3S0PA

Copper-reconstituted tomato chloroplast superoxide dismutase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
153
structure length
124
Chain Sequence
TKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDAGGRLACGVVGLTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical properties of Tomato Chloroplast SOD
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
total genus 27
structure length 124
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3s0pA00
2AQSA 2R27A 4A7GA 3KBFA 1UXLA 3KM1A 2VR8A 2Z7YA 4N3UA 1RK7A 1SOSA 1SXBA 3F7LA 1E9QA 1F18A 1SPDA 3KM2A 1SDAB 1TO4A 2C9SA 1AZVA 3H2QA 2GBVA 1ESOA 3L9YA 1F1DA 2ZKYA 1CBJA 4A7GF 1E9OA 2ZKXA 1P1VA 1SXAA 2Q2LA 3HFFA 3KH4A 1CB4A 3HOGA 2WYZA 2XJKA 4A7TA 3MKGA 1DO5A 1EJ8A 1N19A 2GBUA 3KH3A 1JK9A 1SXCA 3GZPA 1SXZA 3L9EA 1HL4A 3S0PA 4OH2A 2XJLA 2AQPA 1U3NA 2AQQA 2C9UA 2WYTA 2AQTA 1SRDA 1YSOA 1TO5A 3GTVA 1UXMA 1MFMA 2WWNA 1YAZA 4OJAA 4A7QA 2C9VA 1Z9PA 3T5WA 1PU0A 1IBHA 2VR7A 4N3TA 1XSOA 3ECWA 1OAJA 1XTLA 1IB5A 2NNXA 2ZKWA 1E9PB 4B3EA 2Z7UA 1DSWA 1B4LA 1OEZW 1IBDA 2K4WA 2AQRA 4A7UA 1E9QB 3K91A 2AQNA 3CE1A 1XTMA 1F1GA 3SODB 3CQQA 5KBMA 4A7VA 1COBA 5KBLA 3PU7A 2VR6A 4MCNA 1QUPA 1YAIA 1FUNA 1B4TA 1IBFA 3ECVA 1BA9A 5CU9A 2WZ5A 3ECUA 2WWOA 1BZOA 2JLPA 3QQDA 4BCZA 1OALA 2ZOWA 1F1AA 2WKOF 1S4IA 1Z9NA 4BD4A 2WZ0A 1L3NA 2V0AA 2APSA 3QQDB 2WZ6A 1PTZA 3GZOA 1HL5A 3GTTA 2SODB 3GZQA 5KBKA 1JCVA 2GBTA 4L05A 3RE0A 1N18A 1OZUA 1SDYA 4A7SA 2AEOA 1EQWA 2WKOA 1IBBA 4MCMA 4U4IA 3F7KA 1KMGA 1JK9B 3KBEA 1PZSA 3CQPA 3H2PA 1SXNA 2JCWA 3MNDA 1E9PA 2E46A 2Z7WA 1OZTG 2LU5A 3HW7A 4FF9A 2E47A 1Q0EA 4BCYA 3GQFA 1SXSA 1E9OB 3LTVA 2Z7ZA 2AF2A
chains in the Genus database with same CATH superfamily
3DBXB 4BK5C 3J8F7 3UL4A 3CHXA 3QQ4B 3T0ED 4CVUA 3NRQA 1MRCL 2BY3A 3IVKA 4L9DA 3RP1A 1EEYB 1IIKA 3KDMA 4TVPE 4XO9A 4WKXA 4D9QE 3IJSB 3P9WB 3QCTL 1OSYA 5AVWB 4MCZB 5DJZA 1KN2L 3STZA 1IBGL 2VLME 1Z6JT 2VGLM 3JWOH 5DI8A 4ETQA 5AD0A 1IKOP 2EJ1A 3H9SA 3PLYA 4JO3L 1KULA 3ZTJG 1F6AB 4K23L 1YDPB 5IROA 1FGNH 1MJUL 3H7BA 2ATPB 4HFWA 5E94B 1IU1A 1YPZB 4XNAA 3U4BL 3GGWA 4UF7C 2A0LD 1YJDH 4AYGA 4YS4A 4K9EL 3D18A 3NYKA 1E27B 2JB6A 1EWHA 4L1TA 4M7ZC 4NUGL 3MRHB 4CJ0A 1FA4A 3MU3A 3HC4L 3EH4B 3QS3A 1NMBL 3DSNB 3QWOA 3BPOC 4JZNA 1KYDA 4E9QA 2QZ5A 4Z7NE 5AAPA 4XCYA 2RB8A 1XTMA 2QVTA 3SYPA 3G6AA 2OXGA 1S9WB 4U1NA 4CSPA 2GITB 1QASA 3QXAA 3FYEB 4EI0A 3ECVA 3U79A 4NO3A 3RVTD 4XODA 4Y9FA 3M17A 4PLJD 5AYUH 3WJJC 1G7JA 3V6OC 4XP4H 4YOKA 2HJLB 5J11B 4J4PD 5FV1L 1GL4B 1EXUA 2EKSA 3LJ3A 2E56A 3E1ZA 3MRKA 4PRDB 1MG2C 5AKVA 4AYSA 4F8PA 4FADA 3QUZC 1I8MB 1LO5A 4WFEE 3UO8B 4MMXC 5FB8B 3UFIA 2BINA 4XAWL 2OTWA 4JE0A 2MHAB 3OX8B 1YLBB 4P46C 1LLAA 3WDIA 4XP6L 4FQXA 1KGCE 2EDNA 4XHQA 1KLGB 3O45A 2DYPA 2Y5TB 3RJQB 2V33A 4RX4A 3V7MA 3LPPA 4UTCA 1JGUH 5AB9A 2NY4C 3FT3B 5I2IB 4G8GD 4LCCB 3O2DL 4QXGL 5T33L 1C12B 5D1ZB 4PP1C 5D7SH 1LMKA 4QWWD 1PZ5A 5KANG 5IG7B 5DT1L 3HBZA 4FMVA 4JZNB 4EF3A 5INCA 3P9MA 4AC2A 2XG5A 2FGWL 1VKXB 5K1NA 4UM8B 1UXSA 3B2VH 3I02A 1TXKA 2FH8A 5E6IA 1EXGA 2D0GA 4CA4A 3DUHA 2V17H 2EACA 2K70A 3O2VH 2FAUA 5JQ6H 3ESUF 5F97E 3UIZA 4GP4B 2W0FB 3D8MA 1U0QA 3LN5B 4JKLA 5BRPA 3DV6A 4XXDA 1I53A 2HLEB 1QFOA 3ISWA 3OKEB 3CSYB 1JOIA 4KQ4H 5EF3A 5TH2B 3QEUA 5EUOE 2EDJA 4YEEA 1B3IA 1MN4A 4GOSA 1BQLH 3FMGL 5AVSB 5AW0B 4C56D 1CTOA 3L8QA 4PREB 1TQUA 1TYRA 1A0QL 1P5UA 2R9HD 1V7MH 3MKKA 3WIIL 1MWOA 1DSFH 4LGPB 1R75A 5E9AA 1KGYE 2LHAA 4KI5F 1I9JH 4K3EH 1QSEE 2GSGA 3VGAB 5MEND 4AGNA 1R0AH 5EDXA 3GI8H 3MYJA 2YKLH 1O5DT 4CW1A 5C6WH 1NANI 2P42B 3RVXC 1IGJA 5JPNB 2A74C 5EZIL 4BUQA 1TJHL 1GTNA 4FFYL 3CVHL 1MPAH 4IBUA 4OGQC 5DSCA 3FCUB 4JM0A 4Y5XC 4W9GC 1OT1A 5E5MA 1UD3A 3LB6C 4K94H 2G0LA 3WFEH 4KNQA 1BF8A 2EYSA 1ZE3C 2R0ZH 3EOAA 2BVPA 4X6DF 4HKXB 4PLNC 2VW7A 4FJZA 3QT2A 3ARDD 5FYKU 3KPPA 3QHZH 5D7JD 4NBYB 3BN9C 4YL9A 2X38A 5SWZE 4XZUB 2BOLA 4X4KA 3SHSA 5KYWB 2WQSA 2GABA 3EJPA 1M3IA 2JIXB 2OW7A 2XQBL 2J12B 2X4SB 4FG0A 1JDAA 1L7TH 3SE8H 4YHNB 1Q1PA 5B3SB 3EGSB 1WEJH 5TF0A 5IMOB 4JY4B 5CBEA 3JWNE 4OCMC 1QZ1A 1WITA 3GJEB 1NCDH 3IGUA 2EDYA 2CR6A 2YEZB 1MFEL 2YAFA 3MJ9H 1Q38A 4GAAA 3STLB 1E8ZA 4WI7A 5IGXH 3MODH 4YNYA 2ATAA 1NFDF 1T1XA 3RDTD 1U33A 1PX8A 5JW5B 4QTHB 5DJDA 2Q7YB 1JE6A 1NKGA 4PJGF 4F3FB 3BEVA 4JR9L 4QCIA 4NNPH 2CMRH 1ED3A 3UYOD 3NP4A 4XX1E 3MRRA 5EORL 2BRRL 5F0PB 1MFBH 2AXWA 2P5EE 1E9OB 3NJIA 4BKLB 1RKRA 1RUML 3K72A 5CZKA 5E6ID 1WS8A 4UOW0 1I9EA 3HLKA 2X70B 5LQBL 5GHWH 2H0JA 2IIJA 1CD9B 2IBZX 2GJJA 4X6CB 4XNUL 1EZLA 4IIQC 3WJLC 4UQBA 5C6TH 2AJUH 2WLLB 5DD5L 3TGXA 2F5AH 1BFOB 1DVZA 3LPWA 3W38A 4N28A 3N9GH 2X4UB 4PJDB 3HE6A 5J6SA 3RNKA 3AT9A 2HKHL 4MQTB 3FUDA 1AD0A 5I24A 1XSIA 1N59A 3BH4A 3QAZC 4Y8DC 3KL0A 4NQQA 2RH0A 3BXNA 5IHZB 2QMJA 1J12A 4FQ2H 2IO5A 3HNSH 3AM8C 3X11B 4F5CA 2WQUA 4P5MA 1AGBB 1C5BL 2E4TA 2NXZC 2CCWA 1NGXA 2VITA 1BXXA 3FPXA 4MJJA 4XAWH 4OVVA 2BW5A 5IOPB 5AYQA 4R8WL 4YX2L 4YDVA 1GSKA 2VL4A 3E2HC 4M93B 4MCYA 2DMBA 4DGYH 4I48A 2F5BL 4YHKH 4TSAH 2LU4A 1WTGT 1JWUA 2APFA 1INEH 2WTRA 3ARDA 4NZDA 4L4VD 2R0KH 4JFED 5EC2A 4HUUA 2VDLB 2WNKA 5DS8A 4RFOH 6CGTA 5K9KA 1VGEL 1Y18B 1QFUH 4FL4C 4KKAC 4HIHB 4NRZA 2QQNH 4M43H 4YBQD 4NKDB 3CC1A 3D69A 4S1DD 4CSZA 3S7GA 1Q9LA 3FULA 2VJ0A 5EO0B 1D2OA 1KCSH 3TOPA 4N20A 1QAWA 1NM9A 3ZO9A 4MMYA 4BM7A 5EOCL 3NIFE 1U8QA 4M8QA 3LKNA 2Y1AA 5LBGA 3G08B 3GHEL 1TEFA 5FW7A 1HAUA 2HVJA 3FSZA 3L4VA 5A16B 1HYSD 5B8CA 5EU4B 3EUUA 1K4CB 3WSQH 3CHOA 1JHKL 5AZUA 3X2QB 1HCZA 3HZVB 1T20B 5DQ9A 1L9QA 4PCYA 4O2CA 3Q13A 3SCMC 1M7DB 1U8OA 3JQOB 1ZPUA 3S3CB 2D0HA 5H37H 5J9PA 1Q8MA 1NGWA 2EUXA 1QSFD 3SGEH 3W9DA 4R3SA 1AO7B 1KIUB 4P2RE 1W91A 1N68A 4X9YA 5I19L 4LOFA 3LD8C 4GXFA 2P5WD 3G5XA 4HLEA 5ADPL 2CXKA 1H0DB 2EYRA 3RWIB 2RJMA 2GVYA 2IDFA 3ZPDA 5FKAB 2ZOKA 1G9NH 1PVHA 3A22A 4WJG3 4AEIL 3MRDA 1UWYA 3SO3B 3L9YA 4G6KL 2QV2A 3GMMB 2XNAA 3B2MA 3MFGB 5CP7B 3IDYB 3AADB 1DJXA 2HTKC 1V7ML 2E4FA 4Z7UB 2PNDA 3ZN6A 4DP7X 3B2DC 4UT7L 3BAEH 3QPKA 1AIFB 1F2XK 2DIJA 1M2VA 1V10A 2Z64C 5HGHB 3VM7A 4AQ8C 3L3GA 5DVKA 4BCXA 1L7TL 1XZ0B 4MLIA 2DLEA 3C5ZB 4LOEA 4JCWA 3UAJA 1SFHA 3VFRB 3VMPA 1T1ZB 2HKFL 3ARBA 2K6WA 3ARGB 4GQZA 4JKNA 5E00A 5L9DL 4IHBA 4NO2A 3D3VA 3IKKA 3A4FA 1SHSA 1PLCA 1NBVH 1P53A 5F9OH 2W65A 4HKBB 4QXTA 5GJTL 2FX7H 2IJ0C 1HXMB 1WFOA 3RWHA 3B7YA 1LDPL 2EVFA 5DEJA 2X09A 5EOCJ 3GHPA 1X7TA 4ZNEE 2V37A 5L2JB 5E51A 5EV7A 3MJWA 1AI1H 4JL1A 3WLWD 4G7QB 4LBEB 2VN6A 1OE1A 3LN4B 5GS2H 1YN7A 3GO1L 3OMNB 2G9HA 4P5TA 2CE6A 4GP8B 5D7KD 4MWFB 2GUOA 2WAQA 4L4VA 2EIZB 3G5YB 1J8HA 4NO2B 1ZANL 4M8QB 1PKQE 2P8LB 4IU2A 4KK6C 4NT6A 2WCPA 5A2AA 3DARA 1HCFX 4FDWA 5A43C 5JQHC 1JZJA 2MMXA 2OMTA 2NY0D 2GK2A 4MQXC 5HGHA 5SV4A 3DGDA 3MLYH 3KBPA 2RD0A 3AQDA 3QUKB 1KNOB 1J5CA 2QSTA 3KCPB 4HIHA 5A6IA 2V0AA 1KTCA 2XACC 5F0JB 1FIGH 2DQTH 4MX7B 2M8XA 5DJ0B 4EDXA 2XTJD 1CQYA 5DZAA 4OCRH 3OJDB 4H8UA 4ZS6D 3AWEA 1MLCB 5DFAA 3V52L 4S0SD 3VRLE 1DQMH 3HUJB 1MQKH 1N9PA 3CQPA 4QRSB 3JVGC 2E9IA 1NGYA 2IFFL 3DK2A 3MNDA 4MCYB 1KGXA 1ONQA 5ICXA 4ELKB 1N4XH 2X6UA 3BZ5A 4F7MB 4QRQA 3FB5A 1JDDA 1P9MC 3UX9B 2CJSA 2DEXX 3L7EB 3S2CA 5LGJB 3TYGL 4BYHA 1QSFA 4GRMA 5TDNB 4K7FB 3QZWG 3H55A 5J9PB 3K5SA 1LVEA 2P5WA 4NUJB 3UEZA 4BRJA 3KPOB 4X2UA 4KTGA 4X6EB 1K72A 5EU4A 2VUKA 5DFVC 2AVFA 4LASH 5F89B 2X28A 1CFQB 3V4PB 2X4NB 1XHHA 2XLLA 4KX7A 3FU5A 2X4UA 3FU8A 4PJHF 3QW9A 4PJFF 4NQEE 3WN5C 4CC4C 1JJUA 3N06B 2F5AL 1S8DB 1IKFL 3N3EA 3DTDA 3D9AL 5TGBB 4OU3A 5T1JA 3U0WL 2K0RA 4EI6A 3FU7B 1EO5A 1Q9LB 1VDGA 4CDGC 1IGIH 4JPSA 4Z3GA 1TTUA 3IMVA 5CBAB 4NRZB 4Y4FB 2EIBA 5EUOB 4MSWA 4MS6A 4KQ0A 2A6KB 4HDIA 3MQIA 1ETA1 1W8OA 4H8PA 1BVNT 4ILDA 3BFWA 4AM0B 4H1LB 2DTMH 2E6QA 2HN7A 5ACZA 4PS4L 4NKOB 2BZ7A 2DQUH 3QRLA 4NN5B 4WWKA 4E9XA 3L5XH 4DQOL 4LARL 1ZCRA 3U9PL 1IB5A 1UD4A 4PWKA 3GHEH 1W6WA 4FG4A 4HZLB 3B7UX 5CLXA 5DT1H 2O61A 4YDVB 1IBDA 4MMZB 3O9WA 3K4DA 1AE6L 1IC5H 2R8SL 3CQQA 4UT6H 1OTSC 1I7ZA 3OLEA 1NGXB 4AE1A 3TH2T 1S5IL 3ZZ1A 1J48A 5ALBL 1TYEB 2YEZA 5LBVA 2ADGA 1HL8A 1Q90A 2VH5L 3S8WA 3HUJF 1XF2B 1P84K 3GBNH 4BZYA 2VRQA 5FCUL 2FK9A 3QQDA 3V8CA 1UCTA 3MCKB 1D5ZA 4PY8I 1CK0L 2B20A 1HNYA 2WUCH 4P04A 5FGCB 5I71C 4YHNA 5BOPA 5JIPA 4N8VA 2V9UA 3U36A 4TUKH 1R5WA 3QEQA 3ZDZE 3SKUD 4OUOA 3LKOB 4ELMA 3BH9A 3L5WB 1HJBC 5IB4B 4KAQL 5D6DC 4ONHA 1NEZG 5F3BA 4WDIA 2QGEA 2VISB 4Y5VA 3R06A 5DD3H 3WSQL 2I9LB 4YDKH 2NY3D 4PR5A 3OAUH 4KRLB 5C0AA 2X1XR 2EYSB 5ANHA 4P46A 3HG2A 4AUUA 1IFGA 4KZCA 2BNUB 2XQYA 1CFNB 2G2NA 2GFBA 2UUDK 4PGBA 4PMEA 4TPRH 4YHLH 3BZEA 5ISZE 1LQSR 4PIRF 4APQC 3PDOB 5HGBA 2H6PB 1KBGL 1P7KA 4KUCD 4F7EA 5E99H 1TZGH 1W6LA 2KZ1B 4JGJA 2KLSA 2E76C 2XTJE 4DP8X 1I1YB 4YC2B 4RBPH 3COOA 4U1MA 4JK0D 5SWQA 1AG6A 4ZMNA 2FT7A 1ODUA 3BEVB 4G7VH 3NUKA 4QCIB 4X8XA 3S35L 3KWTA 4JHZA 2A9ML 1OP9A 3V95A 3BUYB 1UKTA 1Z32X 1JD9A 5LWYH 5BO1L 4P23C 4KBPA 4BQ8A 2HT4D 3PQYE 1UJ3C 2DW5A 4TVPL 3TZVB 3V0IA 2KQNA 3K6OA 3B9EA 4L9LB 2BM3A 4DPBX 5KJRL 1BZEA 3OKDB 1KJMB 4RVBA 4PI0A 3L4YA 1FZMA 1X9LA 4NO0B 1CWVA 3PP4H 1MWAH 3RGHA 1SXZA 2O72A 3VU2A 1P5VB 3L7FA 2AQPA 1U8CB 4X7DC 4APXB 1PEWA 5DC0A 3SD2A 1Q1JH 1IAII 3MLXH 3PY9A 2P24B 3E0GA 3JT0A 2IFGA 4WJ5A 3D2UB 2ZXCA 5TF1H 5CEZH 3PUUA 3S96B 2IDSA 1IC0A 5LLIC 5J06A 1LYQA 3IYLW 4BFIB 3SE4C 5C7XL 3BQVA 1S7TB 4JANA 1XIWC 5TFSH 4AQ1A 3B9KB 1CDHA 1EAPA 2JKNA 4L1SA 3O11A 15C8L 3LQZB 3QI9B 4G7VL 2F1AA 1E4XH 3CXHJ 2AQNA 4X7TB 3GMQB 3LQAH 1QR1A 4OY9A 2QT6A 1P4BH 5AW9B 2TSBA 3N91A 1W0VB 4QF1B 1VFUA 3HHSA 1XGPB 5F72S 1V55B 3MJ7B 2D3VA 2MTPA 4EOWH 5ADOH 3WLWC 3C12A 3CHSA 5FB8A 3S4SG 2ICEA 5HDLA 5DEFA 5DO8A 3PE9A 4KKCC 4PB0H 4TL5A 4X6DE 3ARFA 4AV5A 1WYJA 1YG9A 1HI6B 3DETD 2VC2L 2V7HB 4Y7MA 4U1IB 3PCYA 1SYVA 1FAKT 1WTLA 4F57L 4LNVA 4K3JL 5TPWH 4F7PA 2PXYD 3QIBD 1LXMA 1ADQH 1WA2X 1IV8A 4QUOA 2VLKA 1EHXA 1RIHL 3OKEA 2X9XA 5TDOB 3SZ6A 2R15A 3QJXA 4JX0A 3WNLA 5T1LB 1RK1B 4ALAC 3T6QC 1RCYA 2XA8L 3MV8E 3NJKA 3HE6C 1WQVT 1LEIA 2HTKD 4OF8A 5E6IB 3O3DA 2OQJA 2YSSB 3BVTA 3Q1SL 4OFVA 4W70A 4XMXA 2ROYA 4P2AA 5GGVY 5AW5B 3V9CA 2AQSA 2XG5B 5J1AA 3VGGA 1G1YA 2AXFB 3MO1A 1NCOA 1QBBA 1G9EA 1YQVL 4N3UA 3SJVA 2YJLA 1TCMA 4RFNB 3PFUA 3UTQB 4TV3A 4NM8H 2YPVL 2A1WL 2C1OB 1YMHB 3C9NB 3GF8A 4KU1A 4OZGE 3JV0A 5D2NC 3SGJC 3WFCH 1H8SA 3FB8B 3ETBJ 1R3IL 1FE8L 1QSFE 3PWUA 3H9SB 3GM8A 4HALA 2ZUTA 2XRAL 4OD3L 4RMQA 2ARWA 5HSFA 3U2IA 4PQXA 1MREH 1MAKA 4EKJA 5EEWA 3ROOB 3E80A 4WY7L 1GS8A 1RLBA 3DMMB 4QYOA 5BJTA 5HYFA 1DUYB 1DCLA 4KRMB 2WLIA 4M7KL 4WUUD 3WFDL 4FZEL 4MNHA 1T1WB 2C9XA 3I75A 2DN7A 3HG1D 3LS5H 4JFHE 2Y4SA 3ASNB 3X12A 4N5EC 1TZIA 3PRZA 1CURA 1CK0H 2VERN 2ZP8A 3QQ4A 4JG5A 1T1YA 2HRHA 1T7YA 3PWJB 4QHUB 4GKSB 5AL8A 3R4DA 4RGMC 1DJYA 4WAFA 4Y2DD 1FNSH 2OMUB 1UZ6F 2ARJB 4HUKB 5F1SA 5I17B 4XCYB 2G5UA 2XZCL 1HIMH 2X2UA 2EDFA 2X87A 3KPRE 1HAWA 1EGJL 3NEOA 5HI5C 1AQ8A 1FZJA 4PW9A 3IGKA 1R9FA 1NUDA 5IJVB 1ACYL 4FQ1L 3QR1A 2KZWA 4EN3D 4TRPH 3NZSA 1K5WA 1PD0A 1TJGL 3HPLB 2JB6B 1SOKA 2QQKL 3LRHA 1NSNL 4GQ9H 5H94A 3UJIH 3F5WA 4RNRB 5EBLA 3X17A 2NTFA 1CFBA 1MCSA 3QZOA 1WISA 3VDCA 3B5HA 4JREC 5IK3B 2P9RA 2W0PA 2YPKB 1YDPA 1BSIA 4ZPTA 4QRRB 5I8KL 1A3RH 1F6AA 5HDRA 4GW4A 4KITB 1GOFA 3IFPA 5DI8B 5I71B 3G7TA 4OVUA 2OM5A 5C0RH 3CTTA 3WEOA 3B6SB 3HG0A 1EDYA 3NRPA 5JIIA 4UQ9A 5GJSH 3PWLA 2Q1EA 4U1GB 1SGKA 4R2GB 1BD2A 1S5HA 4X7SL 2BVQA 1A3QA 3IPBA 4C4BA 2CKBB 3JTBA 3F84A 3MLYL 1P0SE 1X9RA 2A74A 3RIFF 1JHLL 3CZNA 3W0WE 1NGZA 2AZAA 3HI6H 2PYED 1Q9OA 5GZNC 1SBSL 1TZGL 3I2CL 5DQJA 1KTDA 3TA3A 2MQCA 5T3XH 4HD9A 5EN2B 4HS8L 3GUTA 2JXMB 1FFQA 3LNFA 5FS5A 4FZEH 5CILH 2KZBA 4OLYL 3UIYA 1RUAH 1N6VA 4G6ML 4LPUA 1M6OA 3HE7B 3SGJA 3LKSA 3TO4C 1QX1A 2WNWA 3FQXA 3GBMH 2XFXA 3I6LD 2O4EA 5GGTA 5JHDE 4JDVA 3ZHLA 3VX1A 3V5DA 3DMMD 3PAZA 2WINB 2GTZA 4WI4A 2F18A 5DHDA 5I5JA 1NCWH 2WIMA 4P23B 3QG7L 3NFPA 2P80D 3JWNG 3QNZA 2PR4L 1HH6A 1Z5HA 1IM9A 4PP2A 3JTTA 3RGVD 1SJEB 3H9SD 4DP4X 4WTZG 4ISVB 2VXQA 1WBYA 3KD4A 5L6YH 2I9TA 2BCKB 4D9RD 3HC0B 1XGYL 1WE5A 4X8GA 4JFEE 4OCSH 2VZTA 3BVWA 4YPGB 5EHFA 1X5HA 1MHHB 1IAIM 5L8JB 3K81A 3NCYS 2IDTA 3GI8L 3V6FB 3GMNB 2DWTA 2LGNA 3W81A 1A6WL 4RAVA 5DQDH 1KLUB 1DFXA 1YNTF 4WV1C 3H9HA 2OJ1A 3EFOB 5C0CE 3NACH 1YEJH 5FUCC 5BVPL 3VFWB 4F33A 1JYNA 5IJKC 5DA4A 1B4JL 1AGEA 4HX1A 1T89C 3OKOA 2YA2A 3QUMB 5IBLC 3X13B 4DUVA 5HHQB 1FL3B 3TBBA 5CGBA 3RIAF 4N2GA 1B0IA 2Z91B 3GMRA 2G4EA 4GBXB 4K3HA 1RZ8A 3EO1A 4J4PA 4OM0H 3IRCA 3JV6B 4WO4A 3PG2A 1TCRB 1JV2B 3HG1B 4PRPD 3QNYB 3HRZC 2ZPKL 2DLIA 2ZKMX 5CWSA 4H13C 2XN1A 4FP8L 1CGTA 1NBZB 1F4XH 1KIQA 1NCJA 5G55A 3I9GL 1KB9K 1TTFA 2UWEE 3CH1B 3GZQA 2Q10A 2DQCH 4RSVA 3MV7E 3ZU8A 4JO2L 5A2FA 3US0A 1A6WH 3AZUA 2D3LA 3V4UL 4PJCE 4JFWA 3OAYH 1CO1A 1J0HA 3V0DA 3MC0A 1F2QA 1JZ7A 4YSPA 5KN5A 3QNYA 4P4KC 5GRWA 2H2SC 1QBAA 4EIZC 2A9NH 3H3BC 4OZFG 4S10A 1KFAL 4FZ8L 3GXMA 5I74B 4FNSA 4NRYA 1QLRB 4C56E 5IFAL 2GG1A 3CHPA 1UATA 2PYFB 4LEBA 4Y89A 1WD8A 3TA3D 3Q01A 1MCHA 5DVMA 5DRNB 1I1AC 5KSBE 1PSKL 2Z65C 4PJFB 4TSCL 4DGVH 4H8WL 2WM0A 1JZGA 4LSRH 3EIFA 4JDZB 1OY3B 2EUVA 4XN9A 4W9JC 5E9NA 4ONFL 2ODHA 3A6CH 3EFOA 4TMPA 3B2VL 3N85L 2Q2LA 5KYUB 4NGHL 1JZDC 1KY6A 1MCOL 4JJ5B 4XWOD 3VFOB 4PFEA 4CNIA 3WAJA 1A4JA 4KGJA 4APQA 3H9ZA 5ILTL 1QLRA 1NSNH 3SDAC 4FXGA 4D0DA 3Q43A 1A6AA 1MOEA 5D7EA 1HZHH 4U7SA 1E6JL 4OIIH 3S35H 3TBYA 1GCYA 5E6SB 1OF0A 1U8PB 4I89A 4ZSOA 4C4UA 2D7QA 2XN2A 1BQKA 1ZHKA 3VA6A 1QLEB 5I6NA 4CADA 2H45A 3C6LA 1QR4A 1UH2A 1CDBA 2Y2YA 5ABZA 3TH4T 2J55A 2PP7A 3Q8CA 5GISH 1U3JA 5J12C 3QUZD 5IW3A 3QFDA 4GKZB 4N86A 3V5DB 1LWRA 4YHKL 2VR4A 1IAOB 3IJHB 4HETA 1NQBA 3CK0H 1DSWA 1R4XA 2PF6A 5SX4H 1EMTH 3HE7A 3DVGA 2ADJB 3HJEA 4LSRL 4MD5B 1FVEB 5JHLA 5FGSA 5D6CA 4MJIE 4PJCF 1DJSA 1LJMA 4N25A 3V6BR 1L0QA 4MAYB 4C4KO 5JQ6L 1I8AA 4Z95L 1TZ8A 2W60B 4FLQA 3ARGC 5IJCC 1Q9OB 4IBTA 5LCVA 1C8PA 2P52A 1DQDL 4KDTA 4ENEC 1F1AA 4IGBC 4O51A 3OAWA 4HPOH 3US1A 2QZQA 4AVJA 1DHKA 1E3XA 4UILH 4BD4A 4O02B 2MNUA 2WLYA 3G6DH 1HSAB 4XMLH 1AZZC 5D93C 4ATTA 3F3HA 3PWLB 2UX7A 3M7OA 2ZIDA 3TO2A 1E4WL 3CPLB 4GMTH 1NDGB 1I3GL 4E5XA 1MNNA 4FG6C 3OMAB 1UD8A 4D0CB 2Z4TA 4YPGA 7FABH 1U3YA 5DEGA 3VD5A 4XRCB 4NX0A 1UQSB 1NCBH 4P59L 2BCKA 4YBHA 1O6TA 2OP4H 1NPUA 3T2LA 4X80L 5DS2A 1OANA 1QWHA 2X2JA 2MQ3A 3VXRD 2ZJSH 3IDMB 2Z7ZA 4HIXL 3LIZL 4J28A 1BX2B 4J7RA 4M3KB 1G84A 1NFIA 1MW3A 4HWZA 1UGKA 2P4AB 5E0QA 2G2RB 1L6PA 3CIAA 3EJUA 3R7RA 3V6OA 5ISZB 1RP9A 1CU4L 3BUBA 2JKLA 4NIYE 4PGCB 3K6FA 5GS0L 1IGIL 2BFGA 3LZOA 1IL1A 1S9VB 4NC2B 3V55A 4R5VA 4HC1L 4NUPA 3V7AE 3K2MC 4F58H 2OYMA 2EXSA 5INDA 2VIRB 4BK4A 4JO8A 4Z3TA 2KH2B 1JWMA 4NRXA 3UEQA 4BJLA 2OCFD 3SBWC 3BVUA 2WYZA 3FUFA 4TTDD 5KTEL 3RFZC 4XMUA 1INDH 3GJFH 1RZQA 3RTQC 5D71L 5HHPA 2QPEB 1JMZA 1Y1DA 2P8MA 1FAIH 1I85A 3FBKA 3II2A 3N43F 4P05A 5DURD 5E8EA 3SPVB 4HIQA 4NPJA 1XGYH 4Z18A 3ESMA 4TQIA 4YSSA 3FUHA 1CTMA 2QTEA 4ZOBA 4PJBE 3C6SB 4OJAA 4KRPD 3I84A 4GUPB 4HEMA 3AS1A 3MOBL 2YQGA 3WS3B 4Y5VC 3V0EA 2EEAA 3PWUB 4YHIA 5KW9H 5JDSA 3TIDB 5KOMC 3T2OA 1ZJBA 3SGDH 2ZX6A 1G6RB 1KDIA 3C2AH 3MLUH 1CFVL 2DQJH 3V0GA 2C1OA 3ZTEA 4A6YL 3UTQA 3FH8A 3WY4A 5AAWA 1F6LL 2FLMA 2AXFA 2NPLX 4LCIH 3B1UA 1IBFA 3E6HB 3FBQA 3MCYA 3VGDA 5FO8B 4ZRGA 1NDMB 4KK9D 4Z7QF 1PG7X 1KTLA 3KYOA 4PJ9A 4WKZA 3O3DB 3D0VA 1Z9SA 2J2ZA 5AAWC 3APNA 4PJIB 2QR0B 5DHVH 2GIXA 2LVCA 2ZOWA 3EF4A 2VO5A 2CKBH 3RUGF 3PV6B 4YMPA 1LD9B 5C9JB 3NEEA 4X6DB 4MDJA 3KW7A 4L8DA 1FFRA 3FZUD 1JCVA 1MW1A 3CMOH 5C08A 4A7SA 4GIAA 2NY3C 3M46A 2Q86B 3TCLB 4BZ1H 4F1ZA 2Y7QA 4G8IB 4MRBA 1RIVH 4OBRA 1MQKL 4QRUA 3OB0H 3VQ1C 4KKCD 4G43A 5E9DA 2F8VA 1JYVA 3T65A 4GAJH 5T1DH 2EXYD 1NGPL 5EMYA 3NSYA 1OM3H 3CUPA 4ZUVA 1AC6A 2VLLA 3MV8B 3ULVH 3HS0A 2BERA 3O4OC 3QB7C 1O9ZA 1DLFL 4PLJC 1J86A 5F7DA 3UTSA 1JRHI 4XMTA 2X6AA 2ZWNA 1HWHB 3F83A 1N64L 3MRFA 1XL4A 4RDQG 2G5RA 4NKIL 3Q0HA 4OUUA 2ZCHL 4JQXA 3O4LD 3UZEC 3AQXA 3QSKB 5I8OL 4N8PA 3WY1A 4HSCX 2BPBA 3B9KA 3SJVB 1PLGL 4JANB 1DANT 3U4AA 3QXVA 3ULVD 4I2XB 5AW7B 5C8JB 3C87A 3O41B 1SF3A 5FK9A 1E4HA 3UZEA 3T0EE 3VB9A 5IREA 1T7VA 5BUAA 3S96A 2EP6A 4ZMAT 2VLJE 5GIRA 3RWDB 3L2MA 2W81C 5EUOF 1BPVA 1WIPA 3CHRA 1MVUA 2X12A 1U8LB 4GAYB 4PV1C 5JHDB 1JK9A 3DBSA 1FWXA 1MDAA 3DYMA 5KS9E 5LDSA 1NINA 2RQEA 1OWRM 4GRWB 4JRXB 4UIKL 4X6CF 5IVZB 5I1CH 3H6AA 1XEUA 2VLKB 4H8HA 2AXGB 1J9TA 4Z7WA 2E6JA 4GRLA 2FATL 2HUEA 3SKNA 3ASWA 4N3TA 5I0XA 3ARRA 1T5WA 3HMXL 2PPCA 4RQQB 3MHZA 4YWGL 3DTUB 1FFOA 4KKLC 2XWDA 4B3EA 3LD8B 2D9QB 2DBJA 4IRZH 2F54E 3UROR 2XV6B 1DDHA 4TVSa 4LNRA 3WJMB 3ZQ9A 1UCBH 1ASOA 3FFCD 5T33H 3K91A 4OQTH 4P5TD 2FBJL 3PP3H 2SEBB 1A7OL 3VRJA 5KVEL 4Y1AB 2WNGA 4NQXA 3I2CH 2BOBA 2FO4B 4KFZC 1EUUA 4WWPA 4L8SC 5FOBB 2D7OA 4J6RL 2A73B 2V6HA 1CE6B 1S5IH 4FNPA 5B21A 4N0YL 5EN3A 3GBNL 1PPIA 4AV0A 5FO2A 2VXTL 3GXPA 4WTXA 4YZFE 2VN3A 1UFGA 3HPJA 3QE5A 4OLXL 3H2WA 2UZIH 5GGRA 3LQZA 3QI9A 1FORH 4QO1B 4P46B 5FDWB 3KZ8A 3GRBA 3VGAC 1G1CA 1T0MA 1RHFA 4XPGH 2C3VA 3QQNA 4UM9D 3NBNA 2ZX7A 3WUWB 2HH0H 4O2FA 5BZDA 3WXWL 1FSKB 2NX5E 4NZUH 2A77H 3SQRA 5BRZE 5C70A 3NG5A 2FRGP 4B60A 1Y7VA 2OXHB 4MS8D 4LXFA 1XQ4A 1PZAA 2E46A 3FHEA 3FN9A 4HJ1A 2WO3B 1I1CA 4NWTH 4PS8A 2UWEB 1JFQH 1VFBB 4X5PA 2FEDC 2W92A 5DDHB 3NN8A 2ERJB 3UYPA 3V0AC 2UVEA 2X5PA 4HS3A 4L9LA 2CWRA 3MUGA 4RMWA 4U49A 4EMZA 2JH2A 3NRFA 3MUHL 4N0CC 3NIGF 4JG0L 2DQDL 1S9XA 1QUNA 5T1MB 3K71A 5IM7A 3WJLA 4ODXB 3ZKQD 2AEIT 1FORL 1NC4B 3DC0A 3WELA 2W9EL 4K2UH 1P7QD 4KH2A 2GJ6A 2EDWA 4NSKA 1OGTB 2AERT 2CNYA 4B27A 1M42A 1P7KB 1RUKH 4M6OH 5KSBB 4AM0A 3OSVA 1OGSA 3U9UB 1FZOA 1M56B 2R1WA 4G59C 4OF7A 1SF5A 2XWTB 4O2EB 1I1AD 3V4VB 4YHPA 2DMKA 3BWAA 4KJPC 4S1SH 4MSWB 2WBJA 5EO9B 1QMUA 1ROWA 1ZOXA 1S3KL 4I18B 4Q9BA 3PXHA 3GK8L 4EI6B 3NFNA 2AEWA 2FHCA 1HOCA 2Y0SA 1BYPA 1OO2A 4NCC2 4JFEB 3LH8A 4XC3H 5TGBA 5D7HA 2YD1A 3TZVC 3WO3B 1ZS8A 4WWKD 4RMBA 4RMVA 3ECWA 2APXA 3E3QE 5LGYA 2IH1B 3MGOB 1XTLA 2I27N 4PY7B 4Q4EA 2J25A 4AKQA 2FO1A 5DFVD 3O9WD 3NCJH 2X53A 2B16A 3RDTB 4PLKD 3CLFL 5KBMA 3MUJA 1T04B 2VMEA 4L37B 5MEOB 3MRJA 4XO5A 2JCCA 1LK3H 5DS1A 3X3FH 2WV3A 5AFAA 1R0AL 2E7LA 1J8SA 1UT9A 2OS7A 1U2HA 2QGCA 2XQBH 4KV5F 3ZE2F 1N8OE 5K9OA 2Z8RA 4HHAA 2V2TB 2OMXB 4RFNC 1S4IA 1OGAB 3T2PA 4B95C 5FYJL 5JHAA 2XN9B 5GGRY 2OFQA 2H47C 5HYQB 1TUPA 3JTSA 2VDOB 2WN3A 3DX7B 3RPIA 1IBGH 2M26A 1XF4B 1KCVH 1T4KA 4JCLA 4CDHA 5ABDE 3WY3A 3GT6A 1XDTT 1RIUH 2DKUA 4HMDA 4BEIA 1UZ8B 3SDCB 3QJHA 4Y4FA 3O3EB 2Q8AL 1WSST 4JN1L 4WTQA 3OQ3B 4KGLA 4PSPA 3NJHA 3SDXA 1CIUA 2N1KA 3KL5A 1Z3RA 4TNFA 3QJUB 3INOA 2V5YA 3FO0H 4KMTL 5E4OA 5HJDA 1QEWB 3BGFB 2VDRH 2FSEB 4QAWA 2DBLL 5L7XH 1ZLUH 4URKA 5J11C 4JFFE 3ES6A 4MD0A 4NQDD 2UZPA 3LH2L 5B7EA 4ANKA 4DWHA 3OHXC 4FLHA 1WEJL 3V2AR 2Z7YA 2X4NA 2G9HB 4P5TB 1NFDE 3LN4A 3RTQB 4ZPVB 1K9TA 1BVNP 2GJ6D 3PXJA 3IF1A 1ACZA 3TH3T 1CD0A 3KEHA 1OQOA 3T04D 3UG4A 4L48A 5D70L 1AFVL 1FLRL 3KH4A 1GJUA 3MBEC 4F2EA 3D3VB 1AKJD 1JUFA 3FAWA 2D73A 1G87A 1I1RA 3U4EA 5I8CA 5D2LF 3MLRL 4F7MA 2CHWA 1RPKA 4YE4L 4I0CC 3C5ZA 4I77H 3T1FB 5F70A 4MRCA 2ZXDA 2DQEL 5JHDD 2KL6A 4RGND 5F7UA 4PVLA 2UZXB 4PWFA 4F9LC 4R7DB 4L4TB 1OLLA 3QARA 4L1DA 4P57B 4TVPH 3TJEL 1GGCH 2JNZA 1WG3A 1HDMB 3KHOA 3WE6A 3KXFE 1AO7E 4P2RB 5JHBA 3QEHA 4Z77B 3W5NA 1W9XA 3TN0C 1H15A 2CLZB 4JZOB 4ES9A 1MCPH 2B1OA 4GEJA 4RISH 3WU1A 1H0DA 2EYRB 3MRNA 4ODVL 2YPLB 1OF2B 3O6LH 4LL4A 4GSQA 1NCNA 3PWPE 5D1QB 2NY5H 1NC2A 4OFKA 4ZZKA 2MWCA 3QJOA 3T3MF 4LQ1A 3P9LA 4M6ML 4QTIL 2VN7A 3WTXA 3NIDE 3ZDZF 3EBGA 4YXLL 2IV8A 1N8ZB 5I16B 1D9KB 4ADJA 1VGKA 1OSEA 2XKUA 4CMMA 4WGKA 2ADIB 4YGAB 4HBCL 3RWHB 3OD3A 4FJYA 3S37L 1AS7A 5KJRH 5C0BB 3UTPD 1J8RA 1S7QA 1YECH 2F15A 2VLKD 5E8PA 2HH0L 4ORGA 1RJYB 4GI8A 2VLJA 1K4DB 2X1QA 3LKPB 4PTUB 3MXVL 4GUCA 4Y4FD 4BQCA 3QUXD 1HHHA 2EE6A 5KEZA 4OFYA 1U9KA 4YXKH 4Z3FA 2EVHA 4S1DC 1DQKA 2WUBH 3MLTA 2P44B 4AJYV 3QZMA 1UVQB 2VSMB 3BISA 1Q9KA 5FO7B 1IM3A 4W9CC 2VXTH 4TUOA 2QQNL 2DJ4A 1EH9A 3POCA 1FCGA 4Y16C 5DS8B 4RIRA 3NCYP 5FYLH 4M9PA 5LHDA 1OVZA 3A47A 2AK4E 3FCBA 2VW4A 1CL7I 5ILTH 3SJVD 3DGGA 4ZMOA 3QWRA 5LCVH 4HUMB 3QDGD 4DK5A 4HOXA 1NJ9A 3MOQA 3PPSA 3TL5A 3ULUD 1FN4A 3OMZA 4X0KB 5E6RB 4HPOL 5EPMB 4EBQH 4EUPB 1TKWB 1M4KA 4PN6A 4UT9A 2EADA 3VJ6B 1ILUA 1SMAA 1SUHA 5E9DE 4A39A 4AGMA 5ITBL 1AO7A 1KIUA 4L1LA 4FTVE 1QQDB 2F53B 3FH5A 2VITB 1TF4A 3RVUD 4BQBA 3U0PA 1JNHA 1U91B 2YRBA 1K4CA 2CRIA 2C4FT 3QXDB 1R3IH 2IANB 4N22A 5DK0B 2AEPL 3T0EB 5IOKA 1Z1WA 1HQ4A 4XN8A 4PJDA 2A4ZA 3T8VA 3TWCL 1UD5A 4I5BA 1DR9A 2ZUVA 3W9EA 4NUMA 5IQ7L 3E38A 5DD6B 5JIMA 1FYTE 1RSYA 4JFFB 4IDJL 3IB4A 2GHZA 5SWSB 3BGMB 1MJ7H 4LCYA 3O8XC 1QSZA 4HUVA 3QIWD 5IVOA 4G1MB 4G3YH 1LO3H 3O3EA 4WCYL 3GWJA 5ITFA 2VDOH 4HOMA 1I3RB 2WLNA 3DX6B 3TIEA 4ANVA 2DEWX 5HHME 3FO0L 5L6YL 1QI3A 4WW2B 3AC0A 2K78A 3NA9H 3F01A 5FYJU 3FQ4A 2CJ3A 3EYOA 1U8HA 3U7YL 5BRQA 4IBYA 1G7QA 3REWA 3FT0A 1HHIA 2HFEB 3HHMA 4UQ3A 1AAJA 5CD3B 2N7SA 5HI5D 3OGCA 2OMXA 4ZI8A 1X9UA 3MRMB 3U82B 3NGBC 4PJIE 3RI5K 1ETB1 2CUAA 3QFJD 2FX7L 1T1XB 1EA9C 1RVFH 3C2SA 2J8OA 5IFHL 2R0WL 3P3RA 4ZX5A 2GY5A 1PZBA 1SDYA 4XMKH 5MERB 2ZXQA 5EU7C 1EQWA 2ZUWA 4AIEA 3TC9A 5J6HB 2FL5A 3DK0A 5DJCA 2VJXA 1YA5A 1CL7L 2LAAA 4V2CB 4AENB 3CLFH 4KY1L 1T7ZA 4D9QD 2W0LA 1ZA3A 2DF3A 2WY3B 1OSZA 3H3KA 1AD0B 2R2EA 1MFCL 1PG7W 3AWFA 5GGTH 3R7QA 2JIXA 4PWEA 3MV9D 3P4NA 3DMMC 3SO3C 2BVOB 2F58L 1QLFB 2VDKL 2XQYK 4XBPA 4N0UA 5IUCA 5LKNA 5GZOD 3OXSA 4MB3A 4GINA 3DPBA 4G7YH 1F0LA 5MP6H 2F7OA 1FNEB 2OMZA 1HOCB 5FM5M 1ZD6A 3B8SA 5CMAA 2J21A 5GRJL 1XGQB 1HE7A 1Q1JL 3KLHC 2Z6FA 4ZFGL 4QPEA 3RU8H 1GMIA 1SHXA 4EI5A 3AVEA 4XVTL 3MRMA 3SCMB 2CKNA 1EBPA 4P5RA 3KPMB 3RVXD 3TEXA 1TPXB 1MW2A 2NX5A 1MPAL 5H4YA 4GRWF 5JPNA 3P11H 1OPOA 2VSCA 1G5AA 1B2WL 1IIIA 2BSDA 3A67L 43CAB 1JI2A 1G7PA 1XT5A 4QEGA 3AGVA 2WYTA 2EXWC 2W9EH 1N67A 3FHAA 3GKZA 1UGNA 3QHTC 1YSOA 4KI1A 3GXIA 5ELIA 1VERA 4OB5H 3VG0H 4DK6A 4KTDH 3MFFB 4MXVF 5FA4B 4GIOA 4HLZH 1U4EA 1BJMA 2L7UA 4XPHH 1F4YL 5TJWK 2H3XC 4E36A 2YGVA 3UYPB 2RFXA 3AT0A 3P3UA 2ZXWB 5CO1A 3ZKNC 1S78D 1X7QB 1OCZB 5ESAA 4ZOAA 1Q0XL 4HJJL 4OM1H 4MNQA 4FTVA 4MASA 3VFVA 3QIWA 2FECL 1WUZA 4WEUD 2JJTC 3WTWA 3PU7A 2JLLA 3QXDA 5DR5L 4L0PB 5IVNA 3WUWA 3Q3GB 4ACPA 2Y7NA 5DFTA 3LIZH 3ARVA 1K3IA 1LNUA 3TV3H 1VKXA 2PO6D 2C3VB 4WHYH 5GRZA 3U46A 1A6TB 1MHPH 1ZS2A 2GSIA 3BJ91 5FFGA 3WG7B 5IG7A 5A2BA 2A9AA 4LU5H 4OT1L 4JREB 4TUKL 1B4JH 1JZIA 3EJYD 3IMRA 5EA0H 5LCVL 2CGZA 4ELMF 1A14L 3BKML 1SEBB 5GGQL 3BPCA 2DDQL 1WWWX 1I3GH 2A73A 1IGJB 1C5BH 4N5ED 5EIQA 1FN4B 4X0KA 2EXTA 4EUPA 4NBZB 3CDYA 3SQOH 3B1TA 1AYRA 1WZMA 4Y1AA 1OAUH 3UBXG 5D1XA 1J1OL 4HW6A 1AJ7H 1I4FB 4QGYA 3UCRA 3MR9B 4N2BA 1SLWA 1N7ML 4XXCC 3F04A 2HJLA 1KEMH 2JIXD 3K2KA 4AKPA 1BP3B 3FO2A 1A3LH 4IRSC 4RLDA 2M83A 3W11D 1X5FA 1IGTB 1KB5A 3QXAB 1UXLA 1A2YB 2IADA 1Y6KR 3F7YA 2IOMA 4GKLA 4LAQH 4NM4H 5GGVL 3VGHA 3WFDH 3WJJA 3SDCD 3MJ8A 4XXDB 4YUEL 1F18A 3AMKA 5EU6B 5HHXH 3QISA 5I6XC 4IJ3C 4RFEB 3ILDA 1MCJA 2EICA 4TQEH 2W1NA 1MRFH 3QCUL 3QWOB 2W0FA 3QO1A 1WV7T 1XH1A 3EO9L 5DZNA 3T1WA 5A6LA 5IIEB 1D6VH 4GT0A 5FGBA 3ISRA 4KWUA 1RHHB 2GQHA 5F9JB 3EHBC 4QHMB 4R96A 4APQD 1VGKB 3N55A 3T0AA 2OMVA 1IT9L 1NOFA 5EF1A 4M1GH 4HXBL 3DIDA 1HILB 2Y9RT 3FQNA 4CRPA 1JTPA 3EBIA 3OV6A 4DN4H 2CDGA 1YNKH 1JG9A 2B77A 4PJHA 2BX5A 5LGKA 3O4OB 3VD2A 5I1JH 1X5AA 3O4LE 1T2QH 3MRFB 5DC4B 4MXQD 1GYWA 4UQDA 1UM5L 2F7RA 4ETQB 3CSPA 1FFNA 2EABA 3CFUA 4U1GC 3CBKB 1CFTA 3K8LA 4X83A 1X4XA 4YXHL 1KSRA 1AP2B 1KJ2H 1LQBC 3IJSA 2ZXAA 3FCSA 4MNQD 5B38B 3UERA 3MRKB 4G43B 3C60C 3D39D 4LHUD 3KDMB 4ODTH 5IF0B 3U7WL 5IBTL 1G7JB 4M7ZB 3CFCH 4L4TA 4NQCA 2VQ4A 4HKJB 1WWBX 2WGXA 1HWGB 2A6DB 3HC3H 4GFTB 3S5LB 4DNLA 3WI9A 2OXGB 2GTWA 4U1NB 1O6SA 2IAMA 3JT2A 5EU6D 2PYEB 3U4EB 1DZ0A 4NDMA 4H88H 4HHGA 1FG2A 4P48A 1UYWL 5AOKA 4LCCC 4RISL 4AEEA 4CU8A 5KYYA 2QPDB 3E8UL 3SPHA 4F93B 3CVHH 4ZAKA 2Z31C 4PGEB 2WWMD 1OGAE 4AQZA 1JDCA 4P9HC 4YDJA 4ZPVA 1E27A 2OYKA 5B1KA 3ORJA 1LHZA 4Y1AD 3CN3A 4Y2LA 3GGWB 4FABH 3ZBMA 4KY1H 5E94A 3O3UN 4Y9EA 5L8LB 1AC0A 1GZPB 5D1XD 1FIEA 2WQ8A 3LSOA 1TR7A 3ES6B 3K6SB 2QSCL 1RPQA 1Q72H 2H32H 4FG2A 1AMXA 4F7CA 1MI5E 3U6RA 1E5BA 4P23D 4AL8H 5C2UB 2IAMC 1LO2H 4MCZA 1SVCP 5CHNA 2CGYA 4EVNB 1KY7A 1RZGA 3MGTB 1D5IL 4AVKA 3CCHA 2QMKA 3SDCA 2WLMA 1ZSDB 4HCIA 4WWID 1WIOA 4U3HA 1DQQB 3STBA 3RI5F 3HVDA 1TFPA 3L17A 3QP3A 4NFDA 4XCCH 3W0WA 4DUXA 4K3DL 1T2QL 1F90H 3MCLL 5F7FA 5C0IA 1MFDL 4BA8A 4K7FA 5IHWA 4M5ZH 3V5HA 1HQRB 4YBLC 2X6CA 3TYFA 4I0PD 4G8AC 1BYOA 1ZAGA 2Q3AA 4PYGA 4OZHB 5INDB 3B37A 2X4PA 2GJZB 1FNHA 5TK2A 2NY4B 3LZPA 4N2EA 1X3DA 2KLTA 1N0XL 5D1XC 1XB3A 1BEXA 1DBKL 2AQTA 2B59B 3D2TA 1J9QA 2KI6A 3K8KA 3JBG7 1SUJA 3FPYA 3UJJH 4ONGL 5EA0L 1BQLL 3FMGH 3EJQA 4Q6IA 5ALCH 4OFDA 1BX2A 3FUKA 2ICWB 5DD3L 2AMGA 4TL4A 2DKMA 1QO3A 3D7PA 4DGYL 4TUJB 4JO1H 2OSLB 1RZ7L 4U6YB 4AYFA 1JAEA 5IEHA 4N9OB 3LXUX 2DQ6A 3WDJA 3LX9A 4QOKE 2J5LB 4NLHA 4KJWD 4Q56A 1P2CA 3UZVB 1FV1A 2WSDA 1HHJB 3KPQA 4K5OA 4YDMA 3THMH 3VTMA 3UJIL 4JG9A 1S6NA 3NTCH 2QSQA 4AGLA 1U42A 3IM1A 1JF1A 3FFOA 3C8HA 4JFXA 2VYRE 4CSTA 2HJFA 1YEKH 4QY8B 1HINH 2CBPA 3KBHE 4NC0B 3ZOAA 1SLVA 1E4XL 3SKOB 2DQDH 4KXCA 2FT8A 4UMSA 1BQRA 4GG6F 1KCSL 1ML0A 4HJ0D 3SZKC 3VGFA 4ZX3A 5LUMA 2EDDA 1X7SA 1KZYA 2DQHL 1YCSA 3FQWA 4GSRA 4XVUD 2YMXH 1THAA 2BP8B 2AABL 2EEBA 5D6CB 3DX0A 5F1NA 3CN0A 3FCTB 1HSBA 2NXZD 4MA7H 4C57C 3MUGB 5E9DD 1DQIA 1E90A 4PRPE 1MH5A 4NN5C 3DWTA 4Y4HA 1CD1B 1FO0H 1E28B 2GCYA 3EO0A 4OJFH 4HJTA 1KYOK 1HHKA 3MRBA 5GSRB 3EZJB 1N6QL 2GEQA 2DJUA 3KL3A 2FTAA 1VRSA 1O7VA 2NYZA 3VI3A 3QUHA 2K8QA 3QR0A 2WXRA 2ZOLA 1CFMA 2PYEE 4O5LH 5HHOA 1MFUA 3TBYB 5KSBF 3B9KD 1UB5B 3AREB 2Z0BA 5JNYB 3KLAA 2ZUUA 4R0LA 4A7GF 3LEYL 5L0QC 5BV7L 2F6AA 4HSAC 4OCNC 3Q9QA 2G5BB 3SQOL 4HIEB 4NUGH 3FQTB 4GPVA 4PJCA 3SQBB 1NKRA 4W9HC 3ARXA 1T03L 3KPSA 3VXQA 3WAKA 5C0GB 1LP9B 4HIIA 3VFSB 3MXVH 5CZXC 2H1PL 4NQCE 3CZLA 5I8OH 4D7BA 1X4YA 4MQSB 5HVHC 3EXLA 4JVWA 4MBOA 4JBSA 1MREL 4E42A 3Q5OA 5BZZA 4D9RE 2VB5A 3V10A 1BEYL 3WIFB 2K9FB 4XPBL 3ULVC 2EDKA 1XSOA 3U0TA 2Z1KA 1J8HE 1D9KD 5DRXA 1F4WH 1KCRL 3CXHK 3ZLQC 1M7XA 1OAYL 3GFUA 3QULB 4WW2F 1YEGH 4W9LC 4A6YA 1J5HA 1I7TB 1U21A 2PWHA 7CGTA 1FYTB 3FH7A 1OT2A 3RWGB 3RX9A 4E5XG 1I8UA 3VXSB 1D5XB 4TULL 1HFUA 1OSPH 3MX0A 3NPSC 4ZMPA 5HHNA 3FCGA 1G0YR 4NNYB 1OCWH 4OD2A 1JN6A 1QTPA 1BPLB 4N4YB 2IDCA 1UHVA 2GYSA 4XVSL 4WWOA 3GXTA 3QI9D 5DLML 1CIDA 2RCSL 1UJ3B 4PJ5B 5ERWB 4JPIB 2EDLA 1TCRA 3PREA 3S4SA 3T6WA 1ACCA 3LXAA 3JV6A 2WZ6A 3V0VA 4KJYB 4WV1A 1MLBB 2DQGL 1IZJA 2F54A 5I0DA 4JGMA 2QQQA 3U1SH 3L3DB 4JY6A 4XTRC 3ESVF 1VEOA 1OARH 4O58H 2BHZA 4QD2E 1G43A 4PRBA 3FS9A 4Y88A 5DJ8B 5EO1B 2BY2A 2PW2B 4HUCA 2OTPA 3T0WA 1A5FL 3P77A 1WBXB 2Q8AH 2J4WH 3OKNB 3PQYA 4PJIF 2WIIA 2FB4L 4JRLA 2VLLB 3S37X 4N6RB 5DTFB 3Q05A 5H35B 2Z8VC 2XZQL 2VDOL 4WI0A 3T65B 5TE7H 2X40A 5EU5A 4MJIB 1P4LA 1CICD 1UUNA 3RKDD 2D03L 1ZVSA 4XPFH 3TT1L 2A4EA 2EUZA 1D6EA 3EG9A 1REIA 4JDEA 4JW3A 3FW6A 3K1KC 5HHOD 5D4HA 2C7UB 4LDLB 4Q58C 5TTRA 2X2IA 5D1QD 1P7QA 1NBCA 4S1QH 1ZT4A 3GZKA 5AZEL 4QYAA 5CEZL 2DWYA 4HKZB 4EZJA 3DOSA 3DRTA 3GSOB 1DVXA 5LGHH 5CJOL 1B0GB 3I9AA 3S36L 3HE7C 4PSRA 1EX0A 2WINA 1I1AA 3FQ2A 3FQRA 3WMSA 4ZXBC 3MNZA 3ZMRA 1HYSC 4GG6A 1PW3A 4LPCA 4E41A 5HYSG 4KKNA 5HY9A 2XFXB 1ETZA 3QG6A 1ANUA 3MLSL 4FCAA 5ESQA 4F20A 2DH3A 1NCUA 2NR6C 3CFQA 4TQEL 5ANMA 3Q48A 1GYUA 2CJUH 4JFZH 2VSDA 3O6KL 3MA9H 5AG8A 5DHYA 3AAZA 2HLFD 4NZFA 4QOKA 4MJ5A 1YYMH 2BWDA 2YMOA 3CH8A 3HCVB 3OJ2C 2F1EA 5L2KD 2Y6SC 3NA9L 4RDQF 1W0WB 4TQ8A 4UINL 2CLVA 3I74A 4KROD 3AG1B 4G7YL 1U3HB 2YPVA 1JZ8A 3BGFC 1NEZA 3N50A 2HSIA 4Q6YA 4XCFH 2ZXBA 5I30L 4J2XA 2YGOA 1RMFH 1BVKB 3LOWA 3CIQA 3D0LB 1EEUA 1SBSH 3TFKD 1C1EL 3V79C 5F7EH 5EU7E 1G6VK 3D0LA 2IOOA 1G7IB 4M1DL 4RCAA 3CJJA 5IMKA 2E27H 3L5IA 3PL6A 3T0BA 5DJXA 1KBGH 1BZOA 2R7EB 3FRPA 3DA0A 3IFPB 3CLWA 1U3HA 3DHJA 1S78C 5D9SB 3C6LC 1G9NL 5SX5H 3IDNA 5CCGE 3WL9B 4XI5C 3GO1H 3G5WA 4KK5D 3OM3B 5D4QA 5FC9A 3QDJE 4M9OA 2D7TH 3ASOB 5DHYB 2F54D 2Y06L 2NTFB 5DHXB 4OI7A 1CN4A 2OV0A 3EHBD 1QW8A 5JPNC 3ZT7A 2YD7A 4Z7IA 1KDJA 1KMGA 1G9HA 5CIPA 4JHWL 2HFGH 1OWWA 3IDXL 3L13A 1PKQB 1XX9C 3WV0A 1MCNA 3PQYD 7FABL 4X80H 2UX6A 5BS0B 3VVVA 4L8BB 5ALBH 4J1UB 4P59H 5C09E 4JKMA 2EEFA 2ZZUT 5JW3L 1AACA 3WL9A 4A7GA 2VDNL 1QFWH 3W11C 4D0CA 2RMNA 3O3AB 4GKSA 4JRXE 1J5OH 2CLRB 4KKBC 2D7MA 4QT5A 1SPDA 2XSKA 3CDFA 2NNAA 4GAGH 1VFAA 1NDGA 4FHBD 2H6UA 5FYJE 3PV7A 3SIKA 1A6UH 1QSEA 1RK0B 1HSAA 3A4EA 3OKKA 1QHQA 1XEDA 4GW1B 2VW6A 5FLVA 1NBQA 1RZKH 4LEXL 1FJ1A 4IRJB 2PUQT 3EJCA 4HXAH 3PF2A 3KPTA 4AYBA 3PJNA 5B39B 4ZG1A 1S7XA 2WZPA 3DHMA 1IEAA 4U7KA 5M95B 1CE1L 1EBAA 3DYOA 1TZHB 1U58A 1CF1A 2P8PA 1G0XA 2GT9B 2LOEA 3L3OB 1PAZA 2CHDA 4ZFOA 1CQKA 3NSXA 3F62A 2VOTA 2D0FA 3D4ZA 3PHSA 4N90D 3V6ZB 3VGBA 1GC1L 5BXFA 1OAQL 4FFZA 3T5WA 5J0BA 5CJQL 1T7WA 5C0ND 3VWJD 3QQ3B 5SWZA 1TJHH 4JM2A 3IJHA 4LLWB 2ARJQ 2DWEA 4L3FA 4DPRA 4KDTC 3MODL 2PTVA 3EH3B 5IB5B 3QJSB 1AY1H 4CU7A 3DNKA 1KLFB 3ETTA 2XIIA 1IEBA 3TM6A 3AY2A 4FZ8H 4ZFZA 3GSOA 3VFTB 1XXFC 3AB0C 4MB4A 5T1LA 3PGFL 1XF1A 3BN9D 3LRSA 3AU1B 5J6GB 2IGLA 4K9JA 1DTUA 1NH6A 2CGRH 3GSRA 3QZWA 3LXBA 4AMKH 1BMZA 3ZKND 1T66C 4J3OD 3REVA 1N70A 1U8PA 2YXFA 2R0LH 2YN5A 2VM9A 4TQHA 1GAFH 4AYID 3I9PA 1L9NA 1YEEH 3MTXA 2EYTA 4GXVH 2H2SD 3X1NA 1SYVB 4NJAL 2IWGA 2YAOA 4N0FB 4MJIA 2N1TE 5TF1L 3ARFB 2VLRE 4AQ1C 3FRPG 1KENL 4KPHH 3GSUB 3SKJH 4BZ2L 4OZFB 3VD0A 4CC1A 4MQ7B 1PLBA 3BD4A 2ADFH 5BVJB 2XHNA 2HCZX 2WKOA 4PU2A 1UURA 2VLJD 2B8OT 1QR1B 4OJDH 3RPKA 1PZSA 3GMQA 1IQDB 4JRFA 2BMKB 4PRBB 3S36H 3CZSA 4OFYD 5HGAA 3LQAL 4NQVA 4Y9CA 4ZAKC 2CMRL 1P69B 2R4SL 3B9VA 1MFCH 5GGTL 3EJRA 5C6PB 3GSVA 1SXSA 3IEAA 4X98B 3CZGA 2VDKB 2BOCA 3UC0H 4HLJA 1T83C 3J2PA 1F45A 5FGCE 2ESVA 3RWCA 4AMKL 5CCKH 1UJ3A 1CGSL 2UZYA 1ZXQA 3MLZL 2BY1A 4L2LA 5SV3A 4PGJA 5I0ZA 2P24A 1B90A 5D7LE 1I1FA 2Z34A 1J0ZA 3DI2B 5I66B 2JJSA 3OKLA 4AOFA 1P5VA 3L7FB 1II4E 4FXKA 5LB1A 4HGWB 3UTTA 4OF5A 4OZHF 3S8GB 4Q8BA 3EZ8A 1E30A 2OX5A 1D5XA 3BX7C 5HDQH 2GCYB 2GUYA 4U6VH 2CK2A 1CB4A 1OAQH 1PDKB 1RD6A 5GJTH 4A6YB 4H0IA 1XF3A 3ALXA 5MEQA 2JKSA 2CK0L 4Y5XA 1MZZA 5DXWA 5T5NG 3TZVA 4FQIH 3EJZD 3RL1A 5LVEA 3IXTB 1SXCA 4BK5A 3OAZK 3OQRA 3EADA 1HE8A 2LVEA 3I6GA 4FX5A 3O6MH 5ICZB 2MJWA 2YC1A 4U1JB 1KF9B 1YUHB 4GKNA 2Z4QB 3UBXI 5JXAL 3X13A 4HCRL 2BRQA 4H4NA 3DVNB 4FA8A 1XL6A 2B15A 4PG2A 2GY7B 1HS6A 3OKOB 3QUMA 1OTTD 1ZHLB 4KI5C 1VLXA 3TBTA 1M9WA 3HB3C 2NUTB 4OJYA 1P7HL 5FM8A 2VXQH 3E2HB 1A65A 2VRKA 3AG4B 1XB8A 2X89A 4UAOB 3VWJA 1LP9E 2JB5L 3H6JA 3NVQA 2NSXA 3VFSA 4HMEA 1INDL 1P5UC 4AXWA 2ZAHA 2BWIA 3SEPA 3BZEB 3DTXB 5JZ7D 1UD6A 4Z7AA 2E74C 4PGBB 5J56B 1KLUA 2EH8L 3IFNH 4LSVL 4YHLL 5D2LB 3BE1L 4Z1PA 1QA9B 1ZE3H 4HJGA 2I9LA 1DE4A 3U6XS 4RMRA 4R0LB 2IPTH 5JNYA 4X5QA 4NQSB 1RZFL 1UB5A 2NY1B 4N2DA 4ONHB 1HEHC 3KPLA 4UCFA 4IYKA 4OGAC 3NSCA 3TN0D 2L7EA 2N56A 4K7PL 1RZJL 1X5GA 1IBYA 5DMIL 5KW9L 4LAQL 4N8VB 4ISVA 4NM4L 4WNSA 5GGVH 1G7HA 4EPSA 1N5AA 4XHJD 3D25A 4G6AD 1RUAL 4G6MH 3VGEA 1D5ZB 5I8KH 3KWVA 3L1OL 2IG2H 3QQDB 4NPKA 2XZAL 1WCBB 1E28A 3P73A 2Z8WC 4JO5A 3WEMA 4B6ZA 1MH5B 4WWKC 4BE6A 4Z7OF 4JDVB 5LXVA 5IJDC 2ED7A 1RJZB 2Y06H 3U2JA 1T03H 1HSBB 3Q1EA 3MNWA 5A2JH 5IJBC 5DMGC 1RUKL 1UB6B 4JM2C 2XVKA 2DI9A 1J88A 5EZLA 1QRND 2V8MA 1CFSB 3P30H 3QFJE 3FRUB 3MLVH 4JDTL 4I3RL 4H26A 5EH1A 1AE6H 3OPUA 4TN9A 1UC6A 3BAWA 4Y4KB 4AH2B 5JPMB 3MA7B 4NKOA 4E9YA 1QBML 1JF5A 4X8CA 5D7JB 3K74B 3SDDD 4FQLL 3RIAK 4KNTA 4F8OA 1TU2A 4EN3C 5HHXL 4R9HA 4ZMXA 4Z7NB 2WCGA 2AJZB 3SGKA 4DVRL 4ZTPH 3FT4B 3B6SA 5CR8A 4JFDA 3UTTD 4UT9L 5IMLB 2CD0A 1I3UA 5E6UB 3IKCA 5IMMA 4Y1SA 2R59A 4HIJA 4TYUA 3PHAA 3KVQA 4RA0C 3KPRA 2C9QA 3LHAA 4Z78B 2YPKA 4L8CB 2J71A 1J1OH 5IK3A 4LMQI 3VVWA 3AMLA 1Z66A 3BVNA 4D9LH 1BFVH 3PWPB 2L7JA 1SZNA 3HMWH 3UGUA 4AQEA 4BELD 5MENB 4Q6IB 2VABB 3BT2H 5CZXD 3OPZL 1E2WA 3UAFA 4Q52A 3WHE0 4JRYB 4ZOEA 1NCGA 3BD5A 1AMYA 4JG0H 3EOTL 4NAQA 1FZJB 3WNKA 5TDNA 4TQPA 1TJXA 3HR5A 4XPAH 1L9RA 5KSAB 1B2WH 3T77A 3VFMB 4NQEA 3CFDB 3L9RA 4D8PB 4FTVD 4WU7A 3TYFB 3S5LA 4HUNB 5JLZB 4M29A 3N2JA 2UXGA 1CLOL 1IQWH 3R0NA 4LLVA 1R3HA 1ZTXH 4PW3A 3RWJA 4B9FA 1NLBL 2YHGA 3W39A 1PIFA 3R0MA 2H7WA 4IS6A 2A6IA 3TN0A 2E59A 3DO7A 1BOGB 1IVLA 1L0YA 1JS4A 3HVNA 4NJAH 3FCSB 1MSPA 3D3VE 3CSTA 5F0MB 2GTQA 1OM9A 1U8NA 4CVZB 1JMXA 1X6NA 1XV8A 3O0LA 3O0RH 4X50A 2JTYA 4H8WH 3UADA 5FYJH 4EXKA 4XCEB 4ICXA 4ZUTA 4GH7B 5HYJA 2ZG3A 2PXYC 3QIBC 3NEXA 2FHFA 2P8LA 4OZ4A 3L3HA 3KVPA 4XX5A 2AK4A 4FABL 1IBBA 3AITA 2CDGB 2H3NA 1VADB 2EIZA 4M5ZL 3VXMA 4UI2A 2AJVL 3C60B 3DETC 2Z31A 2DM7A 2VDMH 1HZLA 2XWBA 4UUJB 4DVBB 2BS8A 1KZQA 1H8LA 4KMTH 2CAKA 3DUSA 3GXUB 3LH9A 1L9OA 3FTWA 4HGKC 4KKRA 4L3AA 4ZAKB 5IIEA 5E95B 4JFQB 1PKOA 3PXLA 1KXTB 4X99B 1O9VA 1OP5H 2B1HH 4BHUA 1OSPL 3FTGA 1D5MB 2LABA 1KEGH 2EE9A 4RFEA 1RK7A 4YDNA 4ACTA 1ZHBA 2AV7B 2IVFC 3RA7H 4KZDL 4IRJC 4HFUH 2HB0A 4RA3A 5J5EA 1GXEA 1MNUL 4UAHA 1DLHA 1YEDA 2WXJA 3BWZA 3S97C 5A40E 5JZ7C 2ODIA 1WZKA 4GQPH 3ZR6A 3KPRD 2H1LM 3ZKMD 5CP7A 2X4RB 4UNVA 3AU0A 2O26U 4WEBL 4AW4A 2WYHA 4D94A 2O5YH 3RBSA 4KI5D 15C8H 5FKAA 1RERA 4Q6KA 5KANI 3FQUB 3WHE1 2NZ1A 1TTRA 1AXSB 4WGWB 5ESVA 5I9QC 3V5KB 2PCYA 2CRZA 1MJJA 4JB9H 1T22A 3H0TB 4WHTB 4XP6H 2YK1L 3O2WL 5IBUG 4GRWE 4I0PC 3D06A 1KGWA 1JGLH 5T3XE 1PZ2A 4MA3A 5D1ZI 2R2CA 1TSHA 5DUBA 3WEBA 5FUOL 3TA4D 1TNMA 4M62H 4FNQA 4OCSL 1DFBH 1J05B 5DQ9B 5TQ0H 4FQHB 4URTB 5A16A 3NK4A 3VTTA 1YEWA 3NCEB 2XU9A 1AS6A 4NQCD 3ATDA 1M1XB 2ZX5A 3VM5A 1R3KB 1I9IH 3ELAT 3U1SL 2MKLC 4PRHD 1U93B 1U8QB 2WVVB 4PRAA 4OLYH 4Y1AE 1XGRA 2IAMD 2J7LA 3RVVC 1X5LA 4FL4B 5ECJE 3F7YB 5IW1B 3ECBB 3BP6A 3GRWA 4FQPA 3JWDC 4BDVA 2J1WA 5F6HJ 2KYIA 1NFDA 3E8VA 1KG0A 1Z3GH 2I60L 5BPPA 4FFZH 5EOQL 1HHGB 2NYYC 5IVXF 2R69A 4M93C 5J3HD 1F3DH 1G7PB 2JJVA 3LDBB 5T5FA 1BLNB 2Q7AA 1PG7H 3GMPA 3GTNA 1WZ1L 4LGRB 2MH4A 1FZKB 4YPJA 5B39G 4IW4C 2BIIA 4XNMB 4ELME 4D9LL 1PZUB 2R56L 5CUSH 3BPCB 2XV2A 3J27A 6FABH 2YO3A 5ACLA 3HG1E 1U8KA 4JFHD 2BNUA 1KJ2L 1XGQA 4QI3A 2BCMA 4GXUM 3H3PH 5CMAB 3X11A 4G9FA 3M1OA 1PIGA 1WCQA 1K8IA 5EIVA 5BO1H 1GOGA 3HBPA 2AQ2A 5IB4A 1CYXA 3AS2A 2GBVA 1A7RL 4FEMA 5IFAH 4IJ3B 4ZMZA 1SVZA 4JY5H 2VDPB 3QEQB 3LZFH 2FZ3B 2HVBA 3C5JB 4GXUN 2YMXL 4EN2A 3BP4B 1A1MA 3AUVA 1S2EA 3K2UL 3FB6A 3K6IA 2NY0B 1HIML 2AV1A 4B9ZA 5KTEH 1YEHL 1K8IB 4BBWA 3MLVL 4U6XB 4JFFD 2FL5B 5DJCB 3CVDA 4ODUB 3D48R 3BAIA 4ODHH 5DJ2A 4QRPB 1KIPB 3L4CA 5AZ2H 3HMWL 4MDIA 2O6PA 1PY0A 4F92B 1BQHA 1CGUA 3FF8A 1T0NB 1ZT1A 1NFKA 4AEFA 4BFNA 3T3PE 1QSVA 5F9WC 1XSKA 43CAA 2JK5B 4JPKH 4I88A 4K7PX 1A9BA 1CBVL 4OLVL 3M86A 1PZDA 3FOLA 2Q76A 4LLUB 4P5TC 4FFVD 1JPEA 2NY7L 1E9QB 3FU6A 5CEXA 3GI9L 2MKWA 3ARGD 5KJ4A 2EUWA 4C8XA 2XX1A 1LO2L 1KV3A 3CLEL 5ITFB 4MLSA 4UYQA 4PRHA 1JTOA 5A7BA 3K0YA 1KIPA 5F1IA 3N40P 3ESPA 3GJEA 4Y9BA 4QTFA 3Q2WA 3H9YA 3D6GA 5M94B 4PY8J 2GBAA 1BAFL 3V9EA 4XNQB 4YZFF 4XNXL 3VD1A 1XGZA 2FWSA 2R2EB 4KO6A 1Z9MA 4PLOB 5KYWA 1S9KC 2GBTA 4MJ2A 5HVWA 4XZUA 3DYPA 3UZQB 5FDYA 3G04B 4X9GA 4ADIA 2AGJL 1E42A 2VLMD 4X4MA 1XR8A 3QUYD 3G6JE 4G9FB 5J6HA 1SJHB 3LKRB 1LO4H 4MVBD 1THCA 4GAJL 4ZK8A 5JXAH 2ZUSA 3S34L 5BOJA 1NIBA 1MFBL 1RZIA 2EO1A 2VZSA 3EYFA 3FU0A 4BCZA 4QRQB 2B9AA 2EDEA 4KVCH 3FN0L 1KEGL 4F8TA 5MP6L 1J5IA 4OLWL 3MRIB 1SYSA 5EPMA 3NCXA 4JQXC 2R29L 4CUCA 4NM8L 1I7RB 4M7LH 4XBEL 1UT1A 2AKRA 5JXEA 2IPUG 4LB8A 5AVYB 3C60D 2MEJB 2C8NA 4N90E 4XXCA 4E9VA 3HHRB 4J3OG 1JGLL 3NDZE 2NDGA 3BE1H 3OJDA 4H44C 2JTDA 1TZOA 4OCLC 4MNGB 1U95A 1FL6A 4XWGH 5JDJA 3BKCH 4OQTA 4QR7A 3HFFA 1S7WA 2FIKA 3FOMA 2GAZA 2YUXA 4DOHE 4FKEA 2NT0A 1QBLH 1CL7H 1H6UA 1SN0A 3HRZB 2QVFB 2XA8H 1S7UA 4DCQA 1UFUA 5LXGL 2XXFA 2WHVA 1F86A 1K4DA 2C9UA 4IU2B 2ZP0T 2XZQH 3VWKC 1N4XL 5FYJD 4Y2DB 1E6OL 1D5MA 2B4CL 2B39A 2YBRA 3S34H 3S3PA 2GUOB 3CFEA 4K4KA 1YQ2A 3O6KH 4J3BA 1GW6A 2ZICA 4PJ7F 1MEXL 5IVXB 4ERSH 2C9PA 2DWSA 2FIRT 4XN1A 2XY1A 4OLZH 5L2JA 4FQHA 1NBYB 3CFKA 4FNLL 1OCRB 4HFUL 5I76A 1CJYA 1N8ZA 5I16A 2X2HA 1OIOA 2M1KA 4U4BA 5DD1H 5DVLA 4OZIB 3DX4A 4V1DB 4LSTH 5F93C 1NC2B 5JIHA 2NW3B 5HYJB 1FUNA 4TNEA 2ERJC 1XZ0A 3CN4A 5IW6A 4OKVB 5IQ7H 5E4IA 1PNCA 4CVXB 3C6EA 4LKCA 4PJBB 1XCTA 2OTWB 3MV01 4Z77A 3VFGH 1MI5B 1WWCA 4KFMA 5DJAA 2CO1A 3VYNA 1JNJA 4KHXH 3QS2A 3CV5A 4PRDA 4F58L 3GD1C 4Y16D 3IMWA 1F41A 3IJ8A 2B0SH 4PBXA 5C0RL 5BV7H 1YJDL 4P2OB 5KVFH 4H2AA 1DO6A 4PJGE 4PM1A 1C8QA 4J3WA 5DHMC 4FGMA 5CP3H 2DZEA 1GYVA 2K7PA 3KBEA 3G5XB 4ZODA 4LPVA 3PGCB 3BIBX 1RJYA 2CO4A 3T77B 3BMWA 4N9GA 4XC1H 2QQKH 4GQ9L 4X5LA 3BD3A 2DI8A 1CLYL 1M7DA 1U8OB 1WJ3A 3QORC 1R17A 2Q0ZX 1XAUA 1IO4C 1KBVA 1G9MC 3GSWA 2VR8A 3D18B 1T83A 3K8MA 1HN1A 3DO4A 3OC5A 2W95A 4QTIH 3ROLA 2XWBB 4UUJA 3SY0B 4AKOA 3KLKA 3C60A 4NFBA 1UASA 3BVNB 1TO4A 1BM7A 4DP9X 1VESA 2YAHA 4HFWB 5C0DA 4PBWD 3NABH 3ABMB 5GXBB 4NCC1 2DD8L 5E23A 4EUPG 4JY5L 5D1QA 5C92A 4HISA 2W9LA 4NUQA 4Y9GA 2FECI 2GSMB 2Q20A 1XCQB 3BIKA 4JMNA 4U1SA 3MMEA 1QYGH 2UYLA 4XNDA 3BH8A 5E4AA 1XCWA 3GB7B 5FUZL 5LAXB 1U8NB 3EJSA 4CKQA 3QJHB 4P2RA 2J73A 4PIBA 1TLMA 3HBQA 1A7PL 3LVEA 4LKXA 4NZTL 5DD1L 5E2TL 3PIQA 4GG8B 4UQ2B 3DHPA 3MACL 3OWRA 5CLTA 3RWJB 2WO4A 2WTRB 4KKQA 4YZWA 2UZXA 4Y4KA 5MEPB 3MV9B 2HYMA 4U0RB 4HIXH 2EDOA 4NERA 2J3SA 3IDIB 4WI0B 1FVCB 5T1KB 1S7RA 3RVUC 4I48B 1TNNA 1CXEA 4X0NA 4HQQL 2X6MA 4NO0D 2V7NB 4HOWA 4JN2A 3T0XA 3PGDA 4R5XA 3KCWA 4TTGA 3NJMA 4FAAB 4LOUC 3QH3B 2BSTA 2C1PB 3F7QA 2JCCB 1CXKA 3WIHA 2ZWKA 4AEHL 1QPPA 3IF1B 1QUPA 1QPXA 2P1YA 2VDKH 3O6FD 4BGDA 4GMTL 3HI5H 3BXNB 4JRWA 5ICUA 1M9SA 5IHZA 4PRIB 3TT1H 2KBGA 3ECUA 2MCMA 4AQEB 1JGEA 1KT2B 4BK8A 1FI8C 2JKRM 3N44B 3DJSA 3LAFA 5JHMA 1JVOA 2X2YA 1BGXL 4OIBA 1A3ZA 2Z0UA 1F8TL 3HB3B 2R1XA 1I9RH 4DGWC 1OHZA 2PN5A 1TQTA 3VG9C 4LO9A 4Y19A 4RAUB 3AW5A 4RX4D 4HAFA 2ADFL 3S9DB 2GHWB 4X42A 1M53A 4FQCH 1J9RA 3IU3B 4M5TA 5GQBA 2NOYA 3F65A 3IDJB 4XBGA 4G8GA 5AOLA 2XWJA 1P1ZA 4DEWA 1UZ8A 3CSBA 2DB8A 2XWTA 3LNGA 4O2EA 4P99A 4PJXB 3IJEB 5KAQF 4FI7A 1LEKB 1MZYA 1BQ5A 5CGMA 3WMPA 1RULL 2BVTA 4C55A 4MMZC 5FF6B 3FO9A 5IR1B 3VWJB 2CPUA 4UM9B 1JWSB 2R0LL 4JM2F 2J44A 3SKMA 1U8JA 2AC0A 4DO5A 1CGSH 3B5TA 1GY1A 4PCSA 2R27A 4AVIA 4IIQA 2VDQB 2Z4QA 3LH2H 1P1ZB 3D08A 5D1ZD 5HYJE 4ODXA 1OCWL 2F7PA 1J9SA 1MAJA 3WLBB 3TNNA 5BCAA 3QO0A 4UQIM 2OMWA 1W72A 1U2YA 4LSPH 5HD8C 4PWJA 3H2QA 1EJOL 1KELL 7PCYA 1RJZA 3ZO0A 4P2QE 3E6FB 4J6IA 1MCOH 1XIWA 3KS0J 3A21A 3MLRH 4JN1H 5I6XB 1RUPL 4JQVC 3MKGA 2VM4A 4K15A 3IU4H 3OKLB 4K73A 4YUEH 5C07B 4OGYH 4YHOL 4ANWA 2WZPD 3ZUNC 1C5DB 2XJLA 2CBQA 2QJDA 1XFPA 4MMXA 3L4UA 1AHWB 1AZNA 2IGFL 2PCPB 4KO7A 1SM3H 2FB4H 5ENWB 1FYHB 4XE5B 1IQWL 4WFFD 3N6YA 4ONGH 4YSUA 5TD4A 1EV2E 4XTRD 1UT2A 35C8H 2JE8A 1J87A 3TBVB 1JV5B 3GSVB 2BVPB 3FTXA 5HJBA 4BINA 1JGVL 2FBRA 4XNYH 4MZIA 4JM2D 5IB2B 5KAQG 5EO9A 3MOAH 4MYWB 3HKZA 2ZKWA 5GGRB 3BWAB 1Z5LB 2W07A 5GS0C 1JHLH 3US9A 4AXWB 3U9UA 3QIUD 2EO9A 5FFLA 1CE6A 3FN3A 5EEXA 5EWIH 2Q8BH 1H3PL 1WH0A 3R19A 3FT2A 3TBTB 3O6FA 3IK2A 5IKCB 1ZHNB 2DJSA 2R0WH 1GTFA 3LMJH 3DSFH 5LAPA 2VN4A 3ZX1A 1M05A 5T1MA 2ID5A 3O6ML 3L6FB 5JTWA 1W80A 5JR1L 5FKPA 1NUFA 4OLVH 1HTYA 2NR6A 1MAML 4RRPG 1D7CA 2B3IA 2HWZL 1D6VL 2ZUQB 4NIKB 1FGVL 3NN8B 3BWUC 5DJ6B 3T8MA 4A2FA 5IFJA 5IVZA 2FEDD 4XOCA 5LBSA 2BNQB 2Y1YA 1N18A 5C0DB 4HCGA 4N26A 3SJVE 1EMTL 2YQBA 4FQQA 5I8EA 1KGJA 5F0LB 3IE9A 1R5IA 2ZNXA 4P2QA 1IC7L 1LDSA 5HGDA 4ZUUA 3RWDA 3MBWA 2BDNH 3BT0A 3AXLB 3EFFA 2CIKA 2ESVB 2QQLH 2XKNA 3BJLA 2RR3A 5FK9B 1GRWA 4MAYC 3ZRSA 1GIGH 2AFNA 2WVTA 1E2ZA 1URZA 4N9GB 3DDGA 3EH1A 3KHQA 4ODSH 2GT9A 1C12A 5D1ZA 2ZSVA 3GLEA 5GS0H 5I73C 4UILL 3ULUF 2VLKE 2XFGB 4N1HB 4XH2B 3QUXB 3VNYA 1CLZH 1W8EA 2ATKA 3QZNA 2MHAA 2C9RA 3LZLA 1SMOA 3VXRB 2X3CA 1FDLH 4MQ7A 3TBCA 5E5RB 4J23A 3GSUA 4YGVA 3HE6D 4KZ0A 5D1XE 1DJHA 1MI5A 3TZVD 4EZMA 1XCTB 4RGNC 4YX2H 3ET9F 4HJSA 1VFAB 1FFOB 3W2DL 5KYXA 1MWAB 5C3TA 5HYSA 3CZFB 5FUZH 2FGWH 2OJZL 3JWDH 1ZVHA 3UBXB 1U3NA 1WRFA 1JERA 2DAVA 4TRPL 2OCJA 5DUML 3BGAA 4L8DB 5FYLL 4YR6A 5KVDH 2E7BA 2ALAA 4OCXH 1DN0A 1KTKE 2F19L 2FUTA 4NOBA 4YLQT 5D8JL 3ZE2B 5LG6A 3D4CA 2YN3A 1DVFD 5KSVA 2VT0A 4KKPA 1ZGLA 4ZFZB 1YC8A 3VFTA 1IEBB 3QR2A 1ZEAH 3TFKC 2YOAA 3N1QC 4JFOA 1VIWA 3ABZA 3MRHA 5JYLA 1XWVA 4HWEH 4HF5L 4DKFL 5I1GH 3ZQXA 5AYTA 1NDMA 1X5JA 4A7VA 2G9KA 2YBRB 1T6VN 2PCFA 2K6YA 3SDDB 1BXVA 3PWNB 3ZTJH 5BW7C 1YNTA 3OLDA 5AVUB 1YPZA 1F3JB 3V0FA 3L3OA 1TJIH 3EUDA 2BO0A 2YQ3A 1E3FA 1WA1X 5HXMA 4NB7A 4NZTH 2JF1A 4ZMQA 4Z7VA 5C08E 1SN2A 5HI4D 4LK4A 4XVJH 2NR6D 4XO8A 3TVMD 1IAKB 1ORQB 3GTTA 1KV7A 1G7IA 2AJSL 4UZGA 4BWTA 2PKDA 2K7QA 3NCBB 5I26A 4LEOA 2NY5L 4L05A 4NCDA 1JPGB 3VI4E 1YEFH 2BIMA 3FO1A 1MIML 4QRAA 3QXUA 1DQLL 3QEGL 4F2MB 3SPVA 3VACA 2P8MB 5E8EB 1IC4H 3ZDXF 2UY6B 5I1LB 2B7DT 5C0NC 5AALA 3OR7A 4GAGL 5IP4A 4JR9H 5IHBA 3EYSH 4KI5E 2KDGA 3BAXA 1G9ML 2OR9L 2QELA 1NFAA 4L29A 1KPVB 3RVVD 2RIKA 3SE9H 1AGFA 5EEZA 5C0AE 1CICC 4KTDL 3ZE1E 2I85A 3AACA 3OR6B 3SDDA 1RY7B 2WAHA 5I5RA 1G7LB 4Q9RL 1A4BA 1IGYA 4LRIC 4XXWA 3SBPA 3VD7A 5HY9B 4MZRA 4E41B 1MNUH 2Y1ZA 3AB0B 4GG6B 4HEME 4EIGB 4XVJL 4QRPE 3DRTB 4OI8A 4JZJB 2Y2TA 3P40A 3IDMA 3UCQA 3SKJL 4XNQA 3PS6A 1MCIA 1QI4A 5D96C 4BZ2H 2ZKHL 1BF2A 1DN0B 5E5LA 1E65A 4BFKA 3VFPA 2VE6B 3N1GC 4OGYL 4YHOH 3RLSA 1IX2A 3NFSH 4Q4IA 3CSGA