4TVPL 3CFTA 3RL1B 1BYPA 1YMMB 5CGTA 4XPGH 2WWOA 5EA0H 1RJZA 1LYQA 4X5RA 3S3SA 3CE1A 4B96A 3ZRSA 5HVHB 2FYVA 4H88H 4UF7C 4KUCF 1FAKT 3DHMA 2QGDA 3JT0A 3GJEB 4K15A 2CO4A 1BZ8A 3SOBH 3UAJA 1MFCH 3NSYA 3BH9A 5EF0A 5CMAB 5KVGL 3UEZA 4Z0BH 5FX3A 5GGVL 2FQGA 1N70A 2LQRA 2R69A 3SDDC 4Z3IA 3TS8A 4G7VH 5EO1B 2E47A 1TZ8A 3QXVA 1IKFH 2DMCA 1EQWA 1H0DB 4JY4A 1I7ZA 4MJIE 3ZTDC 4G8AC 1ZWIA 3ARZA 1IBYA 1TPXC 5I6OA 3KW7A 1KGYE 4QXTA 1ES0A 4S0HA 1MQKH 4B97A 2D03H 5I0ZA 2EYRB 5TF1H 3LPOA 4NENB 4YDVA 5EUOF 5K59E 4L5FE 2AJVL 3AXLB 1HN1A 1U9KA 1K4CB 4XXDA 4EI5D 2OMWB 3TL5A 4R3SB 4IJTA 2ILLA 4LL9A 1KTRL 4DO5A 3GPEA 3W0WA 3N42B 1CFSB 3FTXA 4XBPB 4X42A 3E2HC 1MFDL 1DJHA 4NJAH 1IAOA 2R8SL 1M9SA 3P3RA 5E9DD 2P24B 2ED8A 3H8NA 3R06B 4FQ1L 1O6TA 2Q7YA 5IJKA 4MA7L 1R5IB 1WBXB 1LD9B 1VEMA 3QUYB 1K8IB 4S1SH 3UROR 4X83A 1ZS2A 2VSDA 1MHPH 1TEYA 3FB8B 3IXTA 3WXVL 3VO0A 2P52A 3GTVA 5C6TH 1MCEA 4M29A 5GGVY 1YEKL 5I1IL 5I6KA 2Q76B 5T5NG 3VFNA 3WKML 4HW6A 5DRNB 3MQIA 1H3UA 5ICXA 4QXVA 3P11H 1AIFB 2H0JA 1KGWA 4JFWA 5F7DA 4ZS7L 3MBEA 5F9OL 5B4MD 3QXWA 1ZK5A 2NY6C 4PG9A 3C6EA 4AYFA 5FGBC 1P1ZB 3G6JA 3TNNB 3RA7H 4U6XB 2VMDA 2PPFA 1NCHA 2UX6A 3MCG1 3MLUH 1NQBA 5CHNB 1VFOA 1L9MA 5C2BH 4JB9L 3TASA 4LGSB 5D1ZI 2HMIC 1ZHLB 3VB8A 3PXHA 1XH1A 2CLVB 4AYGA 3ZKSD 3ECQA 2VE6B 4FN0A 2ED9A 2NXYC 5T3ZL 1J9SA 2FQFA 4JO8A 1KN2L 1RIVL 2G30A 2KUTA 3B7RL 2IPKA 1IARB 4TMPA 3C08H 5E00B 4OD1L 4KY2A 2XNAA 3DV4A 2AXHA 4IMKA 3LXCA 4RZCA 4UQAA 3ARDC 1GPOL 3D2UA 2H7WA 2XZAH 3US9A 4Z78B 4XB8A 3BP7A 3S5YA 3QH3B 1UOKA 3HCVB 5ILTL 1Q9WB 5JW5A 1UWGL 2VKXA 4OCSL 5I74C 3T3MB 3MJGX 3DYOA 3ZE0E 3OTTA 5D9SA 1QBBA 1P4UA 5B1CA 4KXAA 4J2QA 1A21A 3RVVD 4X7SL 3QJZA 1XGQA 3QXDA 1OE2A 2WKOA 5E2WH 4FXGC 2GG1A 1DO6A 3QUKA 1UURA 1WVZA 3C2AH 1N64H 3OG4B 4JRWA 4JFSA 3BUDA 1DQKA 1FPTH 5L2KA 5LUMA 4LVNB 2R23A 4ZQKB 3D0LA 4R97C 1CGTA 5C9KA 2R4SL 5IG7A 5JQ6L 1CLYH 1G6RL 4OF7A 1H8LA 3D85A 3VFSA 3CVBA 1DVYA 2AQ1A 4LSSL 4HGMA 5I1GL 4YPJA 3L3OB 3FH7A 2YLHA 1T20B 2CO7B 4N2KA 3OBAA 4L5FL 1DE4A 1QSZA 4RMWA 4FXKC 3UO1H 3C5ZA 2AERT 4PY8I 3ZDZF 4ZAKB 5EEXA 2P8PA 2WYZA 3SIKA 1NCBH 5AVVB 1HEJC 7FABL 1CGUA 2GBVA 1CICD 1SYSB 2B15A 2X87A 5GISL 2OMXA 3DO7B 1F3RB 2VZTA 1P5UA 4FNTA 5GGTH 4AZ8B 4CKQA 2ZSWB 2VN6A 3AVEA 4POYA 3B7SA 2BS71 4N85A 1BP3B 1E27A 4HK3N 1J5IA 4YSSA 1NAMA 3MGTA 4EVNA 1RZIA 2DJSA 1VCBC 4XRCB 4IOSD 5A2KH 2XU9A 1PKQE 1AGCB 4PRHA 5E9DE 3L5JA 3SDAB 3C5JA 3KPRB 5D70H 2VKWA 4XNQA 5DDHB 3O0RH 2FT8A 2VO5A 3L48A 4N90D 4OFYA 3FRUB 4Y1AA 4LARL 4I3RH 2L7UA 4TSCH 5D7SH 5DD5L 4D2NA 3L95A 1VA9A 2DL2A 5DYFA 3QISA 4HEPA 1ECZA 4X5XB 2CZNA 1C5CL 5GHWL 3QHFH 4NQTA 2A2QT 1AKJB 2W0KA 4KDVA 4NZUH 3T4AB 1UVQA 1UADC 1FN4B 3P02A 3MNVA 3VYNA 2A6JA 4JRXA 2XVBA 3CXDL 5DVOA 3Q5TA 4L4VD 3L3HB 2DM2A 4OJEH 5KANG 3UIYA 4MSWA 3BJ91 2ZOLB 3BOVA 4YDJB 2FWUA 1YDPB 3RDTD 1T66C 4IU3A 4O2CA 3SYQA 1CVRA 4XBGB 1FA4A 2BW4A 1XMEB 1NL0L 5DSCB 1HHGB 3VXPB 2EIDA 4JKMA 5ADOH 4JNXA 1Q9KA 4M8VA 4F9PC 4OB5H 2GSMB 4S1DC 1E4WL 4M5SA 4YC2B 4F7TB 3U4EB 4P5TC 3PIQB 3GLEA 2YD9A 1JZ5A 2IXQA 1RURL 3ETBJ 3LRSB 4N8CL 2JQAA 1SY6A 4TF4A 4X9IA 4PGJA 3EFFB 3M1BB 5CJXC 4NGHH 4WUKL 4D8PB 3DIVA 1A4KA 1IIKA 3LSOB 1QHQA 5IHZB 4H0IA 3WJJC 25C8H 4ZW3A 5GSVA 3B2UD 2K4AA 2Q7NA 4K9EH 5FW8A 2JNZA 5J5EA 3I9PA 3RWJA 2AXGA 4X6DB 4YAQA 1WAAE 5IB1A 4Y4HB 1NZRA 1X9LA 3HPLB 5JOEA 2UZIH 1BDYA 2JTDA 3IMUA 5KVEH 2E6PA 3KVQA 2HUEA 3AREA 1OAZH 5KJ7E 3OKEB 2LAAA 5ITFA 4PAZA 3MBWA 1YJDC 5IBTH 1IEAB 3NPSC 1XF2A 3MA9L 4AE0A 2F58H 2XA8H 5FYKU 2YUXA 4LO9A 1A0QH 4ANKA 4IS6A 1O6SA 2WLZA 3HJ0A 1JWSA 3E1ZA 3SO5A 3EO9H 1O0VA 1PZ5A 2AXFB 4BA8A 1B9ZA 5HVHC 3QNFA 1AMYA 4UT6A 1AHWB 1G6VK 3MCYA 1GGCL 4X6CB 4XO5A 3VWJA 2JSFA 3VX0A 1FBIH 3KZ8A 2EH7L 4RMVA 1QMUA 4C57C 4N68A 4PCYA 4NKOA 4MQTB 3VFTB 4DF9A 2WUBH 5JIMA 1YEEH 2F2HA 1K8DA 5DO8A 2ZG3A 1JOIA 2UY7B 3T8XA 3KGRA 5MP6L 1G43A 1U91A 1CFNB 4ZW6A 1MCLA 4PS8A 3F7YB 4J39A 2M26A 3ZDXE 5LCVL 4HAFA 2P5EE 1E67A 3KWXA 4OCMC 2VRKA 4KXDA 3NN8A 1SFDA 1HHHB 2B2XH 4GW1B 3WEMA 3G6JF 5HDRA 4CA4A 2BXYA 3Q2LA 3I6GB 4O9HH 4HJ1A 5AZUA 3OGCA 1ITBB 4FP8H 5I1DA 2C4FU 3DX2A 5T1KB 3LH2L 35C8H 4IOFD 3HBGA 1NGWA 3J2PA 4N90E 3EJTA 3TEUA 1CZ8L 4ZFOA 1II4E 4BWUA 4CRPA 1R0AL 1FFOB 1BBDH 1JTPA 1A4CA 1MFNA 1RZFH 4HC1A 3QUYC 4I9XA 1R6VA 1OP5H 5C0DA 1AFVL 4PRPB 1UD4A 1XAUA 1DJZA 5I1HL 4LHUD 5BXFB 1UATA 1TVDA 1U8MA 1Z9MA 3GRBA 3SBQA 5J6HB 3HAEA 2NNAB 4F9PA 3NRPA 2O6DA 3R4RA 3X1GA 4L4VE 4QRSB 1BQ5A 1JK8A 1FVDB 3HA0A 4HJJH 2VAJA 1GAFL 1KENH 3ULUC 1TTCA 4P57A 1QSVA 4U0QB 4P5TA 1M2OA 3LEVL 4JY5H 3ZKND 3MTXA 5I1JH 5FS5A 2X7LB 2GTWA 3PJSB 3KS0J 1V05A 4HKJA 4BD4A 1FE8L 1JK9B 4EEEA 1P4BH 4B3EA 4KJQC 1GIGL 3WJJA 1ODUA 2BNQE 1T5XA 4PCTA 1VADB 4FYQA 3A22A 5GZNC 3DOSA 3X3FH 4BXSV 3QIUA 2NTFB 1C9SA 1A3LH 5FOBB 4IOIB 5EU6B 2BOBA 4PJEA 5C09E 4PJAA 4LL1A 2OSWA 2BNUA 2WVSA 4DGIH 1FV1A 2GJJA 4Q0XL 1RIUH 4XP4L 3TFKC 5AAMC 2C9RA 2VXSH 3MRGB 5MHSD 1WFMA 2AQPA 3NA9L 4XH2B 4ZFZB 5CEZD 4UB0L 1KCVH 5C08D 2JKRM 3RWGA 1HNGA 1N6VA 5F7BA 1PL3A 4E9LA 5F6IB 1CXHA 3QGVA 5IGXH 4JFXB 3ULVC 3ARUA 1NCDH 4GRLD 5L9DL 3RL1A 3T6WA 2ZXCA 1AR1D 1EVUA 4TYUA 1AQHA 2H2SD 1KCUL 3MRKB 2R51A 4W93A 5LBSA 2J4WH 2X2UA 2WQVA 1LK2A 3WL9B 1TTUA 5KYUB 5FWQA 4ABUA 2X0UA 2JE8A 2DTMH 5AW9B 4R0LB 5K9JL 4LLQB 4LVNC 3FZUC 4D8OA 4KK6C 3WIAA 3BH8B 4XHJC 5CMAA 3U30B 2DKUA 3D12B 5EG6C 5AYTA 1ID5I 2IV8A 4PJHB 3RIFK 4F58H 5IR1B 4YWGL 4LSPH 5EO1A 2AQQA 5HI4C 2F53B 1X4ZA 1H0DA 4AYDC 1XAKA 1NOLA 2JI3A 3M1OA 4M6OL 4AGPA 3CU7A 3NG5A 1KTKE 1JAEA 3FOMA 3L54A 2WYHA 4LSUH 2EYRA 2FGWL 4NENA 4P07A 2HUHA 4KK9D 3QDMB 1X7QB 3AXLA 3EG9B 4KROD 3AT8A 3W11D 4D3CH 5C0CA 5GZOC 4ZAKC 1QI4A 3KDPB 5AYUL 1GW0A 4FLRA 1CFSA 1U3ZA 4K71B 3QQ3A 3UG4A 1B2WL 3VXSE 2ZT9C 2VT0A 5MERB 4N9GB 1NCCL 2B4CL 3JV0A 3BUIA 2P24A 4PSRA 3ZHKA 1HXYB 2WQSA 2JI2A 1IC5L 4HSCX 4R4BB 2EABA 2F5AH 4PBVC 1WBXA 1K8IA 2YPLB 1XZWA 1TKWB 3EDDA 5DLML 3MYZA 4JJ5B 5I19H 4M43H 4DK6A 4K73A 1OP3K 3SDAC 4P3CL 3RX7A 3U7WH 2ARJB 2FX9L 1E9OB 2Q2LA 5DRNA 1IB5A 2DQFB 3C6LB 2WQWA 4NN6B 3HJEA 3SKNB 3RKPA 4YXLL 4MQ7B 2JTYA 1P1ZA 3JUYA 4M03A 4XNMB 3T4AC 3TNNA 1R75A 4U6XA 3OPZH 4IKLA 5I15H 1QSEE 1KFAL 2MJWA 3UCQA 5CHNA 2YAOA 3VJ6A 2ICEC 2ZCKH 4GQQA 1RK1B 3T0DA 5EU3B 3WMSA 2VE6A 1K2DB 1LEGB 3S2CA 4BQ6A 3X12A 1A7OL 2AJXL 2V3EA 2RQEA 3GXTA 1KELL 5E00A 5AAMA 4WUUE 4YC2C 2YSSB 1LWHA 4QCIB 2ADJB 2FUQA 4DFHA 2YD5A 3HCVA 3UZEA 3FRPA 3UYRL 5I1AB 1VKXB 1H3WM 2FQEA 2WKGA 1JPSL 3Q2VA 4HOZA 3BRGC 1T6VN 2GSIB 5MHSE 3D4CA 2DWXA 1Z3GH 2ZOTA 3D33A 5C08E 5E4IA 1T7VA 3WCYA 1ETA1 4MMXB 5LXVA 4NQQA 2VB5A 5K9KB 5ACMA 4Y4HC 5SX4H 3FFDB 3UYOD 2MPAH 1M6OB 4X4KA 3VFMB 2O93L 3LZFL 4B9YA 4HU2A 1H9DA 2X6CA 1INEL 12E8L 2FBJH 3D18A 3F62A 4ALAL 1MIMH 2A0LC 3HFMH 3HG4A 4NQSB 4JFYA 1JP5A 2SEBB 2OYKA 1JMXA 4U6HA 3V6FA 5FKPB 3WIFB 1SQ2N 4EDWH 4TLTA 3WS3A 4YPGA 4Z7OB 1A6UL 1KB5B 3L3OA 2J88L 3FF8A 4BFEA 4CW1B 1NUDA 3VXTB 2DM3A 1T1XB 5GZOA 5DC4B 2PW2A 1JZHA 2JJTC 4MX7A 2Z35B 2LLGA 4WZ9A 4DGUA 2DPKA 2AJ3B 2MPVA 5DMIL 1CBVH 1SM3H 1SYSA 3DO7A 2QVMA 1A8ZA 2ZSWA 4O58L 3IVKB 4XI5D 1JUFB 3NDZE 5F7AA 1J1PH 3AU0A 4QHMB 2E9BA 2Y7NA 1T21B 1WFUA 2H32H 2ALAA 1A3ZA 3Q2WA 4I2XE 1LO5B 4JZNB 1WEJL 2C1PA 2DKSA 3W38A 4Y5XB 1OAXL 5JPNB 2UY6B 3QDGD 5CBEB 2ZOKA 2ZX8A 3C8KA 3D7PA 4JHZA 4XXWC 5J9PA 3JTBA 3SDAA 4XN5A 2H6OA 5DDHA 3ZUCA 1KTCA 3FRUA 2XBDA 1IQWH 2ROXA 3DROA 1LM8V 3EJCA 1OM3L 4K3EH 4BDVA 5FM8A 1R17A 4NOFA 1T2JA 1ZSDB 1J5DA 3Q43A 5EB9A 3T4AA 4KJWD 4WAFA 5I1EH 1A7NH 3HG3A 3TN0C 1FN4A 4M48L 4NXKA 5E1AB 1D5IH 3QFDA 4M8UA 3ZPDA 2H6UA 3GKWH 2VM9A 1DZ0A 4PJEF 2NUTB 4PJAF 4Q4EA 5D2NE 3B3BA 1JRHH 1YDPA 1L7TH 4KX9A 4TLUA 1JGIA 1BAGA 4XBGA 4ENED 1L6XA 4WWNA 2APVA 5D1ZB 5DSCA 1C1EL 3KXFB 2Z64C 1ADQA 4HEMA 1U41A 1ODAA 1MAML 2YPVL 1C16A 4QLWA 1UZ8B 3Q6GL 4YUEH 4Z7WB 1K5NB 3ZVVA 1YC8A 4MKTA 3UC0L 4AGQA 2RMNA 2VIRB 5FYKH 5PCYA 3LX9A 5HDQH 5CSBA 3RAJL 3FCGA 3K81A 3EH2A 3M1BA 4AUYA 2DQUH 4D8PA 1UH4A 1N59A 2HT3D 5T1JA 4I0PD 4KVCL 3JWOL 3M88A 3LSOA 3SE4C 3D8MA 1A6WL 3K4ZA 2VDLH 2C9XA 4AQ1A 5J1SC 2XRAH 2Y72A 3IRCA 3QS3A 4OY9A 3KG5A 4X6DA 2JJVA 2QV4A 3F7VA 2NY4B 5TD4A 4HUMB 2C4FT 2YPKA 4Y4HA 5D4IA 5FLUA 4F7CA 3HPLA 1ETB1 5E56A 3KEDA 3PDGA 4EE2A 4P99A 3VFGH 1ONQA 3D3VB 5AW6B 5ANMA 5FEBA 5DC0A 5ABDE 2EEXA 5EU5B 4P46C 3QJOA 4KXCA 1OZUA 3LB6D 4ZSOB 3AS2A 5T1LB 4Y8AA 3SJVD 5HHXH 2E75C 4OZIB 1IEAA 3D48R 1OB1B 3VXMB 4AOFA 4GS7B 1BF2A 2BJML 1KPUB 1WZ1L 3N42F 4KNUA 1XZ0B 1ASQA 3J27A 2EH8L 1BX2B 2IVFC 1I1RA 4G8GD 4LVHB 3CHRA 1TTFA 2PTUA 1AHWA 4U7KA 3VD7A 3FTZA 4Z5RA 3BQVA 5LWYL 4K8RC 1M71B 3MRPB 3X11B 4R0LC 4PJFE 1XR9B 3BPNB 4MTMA 1EV2E 3U30C 3VFTA 1HZKA 3WHE1 3HI5L 3ZQWA 4JR9H 4HBQA 4TUKH 2UY7A 1Z9SB 3SPJA 1BGXH 4M3HA 4WI9A 3CG8A 3NZ8A 1CFNA 1KV7A 1JDDA 4UT9L 3MLXH 5BO1L 2CO3A 1MWAB 4GRWB 4U1SB 3WNKA 3ULUF 5IOPA 4AYBA 2B20A 1MELA 2ZF9A 2XZQH 4AJVA 1C8PA 3E0GA 3VSQA 2FWOB 4I0KA 2IGTA 3QWRA 4GW1A 2DBLH 4DJMA 4KITB 3WTUA 2D7TH 3SQBA 4K71C 5T1KA 1BLNA 3CFDB 5D7IA 1N5AB 5ID0B 3TH4T 4R26L 3Q5YA 3CZSA 3AGVA 1CC3A 3GRGA 2FDBP 1SUHA 3NOIA 5SV3A 2ADYA 2AP2A 3RZWA 1AR2A 3ZYOA 1IBBA 2UXFA 1DUZB 2NZ9C 1WFTA 4YFLF 3KDMB 3ZZLA 1BVLA 3CVHL 4NKDA 4AW7A 4FGMA 5J6HA 5EWIL 2DMGA 1CG9B 2KBGA 1PZ3A 3EOYG 3OM3B 2G0KA 4UTBH 1FVDA 1PSKL 3CFCH 4Q58C 1OAJA 5IQLA 2W9LA 4LT7A 4OLXL 2QKSA 3T3MF 5DMGD 1PLGH 3ARGC 4UUJB 2CPUA 3FN0L 2X7LA 2Z93B 8FABB 4CVZB 3PJSA 3RL2A 1OTUC 1ZE3C 1O75A 3ULVF 4XX5A 5G55A 5FW6A 3DYPA 4AUUA 1BFOB 1FAIH 2NY5H 3GSUB 4UOW0 1MCPH 3FUHA 4P4RB 4OFDA 1Q0EA 1H5BB 1RH8A 4FQJH 4WO4A 1AI1L 1VADA 5CKGA 1VFMA 3D2TA 1KXVC 1UA7A 3CDCA 2C5DC 4H1LG 4XE5B 4G7QB 2NTFA 1J8HA 1FCGA 2W60B 3ZBMA 2V5RA 4PUBH 5EU6A 3O4LA 3CXHK 5FM4A 5FOBA 3H6AA 1QFWL 2APXA 2Z31B 4TNFA 5C0IB 2GCYB 1ZGLB 4OKDA 1CU4L 2J8UA 3QFJE 5D1QE 2APSA 3MRGA 2VR3A 4JKPH 1JGEB 1ZJBA 4NXSA 4L2YA 4WW2B 3NGBC 2AKRB 3WLWD 1YEFL 1DN2A 1OSZB 4EZJA 4Y2NA 4JFVA 1EEYB 3SCMB 4PMEA 3DA0A 4N24A 1A9EA 4PJGB 5CO1A 4JFXA 3L1OH 3HG2A 4X6FA 4FABL 2G5UA 4JM2B 5I18L 4MMXC 1IL1B 1RU9L 2ZAHA 3TVMD 4HCGA 4JM4L 3WL9A 1BFTA 5KYUA 3KBPA 4WJ5B 1LLAA 3H42H 3T1FB 4R0LA 3LCYA 4LLQA 4EAEA 5DD0H 3VD1A 1AGEB 5HJGA 1M9WA 4WY7L 5CNHA 5HDOA 2CA3A 3GLAA 1AC0A 4PJHA 3DOIA 5IR1A 2NY2B 4BFBD 3GK8L 2PR4H 2AJZB 1DBBL 1AHMA 3QNZB 4NKMA 3RVWC 2DJUA 4PJIE 3NCCB 2KI6A 4OZFA 3P9MB 1KC5H 4M1GL 2R2BA 3E6HB 3TONA 3WJMB 4DAGH 3NH7L 4QF1B 3F58L 3ULAB 3EG9A 3QIBC 1T4KB 5AG8A 4ZTPH 2IPUG 4EBQH 5E5MA 4EUPG 3ZKXC 4AGMA 4H25B 4DKDC 3LKSA 4MJ2A 4CN4A 4AH2B 3NAAL 4KGJA 5MERA 3LZLA 2R2HB 4ZG1A 2YHGA 3E9UA 2X70A 3QPQD 1F3DH 4A38A 2F61A 4P0DA 5I8OH 2D9QB 2O5ZH 4KOBA 3V4VB 1IZJA 1IGYB 5IMMB 2HA1A 2WN2A 1XGPB 2EDTA 2R4RH 4HBCH 4XOEA 2BP3A 3LEXA 4DNLA 5LNDA 3KPSE 4Y5XC 4JJ5A 5JPNC 5FA3A 2Z8SA 1BZ7A 1G5GA 4IYKA 4PVLA 4G8EB 4TNWK 2NYYD 3MV7D 5A40E 3KLLA 2ARJA 4P2OB 5B3JE 3FU8A 4G7VL 1IVLA 2QFPA 1IKFL 2DQFA 5INCB 3ML9A 1AZZC 3C6LA 1UA6H 3ATFA 4D0CB 4A04A 3SKNA 4DERA 3J7HA 3B4NA 3PWPD 4JN1H 4P49A 3ARFB 4MQ7A 3W2DH 4EDXB 2EYSB 3EH4B 4DSYA 2VM4A 3CFBA 4J3TA 3UPRA 4X6DF 1IO4C 4HS3B 3QJFB 3GRWL 4HIEB 4L9LA 5J12B 1RK1A 1J0ZA 4RFOH 5EU3A 5HBBA 3LKRA 4UT7L 1OE3A 1K2DA 2WV3A 5D1ZC 3PFQA 1CLZH 1UASA 2PXYD 3LQMA 3GSXA 4KBPA 5HDBE 1CYXA 2HRPH 2F7IA 1RP9A 1UM6H 3GS0A 3H55A 4NQDA 2YSSA 1A1NB 1FFPB 1SXAA 4QCIA 2ADJA 4FI6A 3KHQA 4ZMOA 5ISZB 5AKTA 1N8ZB 3AS1A 3SE9L 3SPVB 4TPRH 1PMYA 2JKTM 5B4MC 2Y06H 4X4XA 4J8QA 1VKXA 5ICUA 2HZHA 3BAXA 2NX5B 4JLRA 4U1NB 3A6BH 3VWKD 5J1AB 4GKZB 5DD1H 4X6CF 3MPCA 4P48A 3WTYA 4NCC2 4WWKD 4NO3B 1Z5LB 2DH2A 1OM9A 3LH8A 2X12A 2Z7WA 2WNXA 5ABZA 2B0SL 4MMXA 1R24B 4M5YH 5A7BA 1DCEA 2NY4C 2ZXAA 5FHBH 3H4HA 4FG0A 2NLJB 3HE6B 1KB9J 1I7RA 4TNVK 3RA7L 1FL3B 5GS1B 2QMKA 5ACZB 3VFMA 1M6OA 4AC2A 5C2BL 2AQ3A 2EDNA 2VR8A 3KLHD 1T03H 1XSKA 2FUTA 1KWGA 3HZ3A 3HI6H 4M4RB 1NGXB 3VXQB 1JZ6A 2H2PD 1UJ3B 2HRLA 1JPFA 2XJLA 2SEBA 3HC2A 3PQYD 4PWEA 1DEDA 3FSAA 4HETA 5FKPA 3RIFF 1AO7D 1IBHA 1UENA 3GSNL 2DI8A 4YVNA 3BDXA 1KJ2L 4GS7C 5T5NF 3BJLA 1ZPLA 5ENWB 3D69A 5CUSH 3H3BC 5C2UB 1NDTA 4CW1A 3VXTA 1BZ9B 1MJUL 5TQ0H 1T1XA 3RVVC 2XZAL 4X0NA 4XTRD 4UOQA 5LN4A 3LKOA 4LVHC 4K5OA 4XX1E 5CR8A 4G82A 2EIBA 3JWDL 3MREA 2XYBA 3BPNC 3NIDB 5A16A 1YSOA 4ODWB 1JUFA 1ZSHA 4QHMA 4LSQL 3DLQR 3KCPB 1N64L 1D5XB 3CZLA 3MLRH 1CMOA 2DWEA 1RJCA 1T0OA 2WZPD 4Y5XA 5JPNA 2NR6A 1E6OH 5CBEA 1R47A 2BFVH 3CLFH 4QTFA 2X4OA 1D5ZB 4NC1C 3RQ3A 4J5VA 4HD5A 1KGCD 1N0LA 3H85A 1QSFD 2EDQA 3PY9A 1OIOA 4JZJB 1ACZA 4HJGA 1EJOL 1YUHB 3KPPB 2YGQA 1D2OA 3GSVB 4QXGL 2FD6H 5I17B 5DURD 5AVQB 4OI7A 1CICC 1ZSDA 1EBPA 3L9RB 4BIKA 3MV7E 1HESA 4XCYB 2PWDA 2YKKA 2COQA 3L81A 2YJLA 2YIHA 1RSYA 3DURB 4L4JA 3ZYJA 2FCBA 1NFIB 3MFFA 1BD2D 4DEWA 1NCBL 3MUJA 1JZ3A 3JV6B 1PJWA 3PWPE 5FV1L 2NUTA 3V5DA 4WW1A 4HALA 1DQJA 5GGTL 3KBHE 3NFSH 5D1ZA 5FF6B 2QPUA 3KXFA 4N22A 4BWWA 3QUML 2IDUA 4A2EA 2CK2A 1K85A 4XN1A 5I9QB 4Z7WA 1OW0C 3FB7B 1HC1A 3T4YA 5ECJE 1ZT7A 1N2RB 2WVTA 1PFCA 2V7NB 3MJ8B 5EU7C 4FI7A 4A6YB 3VAEA 6PCYA 1C7SA 3UTQB 4LDCA 4LLAA 2BDNH 1JXFA 4AK1A 1GC1C 4GW4B 4PVNA 3O0RL 3FCTB 1U6AH 1XIWA 3EOTL 4L1LA 5SWSD 3UZVB 1I9RH 2XVGA 5E0FA 4I3RL 5D7SL 1H5BC 3GSOB 3Q8CA 5MENB 4RISL 2QFRA 1A6VL 2GW5A 4AVHA 4UILH 2Z65C 3QHFL 4UU9B 4EKJA 4NZUL 2E4TA 4AT6B 2Z31C 3QQXA 4PJHF 2WIMA 8PAZA 1MCOL 5KJRH 5CD5C 1PIGA 4BCYA 4IBWA 5D8JH 2JCCE 2EKJA 5EU5A 1MQ8A 3LRKA 4YDIL 4BINA 3H53A 5DHVH 1XF3A 1BAFH 3QG7H 5JZ7D 5LG6A 4ODBD 1JZFA 4WW2C 5I1CH 5T1LA 3N04A 4OZIA 2WLMA 4DQAA 4HUNB 2G3NA 2FH8A 3SCMC 1OB1A 3VXMA 1EAQA 4Y5YB 4ZUWB 2DJMA 1KPUA 2EKSB 4YZWA 1XZ0A 4NWUH 1YY9D 4P2QD 3B2UC 3BAWA 4RIRB 1BX2A 1QR4A 3K0YA 4HPOH 4G6KL 4JM2C 1M7UA 1AO7E 4EUPB 4WENB 3IWUA 3VNYA 3A5VA 5FB8A 1M71A 3MRPA 4FG4A 4XMPH 1E2VA 3E6FB 3VFPB 2ZWYA 4P3DB 5E4OA 3X11A 3JBG7 4YBLB 1XCQA 4NQVB 1GA2A 4IDLA 3VA6A 5B1BB 2NY2C 1Z9SA 4APXB 1TNNA 4UYPA 4XC3H 1BM3H 1NM9A 2Z91B 3T0VA 5AVSB 3ZXAC 1BWMA 4Z7VB 1RLBA 1MWAA 2UZIL 2ZKHL 2WMPA 4DVBB 4OF5A 2VDRL 1BZEA 4BFNA