3S0PA

Copper-reconstituted tomato chloroplast superoxide dismutase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
153
structure length
124
Chain Sequence
TKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDAGGRLACGVVGLTPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
publication title Biophysical properties of Tomato Chloroplast SOD
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
total genus 27
structure length 124
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3s0pA00
2JCWA 1YAZA 1E9PA 4L05A 1ESOA 1TO5A 3CQPA 1JK9A 3H2QA 2ZOWA 3QQDB 1OALA 5KBMA 1PTZA 3KH4A 1KMGA 1SRDA 1XTLA 4A7GF 1UXMA 3KBFA 3F7KA 1AZVA 1L3NA 4OH2A 3GTTA 3ECWA 1SXCA 1XTMA 1OZTG 4A7QA 4BCYA 4U4IA 5KBLA 1YAIA 3ECVA 3KM1A 3HOGA 2Z7UA 4MCNA 3GZOA 2GBUA 2ZKWA 1E9QA 1OZUA 2C9VA 2Z7WA 3SODB 2XJKA 1PU0A 2Z7YA 1Q0EA 1B4LA 2WKOA 1E9OB 1F1GA 1SOSA 2GBVA 4FF9A 1F1AA 2AEOA 3F7LA 2C9SA 3KH3A 1F1DA 2AQSA 1JK9B 1OEZW 1SDYA 3PU7A 2WZ6A 2GBTA 1N18A 1COBA 1EQWA 4N3TA 1YSOA 2WZ5A 3KBEA 3LTVA 2AQPA 1P1VA 1SXNA 2V0AA 1TO4A 1U3NA 1Z9PA 2Q2LA 2XJLA 2WYTA 2Z7ZA 3H2PA 1SXSA 1HL4A 1HL5A 3MKGA 1PZSA 2VR8A 2AQQA 2K4WA 3K91A 2APSA 2E47A 3S0PA 1S4IA 1Z9NA 1BZOA 3GZQA 1RK7A 2WWNA 4OJAA 2LU5A 1UXLA 3HFFA 1SPDA 3KM2A 1MFMA 4BCZA 3RE0A 1DSWA 3CQQA 1E9QB 2E46A 2VR7A 4BD4A 4MCMA 1E9PB 1B4TA 1SXAA 4B3EA 2C9UA 4A7GA 2AF2A 3T5WA 4A7TA 1CBJA 3QQDA 1BA9A 1E9OA 1IBFA 3L9EA 3CE1A 2VR6A 5KBKA 2WKOF 3L9YA 1N19A 2WYZA 2R27A 3GZPA 5CU9A 4A7UA 1SDAB 4N3UA 1IBDA 1OAJA 1XSOA 1IBBA 1IBHA 2AQNA 1SXBA 1QUPA 4A7SA 1CB4A 1IB5A 1F18A 1JCVA 3MNDA 2NNXA 2AQRA 2JLPA 2WZ0A 4A7VA 2ZKYA 3ECUA 2ZKXA 2SODB 3GQFA 3HW7A 1FUNA 1EJ8A 2WWOA 2AQTA 3GTVA 1DO5A 1SXZA
chains in the Genus database with same CATH superfamily
2V9TA 4FMFA 4LOEA 1EZLA 3PY9A 5FYJL 5JDJA 2VRKA 2VZTA 4MB5A 2QPEB 4HX1B 3RTQD 1NL0H 4UTAA 4E9QA 1O6SA 3Q6FB 1JF5A 1IC4H 1MEXL 1OXYA 5HVHC 1M42A 5HXMA 1CGSH 4H1LH 3T4AA 1CURA 1E2ZA 5B1KA 2OM5A 1AGDB 4LCWD 5LDSA 2KHAA 4GUPB 3ZU8A 1S7XA 2XZQH 3I75B 1INDL 4RETB 4MZRA 4H25B 4D9QE 4TUKL 3IJ8A 2MQCA 5JHDA 3VWKD 1KDIA 2QPUA 5IQ7H 1OM3H 4MA1C 3K4AA 1S78C 2HLAB 4K3DL 5E8EB 1NMAH 2Q7NA 3BAKA 4X4XA 3FUKA 3GI9L 3APFA 5E8NA 1A3LH 5FB8B 3PDOA 4JANB 5JPMA 4TVSa 2NY5L 4OLYL 1URIA 3EO9L 5E5RB 2O61B 4AW4A 3DV4B 1TQCB 2WTRA 3KYNB 3OAZK 3KPLA 3PJSA 4EVNA 5ICYB 1G9ML 2ZCKH 1U3NA 3TH4T 1QHOA 4L1HA 2HLFD 5JIPA 1HX0A 4WV1C 1BVLB 4EBQH 1OCCB 4IU2A 1BFOA 3DA0A 3DARA 4H20L 2XOTA 1YNTB 4MNQD 4AL8L 3FTUA 1OAYH 3SYQA 1I3GH 4HKXA 5I19L 4KVNL 5LAPA 3DWTA 4MBOA 5DUBB 3IMWA 4Y4HD 3HA0A 5A2JH 1UURA 3PQYA 2GSIA 1WAPA 4X5RA 4R90H 3GK8L 1X5YA 1CBJA 3CHSA 1L9PA 2XTJC 2YD9A 1RZPA 3S5ZA 4ZUUA 5E4AA 4F1ZA 4MXWL 4NP4L 2R29L 3FW6A 3GZPA 1K5NA 3MR9B 2YPKB 3GMMA 2KL6A 3QDJB 4XPFH 3ZDXE 3C6LD 1LP9E 2XWXA 3AG4B 4ZUVB 1AZNA 2C3XA 1PY9A 4UU9A 1QUPA 4ZMAT 4Q6IB 3L16A 4KXAA 5DQJA 4F7TB 2F7QA 1L5GA 5F97E 4H88L 5GJSH 2YD2A 4RCAA 3N3EA 1LM8V 5ALBH 4FQPA 3H3PH 3S36L 3U79A 2IV9A 3D85B 2DMGA 4WHTB 4FZEH 3OKYA 5D1XB 2BNRB 5I73B 5ICZA 1T2XA 4BH7B 4W6WB 2LLGA 3UBXI 4EO5A 3HBPA 3H2QA 4K2UH 4GAAA 5TK4A 4E9LA 1BZ8A 1MWAL 2JH2A 4PPTA 2ZZUT 3VYNA 2A4CA 3LXBA 1WFJA 1OD7A 5I1AB 3EG9A 4NNXB 5GGTL 3CFKB 1GAFH 1IGFL 2RAMA 3FSVA 4JB9L 1SUJA 1ZEAH 1NJ9A 5HP5A 1M71A 1CJYA 4PWFA 4IOIB 4UDUA 5I28A 2GUYA 1A6VH 4HMDA 1OARL 2OI9C 4K3HA 1BEYH 1W0YT 1LDPH 4MMZC 4NFDA 4HKJB 4RNRB 1K2DA 4OTXH 4FQJH 5HBBA 5IVOA 2DQEL 4PJGA 1BXXA 1UKTA 3L48A 3B5HA 1KC5H 1LD9B 4TYUA 3ZHDA 1T4KA 1K4CB 4YBQD 5FW7A 4G80A 4YDKL 5I30H 5K9OA 5DUPL 1F86A 1WHPA 2XWBB 2J6EH 3R19A 5D7IA 5GGRA 5JZ7D 2ZUUA 4YE0A 2FLMA 1UACH 4WF7A 2P80D 1UUSA 5D9SA 4DVRH 2A73B 2B08A 4RAVA 5IMMB 4UV4H 5IOPA 5KBDA 4DKFL 5LCVH 1R3JA 3TASA 3X17A 2DEWX 3NG5A 5FYKL 3UJTH 1RVFL 5DZ9A 3WNMA 3D0VB 2Z31C 1OB1A 4EEEA 4LEXH 1ZE3H 2DBLL 4RH4A 3ULVH 3GLAA 4KK8D 4HV8A 5T1LD 2DF3A 4QRSA 4WHDA 4FG6D 3MCLL 1PS3A 4WFGD 4OIFA 3BPNB 2DWSA 1LILA 4ERSH 5LNGA 1HCYA 3P11H 4HFUH 5L2KE 2YMTA 1ZGLB 1BQKA 4GXUM 2CRZA 2D7NA 3NEEA 3D39B 4JO5A 3ZKMC 3IF1B 3MRNA 4DGUA 2NY0D 3ZW3A 1N7MH 1RU9H 5B39G 3K6DA 5KVGH 3DV6B 2Q86A 2FJHA 2V17H 2FGWH 3IJYA 4X0KB 4ELMF 5DHVB 3K6OA 1LE5A 1IC5H 3KYOB 1QRNA 4MAZA 2NW3B 1TZGH 1ZA6B 4TUUA 5BZDB 4XN7A 2APFA 3U1SL 4N85A 1ZLDA 3QZLA 1VCBC 5C0IB 2WBJA 3MNDA 5D5ME 3QA3B 3CDYA 3WNKA 4DN3H 1A3RH 5F9WB 1NGZA 3C5JB 4PJAF 2BSED 2ITCA 3VJ6B 4RGNC 2BVQA 1IC7H 1TDQA 3NIDF 2NNFA 1MVUB 3DBXB 5HVGB 1S78D 4GQRA 4O2EB 2ZF8A 3K2UL 4ODTL 1ZT1B 2YEVB 4LLAA 4PSRA 1EXHA 4AH2B 5IW6B 5D2NE 4J3OH 2Y4SA 3C5XA 1SVZA 4U7SA 3X13A 3H0TA 4HK0A 3ZMEA 3KLKA 5K33A 3DX0A 1EFXD 5J12C 5BVPL 4KBPA 4C4UA 1PZDA 3L95B 1GHFH 1M05B 1WZKA 4LIQH 4MMXA 4RIRB 3GBML 3W5NA 5EDXA 4PBWD 1UENA 4NRXB 3T0DA 1S9VA 4Y16C 3V4UL 4JDVA 4R0LC 4LXFA 2DPKA 3LIZA 4KJYB 3ZTDC 2MOGA 5D70L 1MFVA 5D1QE 3CFCH 4MJIB 4ZYKB 1V55B 3W37A 1SF5A 1GIGL 3GKWH 1UWEL 5HJ3A 3H6AA 3C08L 4ZJ9A 1RUPL 5LNDA 3QUYA 1YJDC 1AIZA 4OLXH 2HSIA 3CAFA 4PR5A 3K81A 5PCYA 2OYLA 1R3LA 4AC2A 5C9KA 4JO3H 2R0WL 3ZDZB 3ULUH 2XTJD 4RISL 2KI6A 5MEQB 3HS9A 4X4ZA 1O6SB 4JFXA 2IH8A 4FXKC 4OJFH 1UD3A 3MHZA 1NGWB 4YVUA 3T4AB 2X6VA 1PLGL 1L6PA 3GIZH 2B2XL 5B1CA 3S96A 4K55A 1WDAA 1S7XB 4FXGC 4OLZH 3O6LH 1J12A 4I88A 2VN6A 1CR9H 5KANG 5A2KH 2AXFB 3IFPA 5JHDB 1KY7A 4N90D 1UZ6F 3TBTB 3BGAA 1CIUA 4AM0Q 2ZAHA 4JDZA 4PBVC 1SJMA 4F9PA 5HYJE 3ILQC 2CDGA 5SV4A 2CIIA 4X4XB 1FL6A 4Z7WE 2R69H 4JN1H 5C0EB 3PDOB 5GXBB 5JPMB 1YO4A 4HWEL 4LSSL 5AB2A 4Q4EA 3ZMNA 4CC1A 3I6LE 3QQ3A 2WTRB 4PGEB 3PJSB 3KPLB 4IRZA 4CSZA 3MPCA 2G5RA 3OKKB 4BWTA 5JIIA 3MU3A 2YD3A 5KJ4A 4IU2B 3W0WE 4QJ3B 1CDUA 1BFOB 2XG5A 1QWHA 4G7YL 4LASH 1JRHI 4LSVH 1GYVA 3CZNA 2WZPA 3ZZQA 4HKXB 4LHUD 2G0LA 4D3CH 2EIBA 3HEIB 4F57L 5LWYL 1H3UA 3MMEB 3PQYB 1JUFA 2GSIB 3GMOA 5CJQH 3ZE1E 2GIMA 3PAZA 2AJ3A 5IHUL 5EA0H 4P59H 5JTWA 3DTUB 1DN2A 4JZJC 2G9HB 1ONQA 4CN4A 1NC2B 2JJVA 2ROXA 3FT2B 1K5NB 1EA9C 3PHQB 2ZYIA 1RIVH 3ZK0A 4M62H 3NDZE 5CFHA 2PCYA 2UY7A 1ITBB 1E6OH 4X6CA 3PPSA 1N3NA 1ND0A 1VERA 1ZV5A 1JTPA 2ZOTA 3P3SA 3ZIMA 3QDMA 1L5GB 2Z31D 1I8UA 3OAUL 4NHUA 2E27L 1RZ8A 3CNKA 4UNIA 2YFNA 4TL4A 4XE0A 4ORGB 4F37F 3QCUL 3LPFA 2X53A 1GGBH 1A0QL 1RL1A 2WVUA 3LD8C 3RFZA 2F19H 1AC0A 1M9WA 3LNEA 4AMKL 2B5IB 5K39A 5ICZB 2UUDH 4KXDA 4WNJA 1R24A 1A8ZA 3BVWA 4PRHB 1SEQH 1K8IA 5JR1H 1C5BL 3D18A 3ZKMD 3CSTA 4DFHA 3EZJB 1M6UA 3FQWB 1E3ZA 1P53A 4WCYH 5I2IA 1TZOA 2Q2LA 3M46A 3EG9B 5DR5H 2AANA 2P8LA 2DQIL 4DNLA 5D71L 5LN4A 4RFNB 4WNQB 1NJ9B 1FRGH 4P5SA 2VJ8A 4XMXA 4UDUB 1UWGL 4BZ1L 3QARA 5ANMB 2FT6A 4N68A 4E36A 1HHGA 2X2IA 2L7JA 2J88H 1WWCA 2WXJA 5H35A 3L5XH 4GXUN 5TDNA 4A55A 5ALCL 5FK9B 4MCZA 1OTUC 4JM4H 4W9CC 3U2SB 4RGND 2OR7A 2DLIA 3GM0A 4Y19D 5K9OB 3ZDXF 4FQ1L 1LP9F 5GSRA 1F56A 5D7IB 5GGRB 3F2LA 5D9SB 3VH8A 3WNPA 4WZ9A 1B9ZA 4RAVB 5HYIA 5IOPB 2X4QA 3OF6A 3RIKA 1R3JB 3ILEA 5DJXA 3GGWA 1OB1B 4Z7UF 1JVKA 5F1IA 4B9CA 5EEYA 2UZXA 2V9UA 3VSTA 3QDJE 2MCPH 2IH3B 4Y16D 4HV8B 5KVFL 2FHFA 1XF3B 4HZLA 3HUJA 1GYAA 3BWSA 5F3BA 1Q0YL 1WA1X 5ADOL 3ARDB 5GISH 1GJUA 3DI2B 1OK0A 3ZDYB 3L3HA 1ULVA 3TJEL 5JW4Q 3ARGC 2DLEA 1X6LA 3MRNB 1TO5A 4KI1A 2TRHA 2V4LA 2ZOWA 4PRPD 4UUJA 4X9GA 2XLLA 3EF4A 1UYWH 3MV7A 3JTTA 2Q86B 2FJHB 3IE4A 4AUYA 4QRPA 2VMCA 4DK5A 2O30A 2A38A 2CKBL 3IJYB 2HX8A 4PH8A 4TSAL 1LE5B 1JN6B 1QRNB 3O8XC 1AS6A 1PZBA 3ARYA 2D7TL 5C0DA 3H9SD 1ZLSL 2JV6A 2XX0A 4UT9A 1AHWA 3HLKA 5HYQB 2I60L 4XPBL 1X9RA 3WXVL 4U1MB 3ULVC 1U8HA 2LABA 2BSBA 4HGWA 4HUXB 2ITCB 5I1KL 1G6VK 1B4JL 2BVQB 1E2WA 4W9LC 5A3ID 4ZXBA 1FAIL 5KUKA 2GEEA 5EEXA 4M1DH 3ILQD 1G84A 2F5AL 3QEGL 3NSDA 3DHPA 1U3ZA 1RURL 1KIPA 3EOTL 3K6NA 3X13B 1LO2L 4Y4KC 3H0TB 4HK0B 4JAMA 4G6JH 4QPEA 4XO3A 3QIWC 5D2LF 4BE6A 2V5YA 4HALA 5F7DB 1I1YA 2Y72A 4XP6L 4G8GB 2BVYA 4MMXB 1JYXA 3WUWG 1HL4A 1ZPUA 3U82B 5JOEA 2PMZA 5I5IA 1S9VB 1NA8A 2ATAA 3ABMB 1EEQA 4M56A 3KS0H 3IDXH 4R97C 4UB0H 4XAWL 2NY2B 1U8MA 1K9TA 1TCRA 2O4EA 3KHOA 4HDIA 4HMEA 4JDVB 2VC2L 1AXTH 1FDLL 1WICA 1X3DA 4TNVK 1MFDH 5FCSH 4OGZA 2VR7A 4AVKA 4FFZA 1XGPB 2HJLA 4F20A 3LH9A 2F5BH 4ZI8A 5HJ3B 2OYKA 1AE6L 3QZBA 3QUYB 1HESA 2WXPA 3P3UA 4E5XB 3L3OC 4PR5B 3FT3B 1R3LB 2RH0A 5T1KA 4J3OC 2VERA 2L7UA 4ZW8A 3RPKA 6PCYA 3C2SA 3D39E 1L7TL 3FYEB 4P5MA 1KBPA 4OCWH 4LHJB 5D5MF 3GDBA 3RGBA 4HIQA 1AC6A 1WRFA 4M6ML 3S3SA 3P9MA 1MFBL 4HJEA 3S96B 3FT1A 4B9FA 4JFFE 2DWYA 4IOSD 1VFBA 1EHLH 1QPXA 2HT3C 4HPYH 4OR1A 4QRRD 5BJTA 3GS4A 1BHGA 3IFPB 1BD2A 3U36A 3U2JA 4JDZB 2KKQA 5E2UL 4PRAA 1J0HA 2F1AA 1MKFA 3DIFA 1EDHA 5L8KB 3F62A 3VXOA 5F7EL 2CIIB 4Y9FA 1E65A 4D7PA 1FL6B 3MBXH 1J05A 2I32A 4N22A 3MGOA 3QZOA 1NM4A 1X44A 1Z32X 3ATBA 3DYOA 2V7HA 3HG0A 3ARPA 3VSUA 3WY3A 4YDZA 4OI9A 4G5ZH 4YK4C 1ID2A 5I1HH 4MBRA 3ZL4H 3ULUC 3QQ3B 3SD2A 3B5GA 3DGCR 4S1SH 3KZ8A 3JWOH 1UH3A 1MCPL 3L17A 1LWHA 3UYPA 3CN4A 3ZKXB 1CVRA 3TTSA 4ZMLA 1EH9A 3WL9A 3GXFA 3QFJA 2D9CA 4QAMB 1S9WA 2V2XA 2XG5B 5FYJU 3V79C 4DGIH 1QTPA 3RJQB 5TE6L 4PHZA 3MLYL 1JXFA 3CFQA 3M6DA 5DVOA 4N8VG 4JPKL 4HXBH 2HLEB 2VM4A 4NX0A 2XQ0A 3GMOB 2C26A 2FL5B 2BSSA 2AJ3B 1BFVL 4C4KO 1OTUD 2OMWA 1M6OA 2YEZA 4IKLA 4M6AA 5AB9A 3JWDC 2C7FA 4N2HA 4PUBH 2DH3A 1MCFA 4LDCA 1EHXA 3ZT5A 5K93A 3KPMA 2KZBA 5DJDA 5IFAH 3L7EA 1SHSA 5IF0A 1W0WA 2UY7B 4GRLA 5DMIL 3TP4A 2G60L 3ZDZE 1ZD6A 5HGDA 3GZQA 4X6CB 4V33A 4Y8DC 1ND0B 2DN7A 4FLHA 4YDNA 1PEWA 3QDMB 1XXDC 2XV2A 4RDQG 1W6LA 4QHKI 4NHUB 1RZ8B 4TULH 1XEUA 5C0BD 3I74A 3T0EA 1FZOB 3OPZL 5IT2H 1TEYA 3IJHA 4Z7WF 1SXAA 3WE6A 1QNIA 5GS3A 4KTDH 4DGVL 3D2UB 4R4BA 5K39B 3GSNL 3HZVA 1HE7A 1R24B 3FB8A 1TF4A 3CIAA 5EO1A 3INUH 4XMLH 5JHDE 1K8IB 1KGIA 2G4GA 3S2CA 1FL3A 3BAEH 4PI0A 5KBKA 3SDCA 3ARGD 3D18B 5E4IA 2EKJA 2W0KA 1Q0XL 1G5AA 2OR8A 5B8CC 5I17A 2NUPA 4OD1L 1E8XA 3I6KA 5ID0A 5I2IB 3PP3K 1ADQH 4QHUA 7FABL 2FUTA 2P8LB 3BH9A 4P5KB 4G9FD 2KZ1B 1T4WA 4KPHL 5GRYA 3MOAH 1YA5A 4JO2H 5AEAA 2Q1EA 3O8XD 4JG0L 5KW9H 1YN7A 4MDIB 5F7AA 3L3KB 5KSAA 4LVHC 3MACL 5T8IA 1IQDB 1HHGB 3G9AB 1WIPA 4N0UA 3ZE1F 3IGLA 3CSPA 3TO4B 3ULVD 3E2HB 5BW7A 4NWUL 1KCUL 5TDNB 3LH2H 1R5IA 4JQXC 4KXZH 4AIZB 1E5BA 5B21A 1DQDH 2Q10A 3DX1A 3I3BA 2AKRB 2ZWZA 3ISYA 2BP8A 5B39A 2B4CC 5J6SA 4DPAX 2QQLH 4I18A 2B77A 1OZTG 3QULA 1BMGA 3MDJA 1JHTA 3PQYE 4LRIC 3VH8B 3ZHNA 3QBTB 4Y4KD 1RLBA 2HB0A 3QIWD 4TS6A 2XWEA 1A7RH 1O7SA 4U1NA 5DHDA 5E4EB 3JTSB 3FF8A 5DJXB 3UAJC 4YLCA 2A6IA 2F54B 3MXVH 5F1IB 2UZXB 4LGPB 3HNVL 4HZLB 3B4NA 2F8VA 1U41A 1F02I 5DWUH 3HUJB 3TJPA 2VN5A 4Q8BA 5C7XH 2EVHA 2Z0UA 2J57A 3C6LA 2FTAA 5F3BB 3VFWA 4N2KA 4ZMNA 4P23C 2BFGA 3BH8A 3DTDA 5CCKL 1Q1JH 3QHFL 3L3HB 4HJIA 4M7ZC 4YDIH 2WD0A 1FG2B 2IPUG 1NUDA 4N5EC 4UUJB 2EDQA 1CDGA 1IGYA 4OQ1A 5CLXA 3JTTB 3H6JA 1NBQA 3KCWA 3RY4A 4XNAA 3C5ZC 4P4KA 4J3OD 1CD8A 2F74A 5B38G 4FABL 1NIFA 3J27A 3U9WA 3EBHA 4OZIA 5C0DB 5J56B 2CBMA 2LGNA 1HJBC 2OULB 5CEXA 3NRPA 3HAEH 4JO1H 5BV7H 2ICWA 4IBZA 4U6XA 1AHWB 1OTTC 1IGCH 4TQ8A 4F8TA 4PB9H 5E1GA 1U8HB 3T65A 4WGKA 1MHEB 1WLHA 1YNTF 5AW8B 5F7UA 3WI9A 4P49A 2HT3D 2C9UA 4QI3A 1H3PL 5CN1A 3CPLA 4L4TD 4A7TA 5J6GA 5GRWA 3DDGA 4PJIA 4ZXBB 3VG9C 3EYFB 5FYKU 2NCEA 2OYPA 3JSSA 1F3DJ 1KIPB 1GPOH 3CZEA 4PJGE 1HNFA 1ZCRA 4JAMB 3LXCA 2CBPA 3RZCC 1T1YA 3V95A 1I1YB 1YMMB 5TQ0L 3HHSA 3HKZA 1J9CT 2NY1B 3ULUD 1UM6H 1CI3M 5D7IE 1XGTA 5FAAA 1WZAA 5JIDA 2D4FA 1U8MB 2L0DA 4HDIB 3CFEA 5DT1L 2ZP8A 5E8OB 5J7CC 2B14A 1Z9LA 4ZODA 3SDYH 2ENJA 4PHXA 2CJTA 2HJLB 3VI3E 4M7JH 2PW1A 2OK0H 3C75A 3PWJB 2P8PA 2R56L 2OP4L 5E2VH 1BMWA 2NY7L 1UWXK 4YX2H 1Z66A 1JVLA 1QKZH 1QLRA 5T1LA 5T1KB 1H8OA 1VEPA 5F21B 1T7VA 2Y1YA 4JY5L 1CL7I 2IMNA 1UH2A 3F01A 4JKPH 4UQIM 2B7DT 2ETWA 3IBOA 2MPAH 3BVVA 2UY6A 4FFYH 3WXWL 4L0ZA 3D87B 3BFOA 3P9MB 4MCNA 2XN9D 3V6OC 5CFAA 1IGTA 3UL4A 2OFQA 4KUCD 3O0RL 1HAWA 1QRNE 1VFBB 2HH0L 5F0PB 3RRQA 3N85H 5BJTB 5DD3H 1BD2B 4YSDA 1XH3A 1RZGB 4TVPH 2WK2A 5DHMC 5A1AA 4PRAB 3BX7C 2IDTA 4JRXA 4LK4A 3VXOB 4BWWA 1L0XA 4QXTB 3DUSA 4GUQA 2XHNA 1J05B 5AW1B 1NMCC 5F88A 4RFEA 3MGOB 4FLRA 2AQ2A 2V7HB 2IWFA 5D7LD 4XXWC 4Y7MA 1YVLA 2FQGA 1BAFH 2OX5B 3ALXA 4L8SC 3RX7A 2BSEA 4HUCA 4LLMB 2FX8H 2F53D 4G6MH 2CK0L 4QTHA 1BMZA 3WL9B 2OMTA 3QFJB 1VA9A 2YLHA 4BK4A 3VI4A 1G7JB 4ADJA 3VB9A 2DQJL 1S9WB 3WGUB 3EADA 2KERA 5E8DL 4JCLA 3UIYA 2QTEA 1WFOA 1ZSHA 4TPRH 4LCYA 1G9NH 2NX5D 2I24N 3LQMA 4NIKB 5FKPA 4OGYH 3FO9A 4AY0A 2BSSB 1UA3A 4FKKA 1M6OB 2YEZB 5C0FB 4E9TA 2LOEA 4E9XA 2CAKA 2I5YL 1TJMA 2GSMB 3DX7A 4ODWA 5KYYA 1QAWA 5DMGC 3Q8EA 3KPMB 3ZSTA 3TCLA 5DJDB 1V10A 1FGVL 3L7EB 1MHPL 4KKAC 1W0WB 2B3IA 5IF0B 4GRLB 3JWOC 4NQVA 1MCWM 4PP2A 3Q1EA 4X5PA 2VDOH 3BKJL 2A0LC 3U4AA 1MEXH 4NKIL 3UAJD 3JV6A 3TURA 4TLSA 5JOPD 3KMDA 1OD9A 3TCTA 2QEJA 4JUTA 2VXSL 3NJFA 3WE6B 5E9AA 3QWRA 4YWGL 4R4BB 3VFNA 4DH2A 2Y06L 4TUKH 4OSUL 4LCWB 3HZVB 5IJKC 3B2VL 4XODA 3FB8B 1QTYT 1OHQA 4JKMA 4P23D 1RZIA 3MRFA 5D1ZA 1FL3B 3WIHL 3SDCB 4X7TA 4KFMA 4A2EA 4N5ED 3ABLB 3ARXA 1CI5A 5I17B 2JELL 2NUPB 4LPTA 4I0PA 3GI9H 5ID0B 3I2CL 1EEYB 4NUQA 4WFHE 5HJDA 4QHUB 1HZHH 1GZPA 1D5BB 3BRGC 4YHIA 2NY5H 3C5ZD 4J6IA 4OLYH 3EDKA 1I4FA 3EO9H 2EIDA 2IDQA 4ODHL 4YFLI 1S7RA 1JD9A 2JJTC 1N9PA 3GMQA 3FCTA 1G9MH 1YN7B 2E7MA 2QT6A 5KSAB 4PJDA 1MW2A 3F6JA 5C08D 4N0UB 1OTTD 2GHZA 1SOSA 1YEKH 4NWTL 3VFUA 4AJ0A 1GS8A 5E6IC 1O75A 4H20H 5KVMC 4AL8H 3AC0A 3GSXB 3KEHA 4HUMB 4JQIA 4OF8A 4BM7A 3KBPA 2HCZX 2OMNA 4AYID 5A7BA 5I19H 3B9DA 3V0DA 4KVNH 4WW1B 2Y0SA 4MNQB 2BP8B 1FZKA 2C1PB 2ENYA 5B39B 2MQGA 1Z9PA 3QULB 3LDBC 4I18B 4NQTA 5AW7B 3ZDZF 1JHTB 1NQBA 1IGML 1Y07A 3QNFA 4JCMA 2D7OA 3HHMA 4BQCA 4BZ2A 4IBQA 1NCGA 3K91A 3TEUA 2DYPA 1V8HA 1OAQL 3RZCD 2HKHL 1EHKB 1WAAA 3OKEA 5D72L 1JNJA 4MXWH 4NP4H 2A6IB 2R29H 3EYUL 1ZV9A 3IEAA 4DEUA 4E9VA 1CT8A 2DDQL 4LLVA 2WCSA 5L4JA 4OFDA 1NPUA 1BVNT 4JQVA 2K4AA 4M48L 3L5JA 1ANUA 1U8QA 3PV7A 4PWEA 4UNVA 4X6CE 3C6LB 4X80L 3RX9A 3VFWB 3ZQWA 5AVYB 3BH8B 3QDME 2PUQT 1YNKL 3ATDA 2J1KA 2VR6A 1Q9LA 2CLVB 2EXWC 2NNCA 3JWNE 3QEQD 3S36H 8CGTA 1IGYB 3VU2A 4QEGA 1WTGT 2ADFL 5D6CA 3NZSA 1B88A 3CBJB 4HYTB 3QZWA 4P4KB 4ZAKA 4U1JB 1KDJA 2DWTA 3TF7C 1RJLA 2F74B 4JZNA 5I18H 4GPVA 2LFEA 1MHCA 1MWAH 3WUWA 4AWJC 3RDJA 4NM8L 1SJXA 5CEXB 2QDWA 1JD7A 2ICWB 3BAIA 1VIWA 2VJ0A 1E4KC 1IGFH 5T5NG 4JB9H 3QIUA 2B9AA 3UAEA 3CPLB 4Z76A 1OK8A 4KKBC 5J6GB 1HXKA 1OY3B 1I1AC 1OARH 4PJIB 3EF7A 3LZNA 4ZX5A 5BUGA 1NDMA 3G5XA 5E99L 2FB4L 4X8GA 5ISZA 2DQEH 3VXRD 2WIIB 3HR5A 1JNLL 1G6RA 3U9UA 4N8CH 5A6IA 2CBTA 3E9TA 2VM3A 1T1YB 3VSQA 5ESAA 3HHSB 2GFBA 1P5UC 4ZFFA 5HY9A 5JXAL 2B59A 1J1PL 4MQ7A 1Q8MA 3S8GB 4HKZA 2ICWJ 1PCSA 4LSUL 4DKFH 3C87A 4G7QB 35C8L 4F5CA 5BV7C 5H4YA 5FYKH 3CFEB 4OBSA 1T7YA 4P04A 4DP6X 3VFTA 3X1BA 1QFPA 1A9VA 5G55A 4OZ4A 3ESUF 1MCNA 2IG2H 2DBLH 4OLVL 4OCYH 2Y3NA 1CL7L 2YSSA 5FDYA 4M93C 2PW1B 2V2TA 1IGJA 4KDTC 2P8PB 1BG1A 4I48B 3QJOA 5J57B 3HUJE 4UTCA 5CHNB 3AQYA 1QLRB 5T1LB 4YLBA 2AJSL 4F58L 1F11A 2XJLA 1K4DA 1LNUB 3NJJA 2UY6B 3MV7E 4L5FE 5DMGD 2FO1A 1FCGA 3KPNA 4H0GA 4QRPE 1PG7W 3IJ9A 5I1LA 1IGTB 1TTCA 4KKAD 3LEXA 4YHKH 2XPYA 3GD1C 4X7SL 4EIZC 4X6BA 1RULL 4G8AC 4O02L 2A0LD 3MCKA 3WNOA 1ACXA 1XH3B 3U1SH 3W39A 1AYRA 3T5WA 3L3JA 4JFOA 4RAUA 3OL2A 1BBDL 4N8VA 1DQJA 4UV7H 5GS1A 2GJZA 4JRXB 1JWUB 3P4LA 2IVFC 3DUSB 3BT2L 3CC5A 4U1KA 4Q4IA 5F88B 4RFEB 4XVTL 4HS3A 4GFXA 4F92B 3BP5A 3T3PE 3A6BL 4CSSA 1XGUA 3K2UH 4ODTH 5D7IF 3ZGHA 3FHQA 3GSWA 4JG9A 4MA1B 5IUSA 1U6AL 4EF3A 3MLRH 1V5JA 5KS9B 2ZXGA 4N9GA 2VUYA 4IMLA 3PXHA 5T1DL 2WB7A 3US0A 5CO1A 3VI4B 4IOFC 3GBMH 4FNSA 3NUKA 4DP8X 3EAKA 4KQ3L 4C55A 4CBZA 4DFIA 1EFXB 5J5EA 3O6FC 3K8KA 4GKNB 4LCYB 2VSMB 2Z92A 2AEQH 2D03L 4MA7L 3JVGA 4PI2A 3SBWA 2JKNA 4L4VD 5E6ID 4LVEA 1MPAL 2O6DA 2NQ3A 1TTGA 4N2MA 4X9HA 5D70H 1UD2A 4DTGL 4G1EB 1AZVA 1KGXA 4W4NA 1JCKA 3GTTA 1GIGH 4J3BA 1UWEH 5HGHA 3SDXB 5MENA 1KCBA 1CDIA 4JL1A 1RUPH 3DX7B 2CO7A 4JHWL 1LXMA 1KYOJ 2NZ1A 2NYYC 1TTAA 1HIML 1GSKA 2CNZA 2R0WH 3ECQA 3DXAA 4LQFH 3ORJA 4NQVB 3APDA 4OZGA 4PP2B 4RISH 4Z3EA 1QFOA 3VQ1C 2AK1L 1THAA 2BO0A 5EU6D 3VCLA 1BVNP 4LSQH 1PLGH 1YNLH 2B2XH 2ENPA 1QW9A 1FVDA 4BINA 2QFRA 2QPDB 4KI5E 1MW3A 1T66C 1BFTA 4S10A 4O5LL 3VFNB 4MHHI 2E4FA 1RZIB 3ZL2A 1IEAA 2H1PH 2W9EL 4ZNEA 4HZ1A 1OSZA 5BUAA 4X7TB 3SGDI 3F5WA 4ZFOL 1LO4L 2EXWD 1IU1A 1XCQA 2YPVA 3K4ZA 1PLCA 4I0PB 1WCBB 1YYML 3V0IA 1I85C 4YHIB 3BEVB 3QPQC 2YGQA 4FQIH 4HWEH 4LSSH 2VGLM 4MXQC 3QCVL 1S7RB 1KB5B 1SGKA 3GMNA 2PO6A 1E6JL 1FC2D 3CDGA 3G6JA 3GMQB 3FCTB 1JNHA 4LGRB 4P46A 4RA3A 4XPTL 4B9PA 4HQQL 4GT0A 5AW6B 1N8ZB 4I4WA 4PJDB 1SMAA 4PJBA 2H1LM 2AF2A 3HRZC 3VFUB 3QFJE 3V6FB 4WSJA 3EFOA 5LHDA 1FHGA 4GBXA 4G7YH 5IQOA 2WN2A 4P2QA 3ERXA 3Q8CA 4KKBD 3SKUD 1CUOA 2ZX8A 1I1AD 1SLXA 3R06A 2ZCHL 4ORZC 3DVIA 3QR0A 2J12B 4F57H 1H9DA 3M45A 3PWPD 5J9PB 4OCRL 5LWYH 1SN5A 2YUVA 1CICC 1IBHA 1BREA 4FA8A 1RZJH 3C09C 1PZ2A 3BESR 5JW3L 3VFOB 5IB2B 1BXVA 2OI9B 2NXZB 3B2MA 2IOMA 5D4QA 5LQBL 2NTFA 4TNEA 4MMZB 4FFWC 2P1YA 4UZGA 4WWKA 5B38A 2NY5C 5DVLA 4MQSB 3RIAK 5DJYA 3OMNB 4M3JA 5FUZL 5SWSA 3FTXA 3N6YA 1CXLA 4X6EA 2JB6A 3QYCA 1W80A 1G9MC 5GRZA 1J0IA 5AYTA 2D3NA 3V4LA 2GUOA 1U8QB 3CFJA 4HBCL 1I9JL 3EGXB 3UJIL 2XKNB 3CQPA 3LPOA 3AT9A 3LH8A 3OAUH 2P24B 2E27H 3AB0C 3I50L 3QCUH 5I6OA 3P54A 4AL8C 5A2BA 1Q9LB 3T0EE 1A0QH 3SBPA 3OWEA 4AMKH 3QRFM 1DBKL 4G6FD 2BHFA 1UKQA 2X87A 2AHIA 1PIFA 5JNYA 5D6CB 1QUNA 1YAIA 1I3RB 3QZWB 4ZAKB 3KM1A 1RJLB 5DK3A 4A2GA 3DX6B 3ZHLA 3TNNB 3BO8A 3ROLA 3WUWB 1MHCB 4M6OL 5EPMB 3HE7A 4OUUA 4DO5A 3AWEA 5HHME 1NUFA 2BVPA 3AQZA 4GRWH 2DQIH 4M9PA 3TWYA 5D71H 3UC2A 1UHVA 3QIUB 4PCTA 3GHPA 3GXTA 3A5VA 5DZOA 3LMJL 1HH9A 4BZ1H 4G9FA 3GXDA 1Z5YD 3T2QA 1LE9A 3K1DA 1N18A 5D93C 1KJMB 2RALA 3IRZA 5LCVA 3EUDA 1NDMB 3G5XB 3O8XA 4N0UE 4YE4L 4JE4B 3V5KA 4LCVA 5ISZB 1L6ZA 3HR5B 2GI7A 1GR7A 5ALCH 1G6RB 3TONA 3U9UB 2MQ0A 1ZHBB 4YMPA 1K85A 2DYRB 3SYOA 4RMVA 3POHA 5FLUA 3VFPA 4Z3GA 4OF6A 5INDA 2GFBB 4KC3B 5HY9B 2J5WA 1Y7VA 1UG9A 3LRMA 4ZFZA 3CVHH 4K7FB 2VDMH 1UA7A 4JRYD 4MQ7B 4NDMB 1KYOK 2A1WL 1EAOA 4X6CF 3RVVC 5AD0A 3TU6A 5I0WA 4LB8A 3BD4A 3VFTB 5JQIB 4BFIB 4Z6AT 3Q48A 4OZ4B 4IOFD 4B9ZA 1MFUA 2X4PB 2YBRB 1HWWA 5AVTB 2YSSB 4K3GA 3O6FD 1SLVA 4JHZA 5KVFH 2V2TB 3BZEB 1IGJB 3HIZA 2VN4A 3MLUH 1N19A 3O4OC 1GA2A 1CGXA 4TVPD 4R7NA 1Q0YH 1YPZB 5ADOH 3MJ9A 3SDAC 1F11B 1XF2B 3V0HA 1SMOA 1OP3K 1RUAL 2YD8A 4HUVA 2G75A 4TF4A 3DK0A 4NXSA 1J5HA 2HX7A 5CGYC 2QHLA 3ZTEA 2CKBH 5KBPA 2XWZA 2NYYD 2OA9A 3NMEA 5I1LB 4PRPB 4TSAH 3LEXB 3BPOC 5F9AC 1OTSC 1WT5C 2X7LA 4D0BB 4L1BA 2BS8A 2D7TH 3C6EA 3FCSA 3MCKB 4OZIE 1RJYA 1ZLSH 5GGRY 4LU5L 3W39B 5AOLA 3L3JB 4JFOB 2I60H 2VSDA 4PJ9C 4N8VB 3O11A 4RAUB 4U6VL 4XPBH 4CSPA 2GJZB 3AU1A 1T0OA 2AZUA 4YEEA 1T66D 3O9WA 2ZUVA 3CC5B 3TT1H 1WEJL 4HS3B 3NGBB 3BP5B 1QA9A 1FAIH 1FO0H 4PJIE 1XGUB 2F5AH 3HI6L 3QEGH 2Z7UA 3GSWB 4BK8A 4F3FA 1TTRA 1RURH 1XFPA 1L3WA 2YC1A 1LO2H 4FKHA 4N9GB 1QLEL 4IMLB 2EDKA 2IPKA 4XP6H 5FYJD 3QPQD 3F04A 2OMYA 3A47A 2MCAA 4MXQD 3G6AA 3QXWA 2YLKA 2R4RL 1E67A 3WO4B 5JHBA 1JWMA 4D8OA 1ZSDA 5IBLC 1NBVL 1TJXA 2OTPA 4XAWH 3HUJF 4BSVA 2Z92B 1MNNA 2VC2H 1JZEA 2ZE0A 4MJ6A 1FDLH 1X5IA 2MTAA 3M8OL 3CFTA 1PYWA 4OAWA 2FLBT 2NUTA 2W65B 4H1LB 4JPVL 1TYEB 4W6YB 5DC9B 5GS0L 3ZTNH 5K9QG 4KY2A 5MENB 1AE6H 1TR7A 1UASA 1M1SA 2CO7B 2XA3A 4BJLA 1CICD 1RK7A 1PZ3A 3NOIA 1EBPA 4WI6A 3DXAB 3PHSA 4OZGB 5I82A 1L7TH 3UZQA 1XQ4A 3JUYA 4FFWD 4P0DA 2ZYHA 4NQED 2BRQA 2H0JA 3VXUD 2VIRA 1LJMA 3VCLB 2AK4D 1FVDB 1MFBH 3QJQB 4AZ8A 1C8PA 1S7UA 4I13B 1SM3L 3MFFB 1YUKB 3GXPA 4TQEH 3T3PF 1IKOP 3VSVA 4YHOL 2EDTA 1EXUA 1KJ3L 1IEAB 3BPLC 2EH8L 1OSZB 5E2UH 3IWVA 3F5WB 4QRRB 3ESMA 1XR9A 3FHEA 2Y2TA 4JRXE 1USZA 1CFNB 1HYSC 5CKAA 5IQMA 1ZVHA 4KRNA 4G8FB 3DOIA 3DYMA 2L8AA 1NLBL 1Y0LA 1TQTA 2EH7L 2YD7A 3DHUA 3LD8B 3Q9QA 4ABQA 3CDCA 3CQFA 3VXMD 1FGNH 4CC4A 1XD0A 3GMNB 2CLRB 2PO6B 3G6JB 3CDGB 1MCOL 4P46B 4XPGH 1JNHB 1GGUA 1MCPH 2VLJD 1MFCL 4I4WB 4Z0BL 3E9UA 4PJBB 2W5PA 2BSCA 1GW0A 1WITA 2JQMA 1JZJA 1PTZA 1VF5C 3SQOH 4GBXB 3VI4E 5GS2H 5MP6L 3IYLW 1IRAY 4P2QB 3D4CA 3DO7A 3MLYH 5DRNA 3L5HA 2IH9A 3R06B 4OFYD 4JPKH 1ES0A 1A7QL 2X6UA 2BNQD 4GSXA 4Y9GA 2FWOA 4CVUA 1BFVH 3MRJA 4AG4H 2CHDA 2NX5A 3DJ9A 3FU8A 2NTFB 1E43A 2FJSA 4LNRA 3BCDA 5DUJA 4WWKB 3IDJB 4FMVA 4I2XB 4OGXL 1X5AA 5B38B 2IWGA 1G1CA 4BSJA 5AAWA 1MZYA 5SWSB 4KI5F 4X6EB 1G9HA 2JB6B 2R7EA 3B1TA 3PWLA 4NENA 4F15C 4L0YA 3KR3L 2E3VA 5DMIH 2G60H 2NY6B 2QLYA 3RVVD 5JYMA 4X4KA 2GUOB 3CFJB 3RE0A 1A4CA 1A1OA 5CR1A 4GSRA 5CN3A 3GNML 2OW7A 2ATPA 4ZNCD 3OPZH 3KBEA 2APWA 2ADYA 4NPKA 3SGJC 4APQC 5CILL 4JHAH 4D9RD 4RWYL 4JPIA 4DGVH 5CJXA 4NO5B 2ZJSH 3GSNH 4WK2B 2PPCA 3O2DL 4XPAL 5JNYB 1QUNB 1J5OL 4JNXA 2ZWKA 3SDAD 5CWSB 5I26A 3PAVA 2J7LA 5DJ6A 2WB1A 1HH6A 2FJGA 3O2VH 3BO8B 5KZCB 2EYTB 3ROLB 5J6HA 4OD1H 1DUZA 3FN9A 3QO0A 4P23A 5H4ZA 3HE7B 4ZS7L 2A6KB 2X4RA 5CGYD 7FABH 1TZHA 4YDJB 2BVPB 5ESQB 1K6QH 2GW5A 2IV8A 1Z3GH 1OTSD 2VO8A 4MLIA 5I8KL 4IHBA 5E2WH 1PZUB 4JG0H 4X99B 3AXHA 4G9FB 5EUKA 1LE9B 4FI6A 3MACH 4PJDE 1JXKA 1UM4L 3GBDA 3M1BA 4PJFB 3O8XB 4PJ9D 4DESA 5I1DA 4NWUH 3V5KB 1X7QB 4TKWA 1DO6A 4LCUA 1KCUH 4KZEH 4QYOA 4B0MM 5DC2A 1RK0B 4G7VH 4KUZH 3AY2A 4MS6A 1MZZA 3FFCA 5INDB 2A9DA 1T21A 5F9DC 1NICA 1GKEA 4ZFZB 5DVNA 5AFAA 2R1YA 5CEZL 3VYPA 4X9FA 3IU3A 4OQTL 4IBWA 2AXHA 5AD0B 2JJSA 1NLDL 4ODUB 5TFSH 4B41A 1WAAE 3KYKH 4JEGB 2BP3A 4Y4KB 1GYUA 1E50A 3N55A 1WG3A 2FSEB 1U2HA 3HNVH 5IBLD 5LGKA 3Q01A 5E08L 4E9WA 4R7NB 1IFHL 3BKYH 2J8UB 2V3FA 3WJLA 3IU4L 1XSKA 3QHFH 3UAFA 3ZE0E 2LTQB 1BQUA 4YDMA 4HUVB 3D9AL 3WFCL 1HWGB 4BHUI 2ERJB 1MQKL 4ETYA 1LO0L 1OWWA 2VM9A 2ZKWA 3CN2A 1AXIB 1H0DA 1DZBA 3VM5A 5JXEC 4L3ED 4YAQA 5K59F 2P48B 4KKRA 4BKLA 1KULA 4FABH 4OLUH 2X7LB 4YSTA 2G2NA 3L3OB 3V7AG 3UYRL 1AQHA 3HG1A 1RJYB 4O00A 4HS6A 1SHWA 4RRPM 5D96C 5TE4H 3NJKA 4F8LA 2ZICA 3O11B 2KBGA 2UX7A 2P4AB 3U4EA 2X4OA 2AQPA 3O9WB 5IOKA 3FO2A 3S88L 2RHEA 3B7SA 2C7UA 4JCWA 1H3PH 3G5ZA 3NSJA 1QA9B 3IDIA 1OF0A 1V27A 4CC0A 2APXA 2J21A 4GS7C 1BZOA 4EIBA 1SQMA 4L4TB 1EO8L 3VGGA 1ZPLA 2VDNL 2YC1B 3B3IA 5ISZE 1HYSD 4BCZA 4QIRA 2IPKB 3CMOL 4CDGC 3FU7A 1KFAL 5TQ0H 3DROB 2EYRA 3QFDA 3G6AB 2E5EA 3HS0C 4PRID 3BQVA 1JWMB 3WCYA 2ZG3A 1ZSDB 3TT3L 4BSVB 3U46A 4J39A 3G5YB 3ML8A 3LZQA 4MJ6B 2IAMC 3IDNA 1ZVSA 2WQVA 1T7XA 3HC2A 4OAWB 1PYWB 5HHQA 4DN4L 2NUTB 2P8MA 3EYVB 2VUOA 1DEDA 1FNGA 3CUPA 2ZXWB 2OXHA 3LYRA 5BRQA 5IMLA 1BLIA 3GB7B 2Q0ZX 4H8WL 1U3YA 4HLZH 4XN2A 5IQ9A 5I71B 1IEHA 5L8LB 3GFUA 5C09A 5HD8C 2EE2A 3UZQB 1NAKH 4JY5H 4FEIA 1JDCA 5I15L 1NGQL 4QHMB 2KZWA 3PCYA 1J1OL 2WNGA 4CMHC 2VIRB 3WXWH 1LO5A 4E9RA 4HU8A 1NOFA 3IS1X 3R4DA 4LARL 5F0JB 1CLYL 1R5VB 3UPCA 2HT4C 3CN0A 1S7UB 3NTCH 1P4BL 3O0RH 3KLAA 2HH0H 2Y5QA 4U6TA 1S5HA 4NC2B 4Y5YC 3HVDA 2XN9B 2QLVB 1QHQA 3VMPA 3W82A 1YCSA 1EXUB 2H3NA 4PJIF 5D6DC 2K3TA 5CCGE 1NIDA 5B1JA 5KVEE 2Q7YB 3TNMA 1JV5B 4W4OC 4APQD 1XR9B 3TPUA 1NAMH 5I6KA 3IDYC 4K5OA 3CFMA 4EKXA 4J3VA 1MRFL 1Y0LB 3F58L 4YEFA 5LGJB 1MCCA 1TEFA 1PD1A 2GJJA 4KX8A 4U1LA 3OB0K 2DQFA 1RCYA 1BP3B 4X4MA 3CJJA 1NCDL 2K9UA 3EJTA 5CLWA 2GBVA 4K9EL 5D7LB 3RNQB 3NCJH 4IMKC 3P77A 5I8OL 1BYNA 2CK0H 4Y2OA 3GSQA 1ORSB 2R2CA 3RWGA 5B8CB 4HHAA 3IVKA 1DLFL 3ASWA 2F53B 3NJXA 2OJZH 3PGFL 5A3IC 3L9RA 2ESVA 2K8QA 3MRPB 5TDOA 2K8MA 5MI0C 4NRZA 1ICTA 3DO7B 5FYLE 1FI8C 3HCVB 4U49A 1AZRA 1D6VL 5DRNB 5IMOB 1X4XA 15C8L 2EIKB 4GG6B 5GGVY 2ZUQC 1BWMA 2FWOB 1CGTA 3QRLA 2NX5B 4WUUA 1S7VA 1EEZA 4KV5E 1I3UA 5IESH 2XIIA 4LNRB 2H4EA 4L4VA 2BSRB 5MENE 2I5YH 2J25A 2JTYA 2O6CA 4L9LA 5JPNA 2VXUL 4PRBB 1E5ZA 4Z7OB 2VABA 2TAAA 2A5UA 3Q2CA 1MHPH 4NENB 1FORL 1NM9A 3DXAE 4JREC 3AUVA 4OZGE 1J11A 2DQGL 3BKJH 2E7DA 3HE6A 4LSTL 4NKIH 4XWGL 1AO7D 1A1OB 1HXYA 3CSYA 2CWRA 3ZOAA 5SX4H 5CD5C 4E41D 2ATPB 1I7UA 2VXSH 1I9EA 3HNSL 5EFIB 4JPIB 4YWGH 5IBUG 3I3EA 4PREA 2Y06H 4LPVA 4OSUH 1IB5A 2GSGA 3B2VH 1B2YA 2GCYA 2GTQA 2VO5A 1R5WA 3T0BA 4RAHA 3DGDA 3WIHH 1J1XL 3BQUA 3EH3B 4ZNEE 4Z78A 1HH6B 2FJGB 4NHCL 1MNUL 3OAWA 2JELH 2PPAA 1DUZB 3E8UL 4P23B 2Z8SA 4XVJL 3I2CH 4OF0A 1GMEA 4M7ZB 1P9MC 2JK5A 3VVWA 1O6TA 4KKNA 5JXED 2IWKA 1TZHB 1RAMA 2IBZY 2EDEA 2KQNA 3MLWL 3VI4F 3TESA 1YEJL 2HVJA 2FEJA 3CX2A 4FKEA 3ZR5A 1IQWL 1M3JA 1XDTT 5AG8A 3UTZA 3G6JE 2WWKO 5DJ2A 3C5ZB 5ID1B 4M8UA 3ECWA 4MJJA 3BUQA 1RUQL 4KRPC 4PJBE 4NWTH 3M1BB 4ZX6A 5I1DB 3FB5A 4KMTL 1DBAL 2H45A 4U4BA 1PG7X 4QYOB 2FGZA 3O3BA 1QOKA 3SDXF 1SYVA 5E9DA 4P2QE 2BY2A 2YWZA 5E00A 4HWBL 3BPCA 2EVIA 1T21B 5E23A 3C2AH 4NN6C 4S1QL 2R1YB 1XZWA 3BVNA 1MFEL 3KPRA 1IGMH 3DBSA 3VFRB 5AZUA 3EJSA 4X8JA 4K8RL 2WNKA 3R0NA 1S6NA 5TDPA 1XV8A 1J8RA 2R2BA 4NQSB 2HKHH 4AQ1A 5J11C 2DMKA 2MHAA 3WFZA 4PV1C 4S0TD 3EYUH 2C3HA 1AD0A 1MSPA 2VW7A 2E8YA 2X3BA 4O2FB 3IM1A 4WGWB 5SWSE 3DIVA 5IHWA 5JW4M 3K80A 1N6QL 4N2LA 4A66A 2CJUL 2WCPA 1A6ZA 2I27N 3T0XA 4IGBA 1FJ1A 4ZMQA 1Q4NX 4MX7A 2IAMD 4UQ3A 4EQ2A 4X80H 1D5IL 5HHPA 5IGXH 4UYQA 5CGMA 2W88A 2VR8A 3VG0L 3MBEC 2E47A 3S0PA 4TQIA 5BNXD 3DRTA 1N4XL 2ED7A 4GYBA 1TMCB 2ADFH 5JQ6L 1E9PB 4YAQB 4KKCC 3N5AA 2PP9A 5FM5O 1DL7L 3QEQB 4BKLB 1CTMA 4Z3FA 2W07A 5HD8D 3VB8A 5T1MA 2FWSA 3OJDA 1UJ3A 4DKTA 5DD5H 1DSYA 1OGAA 4U3XA 5EZIL 5CIPA 2VQ1A 3HG1B 4PJDF 4Z7IA 1UTDA 4NM8H 5F1KC 4HS6B 1N5AB 3U7YL 2X1QA 4MS8C 4E42B 5LO7A 3EJZC 2HT4D 1TVHB 3MLSL 4F33A 2E7HA 5EORH 3U4EB 2X4OB 1X5GA 4X9IA 4ZTEA 2C7UB 4FL4C 3G5ZB 3RQ3A 2VDKL 1UZ8A 4G9FE 3IDIB 1RXLA 3P9LA 5HDWA 4IBUA 4RGMC 5E99H 3V7MA 3W11C 2XVKA 2BLFA 3B3IB 3FU9A 1JNLH 4H26A 4MSWB 5GIRA 1I8KA 1P5VA 4FQHB 4AQ8C 1WAAF 3FU7B 2IO5A 3ULVE 3BIBX 4AK2A 5I6XB 4JGNA 5I23A 1M7UA 5JXAH 2EYRB 4NO3A 1NMCB 1T0NA 4HWNA 4P4RA 1MI5A 1J1PH 1JZGA 1EGJL 3DKHA 3CG8A 3HI5L 3HLAA 4ADIA 1BX2A 4XI5C 4L8SB 5LG6A 4I9XA 1YZZA 2MQ3A 35C8H 3QSKB 2GC4C 1A1NA 1ZVSB 2R0ZH 5HHQB 2X6MA 4QRTA 3IDUA 4L3CA 2P8MB 4FFYA 2VSKB 5KVGE 1FNGB 4OLVH 4XGZA 3CUPB 3DSFL 3T0WA 1CL7H 4Q9BA 3KS0J 4NT6B 4PEEA 4ZPTB 4NI6A 5IMLB 2IJ0C 3RDTA 3UO1L 4K5NA 2BW4A 5IQ9B 3GXUB 3LNDA 5BZXA 4F58H 5C09B 1JGUL 1OSYA 3W81A 4LOFA 3QUKA 3V4PA 1P2CA 2HUHA 5DTFA 4DIXA 1KGCD 4L29B 1LO5B 3NEXA 1ETA1 1SQ2N 1A64A 1RY7B 4ODSH 2JFCA 3FU0A 3LRLA 3GIVA 1NDGA 4KTGA 1RJZA 2ZIDA 4NCDA 1EAQA 3W9DB 4HUWA 3RKPA 3KLAB 1RULH 4O02H 1S5HB 4C8XA 3C60C 1QHPA 1WK0A 2EYSA 4I3RL 4KVCL 1Y6MR 1TU2B 5EN2B 5EZPA 5GS2D 5CD5D 1I8IB 4CVWA 3TS8A 4I85A 3G08A 1DN0A 3ARTA 3TPUB 1Z6JT 4QOKA 4GINA 4XVTH 3P1VA 1BAGA 2B16A 1TJGL 1HJCA 3MRQA 4L8BB 2ZG1A 3EBAA 3WTUA 4Q9RL 1YYCA 5EF3A 3A21A 1TQWA 3A6BH 4U1LB 1FP5A 2DQFB 2F6AA 3U0PA 5AL0A 4HMCA 3PGCA 5HDLA 3TL5A 3D05A 2VTFA 4WKXA 1JGLL 3H9ZA 1NEPA 1U6AH 4R2GB 3P77B 1FNFA 3EOBB 1QPKA 4YPGB 4Y2OB 3GSQB 4YGAB 4XAKE 5T1DH 4NNYB 4EOWL 4XB3A 1WJ3A 4Q58C 3DX4A 4F7KA 3S8FB 3L9RB 4XBEL 5GQBA 2ESVB 4NRZB 2ARJA 1I85A 2V7NB 1QBML 2W91A 2DBJA 3B9EA 1F4YL 4Y2DA 2D03H 3GLZA 4G3YL 4NJAL 3NCEB 4KRPD 1EDYA 2P9RA 3FQUB 1MPAH 4DTGH 1S7QA 4XNBA 5KYNA 1S7VB 1EEZB 3DETC 4L4VB 3MRRA 4WFEE 4YC2C 2YAHA 3D6GA 4GSDH 1DJIA 1IM3A 4MJ5B 4BKTC 2FK9A 2P7TA 4L9LB 4DW2L 4HP5A 2DM7A 1HOCB 2VABB 1I7RA 3E7JA 3MV9A 3I9IA 2B1HL 2FIKA 5FGBC 3NRFA 3HE6B 2HMIC 3BW9A 2AK1H 3EJJX 1DVSA 2F8IA 3MRHA 3V9CA 2EJ1A 1HXYB 4XNXL 1I8MB 3JV5A 3FU3A 1I7UB 2B9BA 3G5VB 4QTIL 3WLWC 4W93A 1AMYA 3VD9A 2DL9A 4HJ1A 4NQEA 4AT6A 5EU6B 2FT8A 5LG1A 1KIUB 1WS7A 2EDFA 4PREB 2GSGB 2FJFA 2YKLH 2GBUA 1M3IA 1FFTB 3BQUB 3BVDB 3MBED 4Z78B 1FBIH 1LO4H 3A6CH 1Y18B 3WBDA 5KSVB 1VGEL 3AWFA 3T8XA 3MV8D 2ZSVA 4HH9A 1MJ8L 2VMJA 1TNNA 1YYMH 2JK5B 3FAWA 4LAQH 4PJ5A 4FHKA 4KKCD 2PETA 4KNSA 5FO2A 4DK3A 3OJ2C 3IAPA 2HVJB 3BEWA 1DFXA 1JOIA 3AAZA 3QCVH 4RDQF 5MEPA 3V52L 1KCLA 3LQZB 2DQTL 4XPTH 5JW4N 3UTZB 5DJ2B 2H7WA 1GOHA 2HJFB 4HQQH 1YYLL 5B1BB 5C71A 1EIBA 5DZAA 5DLML 1T6WA 3MRLA 4MS8D 4M4PA 4HUKB 3V6ZA 4F7MA 3EJZD 3PP3H 3FB5B 2FR4A 5F93C 1HKFA 4KV5F 2BOLA 4M5ZL 1T03L 3TA3C 1F58L 3E80A 3O3BB 1SYVB 1WTLA 4W6XB 2MNWA 4Z7VB 4HOZA 2LU5A 3X11B 3PJLA 4Z7QE 1CFSA 1IIIA 1QSED 2ZCHH 4J27A 2HWZL 3BPCB 3UP6A 5IHZA 3IXAB 3W11D 3SGEI 5DS8B 4HHWA 3NDYE 2A83A 3KPRB 1I1AB 4OZGF 3H3KA 5JW3H 4AIOA 4XMPL 5JHLA 4X8JB 4ZS6C 1X4ZA 4ANVA 5LQBH 3IB4A 2NX5E 4WTQA 5TDPB 1SEBB 2R2BB 5KAQF 2MHAB 1RHFA 2P5ED 5FDWB 5DI8A 1WFNA 4DVBA 4WW2A 5DJAA 2ADGB 3GUFA 1PIGA 1IBDA 3QAZC 4XI5D 1A7PH 2F68X 1A6ZB 2ATKA 2AJUH 4IGBB 3CXDH 4HBCH 1I9JH 4MX7B 4UQ3B 2VXQA 5HHPB 2Q6WA 2XUWA 3HAEB 4WY7L 5BV7B 4ZOAA 1ZLUH 2Y1ZA 3RGVA 2WBKA 4A2HA 3DRTB 1KYAA 3T2OA 5EIIG 4HCFA 2D3JA 2ZUTA 4M93B 3LCYA 2JQZA 2QADC 2YZ8A 3VX0A 1ESOA 2W07B 5T1MB 1HWHB 3BIKA 3G6JF 2APBA 3WNNA 3QS2A 1NANI 2WP3O 4DUXA 1OGAB 5IWLC 3U6RB 4M6OH 2VQ1B 5MEOA 4PJBF 3NESA 2FH6A 5DDHB 4AITA 5T3XE 4F33B 3RWJA 1NCWL 4KTYA 2C5DC 2RB8A 5SX5H 3WTYA 1L9OA 2Y6SC 3QW9A 3Q05A 1J8HD 2R59A 3LMJH 3C60D 5TJWK 1W8OA 3IFLH 3RWHA 3P9LB 1FFNA 1MCJA 4YE4H 2BW5A 1UH4A 5SWZD 1FA4A 2H0EA 2EE6A 4H26B 1R3IH 5GIRB 1I8KB 4U1GB 3Q7JA 3W5MA 3FK3A 2Z4QB 3RGHA 5C2BL 2NTSP 5KOVC 4D2NA 4QUOA 1ZT7A 5K5YA 3FFCE 4NO3B 5DK2A 1T0NB 2FQEA 1R6VA 1ACYL 1KTRL 3D3VA 4XC1L 2A1WH 2PXYC 4IIZA 4L23A 4FJ6A 2OV0A 3FH8A 2CO6A 3CDFA 2GBAA 3ARBA 2GTZA 3PNWA 4YZFE 5HVFB 4KQ4L 2EIJB 4QRTB 3Q5YA 4L3CB 4LNVA 4XGZB 3NEOA 1A7OL 4ZMTA 3MV01 5BMFL 3O2WL 2BIHA 1S5IL 2W94A 4UTAL 1Y1UA 4LOVA 3UTQA 5L4MA 3RDTB 3KEDA 3Q3GA 2BVOB 4UILL 2BIMA 1XVSA 1D6EA 2VWEC 2WQRA 5AW2B 1NKGA 5FCUL 3TYGL 1RUAH 1IAII 3OLEA 1P2CB 3DETD 1FYHB 4FQXA 5AAPA 1KGUA 2LU4A 1OSPL 1GMIA 2WLIA 4G43A 4QT5A 3MO1A 3ZVVA 1SUHA 3L3GA 4JFED 4K3JL 3GIVB 2ODIA 1RJZB 2VXTH 4HUWB 4AMXA 4P3WA 1IL1B 4L3EA 2HMID 1TYJA 1WUZA 2IF7A 5CJOL 4DPBX 4ICWA 1MCKA 2BS71 1FN4A 3HG1E 4LU5H 1F3JB 4PV9B 1A7NL 4UT7L 2DQ6A 1TSRA 5IV2A 4PJFF 1KXVC 3TBVB 1I9IH 3T08A 3WLWD 1G0YR 4AYSA 2C4FT 1SN0A 3FZUC 3OXSA 2UYLA 2AQRA 3G08B 2GJ6D 4HPOL 4ETQB 1DN0B 4P2RD 5DEZA 2YWYA 4QOKB 2BWDA 4GW1A 3V0VA 3ULVF 2F7OA 3MRQB 1WEJH 2F18A 4HF5L 4XN4A 4I5BA 1VAHA 3BSZL 1OAKL 4WO4C 3U0PB 2XG4A 4TV3A 3NPSC 1DVTA 3S34L 2ZXEB 3L45A 2WQAA 1WV7T 2H8PA 1KENL 1NBYB 3U4KA 3AXIA 4WHCA 1QLEH 3MUGA 2MKLC 3SCMC 1BIIA 2J3SA 2FZ3A 1EZVX 2A7BA 2X88A 2IPTL 5CMAB 1MFAH 4PS7A 2R4RH 2APVA 2IDFA 1PMYA 2ARJB 3QC6X 5F9JB 4UQ2A 3N43B 4WHYH 1NBVH 3UGEA 4UT6A 4N6QA 4Y2DB 1ZHKB 2VDOB 3M8OH 5J8OA 1ITCA 1S9XB 4EI6A 4GMTL 1S7QB 1PG7L 3QDAA 4JPVH 3TA3D 4GO9A 5HGBA 1EUTA 3FTGA 3MUUA 4Y89A 1IAOA 3UDWA 3B2DC 3MRRB 3Q8FA 5AENA 5GS0H 1PFOA 1F1AA 4DP9X 4HSAC 1YG9A 2P7TB 2VMEA 4LLWB 3CFBA 2XN1A 1B0IA 4ZDHA 2B8OT 2VLRA 3X3FH 1I7RB 3IJEA 3MV9B 3APCA 1SDYA 3KDMA 4EAEA 5C09E 4F7EA 3TTYA 1BQLH 2FIKB 4ZS6D 4GXVH 1O5DT 4PS3A 1D9KC 2BSTB 2WLZA 5CZVH 1S7TA 1TKWB 3BW9B 2CCVA 3MRHB 3C09B 1XO8A 2KYIA 3SEPA 1A02N 4LKXA 4NIYE 4MAYA 2CR0A 4NQEB 3HKFA 4AT6B 2ROYA 1SM3H 1Q72L 1T5WA 2ICEA 4NQCD 3BC9A 4TLKA 1EANA 3WSQL 1KJ3H 4ZMPA 2ZF9A 4B60A 4B5EA 2EH8H 4PJ8C 5INCA 1FYTD 1XH2A 2EIEA 4GO8A 3T8XB 1P4UA 2ZSVB 2HA1A 7PAZA 3CU7A 1U91A 2EH7H 3L4WA 3SGJA 1E8YA 3NIFB 3SYCA 2AVFA 1QNZL 2CDEB 2QADD 4MASA 4KZCA 3AAZB 5MEPB 1Z2KA 4X4ME 4GUCA 5K9JL 2ED9A 3M7OA 4FNPA 3JV4A 1MCOH 2A6JA 2JQAA 2LLNA 1HZLA 1MFCH 4Z0BH 3ULUF 3BWAA 2VLME 3MRLB 1KIQA 4MDRA 3V6ZB 3WS6A 4PB0H 4F7MB 1F3DH 4AYDC 2XRAL 2FR4B 2MJWA 5MP6H 2Y6SD 4ZTPH 2JLPA 4CU6A 1EDQA 2ESVE 2FDBP 1F97A 1EHNA 3DPDA 1CFSB 4KNQA 5IHZB 2XCMC 3X1FA 5IQNA 2AZAA 1OVZA 4Z95L 1JYNA 5FKAA 3ENEA 3T6VA 3RA7L 2EICA 2A83B 4I9WD 2ITFA 3UTTD 4Q6KA 4QF1A 3WFBH 4WUUE 5FPIA 1MXGA 1KEML 3U7AA 2H5UA 2WVSA 1CDYA 4OGXH 4L4VE 4UQDA 1KNOA 3U30B 1JV2A 3V4VA 1ZVNA 2H0PA 2YHGA 2LVCA 3QZMA 5F96L 3SJVA 4WW2B 5DJAB 4U05A 1K5WA 2IIJA 3KR3H 4YO0B 1KY6A 2PXYD 2ATKB 4M02A 4HULB 3F85A 2X10A 3PABA 1L6XA 5IVXA 1MWAB 2Q8BL 3MSPA 4BQBA 4EN3C 1KTKE 1OCOB 5E0FA 5MHSD 4I3GA 2V3DA 3HMWL 3Q9PA 3VGEA 5IJVA 3RGVB 3NIGE 5CILH 4ZPVA 2OTUA 4XBGA 4WI9A 3D5OF 1UWYA 3O2DH 4HD5A 1GS6X 1J5OH 2HT2C 3VD3A 4BZ1A 2C9SA 3O4OB 3BIKB 2P49B 1C16B 3QS3A 3AZUA 3SDAB 3D25B 3SE3A 5TK2A 4ZS7H 1G7LA 4ABUA 4GIOA 2QQNL 1KBGL 4HU2A 4ONHA 3RWJB 1JE6A 2HFGL 4IRSA 4JM2A 4XX5A 4WK0B 5I8KH 1CD1B 2YR3A 3Q6GL 1DQTA 3CVHA 3GSVA 2YAEA 2CM6A 3RWHB 1VHPA 1UM4H 2CUAA 4GG6F 3HNTL 1FFNB 1T0PB 3CZLA 4ONFL 3CQQA 1YEEL 3VWJC 2IFFL 4U7MA 1ZHLB 1UT1A 2NW2B 2BP5M 2C3VA 4AYMC 1OAUL 5AVXB 5ICUA 3MOBL 4KO5A 5AKTA 3A3YB 5E9DE 1H3WM 1ZT7B 3LIZL 2C8NA 4WO4D 3RYMA 4A6YH 2AFNA 2D7QA 3NN8A 4L1LA 4PG9A 3HN5A 2ZX7A 2ZXBA 3LJ3A 4KVPA 5EOTB 4OQTH 3D3VB 1OIOA 3KPRE 4OIIL 1C1EL 5T5NF 2CO6B 3QI9A 3SCMD 1NLDH 5GSVB 4Q14A 3ARBB 1F0LA 2GTZB 3PNWB 2BVTA 1PNDA 4HCIA 2CO2A 1QEWA 1OM9A 3GF8A 3MNZA 4CW1A 3FQRB 1IAIL 2WZ0A 5ESVA 3E38A 2ZWLT 3LRGA 3KNBA 3UTQB 4Y2LA 5E08H 3FRUB 3VXSD 3VXQA 3Q3GB 1OW0C 3RWEA 3U1QA 3DNKA 2VR5A 1D6EB 3IU4H 1DO5A 1WHOA 1Q9OA 3S8WA 3WHE0 4DETA 1XBDA 3D9AH 4WKZB 4YS4A 3ABKB 3AM8C 1UD4A 1MQKH 1LO0H 4H8UA 2J20A 4H8VA 2X3AA 4G43B 2WLIB 5CCHE 3RY6C 3MO1B 2HPOA 3L3GB 1NC4A 2E6PA 4FA7B 3QQ4A 4CA4A 4HUNB 3KJ6L 3PRZA 1FO0A 1E90A 1U2CA 4J8QA 2D4DA 1D9KD 3UYRH 4L3EB 2Y25A 1OGAE 2B3RA 2B0SL 2KPNA 5ADPL 2V9RA 4Z7UA 1FN4B 2NDFA 1XMWA 2DQDL 1JZ4A 5ACLA 2XX1A 3HC3H 3OXSB 2UYLB 2FIRT 5HHXL 2AS5M 3U9PH 4URTB 3S88H 2QBWA 1O5PA 4YHLH 5TF1L 3QXVA 3V0VB 4IRZL 4AYGA 1CFTA 1F4HA 2XWTA 1BZ9B 5K1JA 4I5BB 4UOW0 2EECA 1OGTA 4PJ8D 1XGYL 2XG4B 2V9QA 3ZO0A 2DV6A 3PWNA 1Q9KB 1EO8H 3KH3A 5D6DA 2VDNH 3KXFD 2H8PB 2WLLA 2GPZA 3BZDA 3BPLB 1I53A 1KJ2H 5TF0A 3MUGB 1MW1A 3CMOH 3PXLA 1BIIB 2VH5L 4KMQA 1KFAH 2FZ3B 5AB1A 2NR6C 3L4XA 3JUZA 1MI5E 5L9DL 4UANA 2YO3A 1EO5A 2GIXA 4UQ2B 4JFZL 3TT3H 4JK0D 3P4MA 2A9NH 3TEZA 5F6IB 1BYPA 2QVTA 4PN6A 2EC9U 4V11A 4V1DD 5IBUB 4G8EA 4HW6A 3I6SA 3MBWA 4DN4H 4EI6B 4HJTA 3PXJA 4LVNC 5HGBB 1I31A 4MRCA 1IAOB 2FBJL 2Z1PA 4M29A 1RUKH 1E9OA 1H9VA 1H3TA 1TTBA 3AGVA 3CFBB 4GLRH 5L4FA 1UCBL 5JIHA 2DLHA 3IJEB 1HKLL 2R8SH 3ZUCA 3KDMB 4F7EB 1ZK5A 3K6SA 1T04B 2ZOLA 4BXVA 5I15H 1S7TB 4XMZA 1NGQH 4XOAA 5IHBA 1J1OH 2W9LA 1CFBA 3MRBA 4MAYB 4LARH 3UTSA 1IO4C 5DVPA 2WN3A 4BZYA 1MDAA 2ICEB 1T5WB 5IROA 4J3SA 4L8DA 4NEHB 4U2ZA 3S37X 3X1NA 5J1AB 2A74C 4F15B 1OGPA 4O4YL 2WWMC 4EN3D 1WFTA 5INCB 2X0VA 4LZKA 4PRNA 4AJVA 4WEEA 4OIAA 3D0LA 3KPSA 1A6PA 4QOKE 5DMKB 4Z3TA 3MLZL 3F58H 3B2PA 4NAMA 2HT2D 4UQ9A 43CAA 4APQB 2E7BA 4RMWA 4TOYH 4FNTA 3O0LA 1UB5A 5JMOC 4F93B 3QIBC 2Q3ZA 3JV4B 3PFQA 4OUOA 4K9EH 3ISRA 2AAAA 2A6JB 3TBSA 3EOAA 2ZSWA 5I8OH 3VW3H 1RSFA 5KSBB 3BWAB 4U1HA 1KIQB 2ZXCA 1TJHL 1C5DB 5IQLA 5FEBA 1N68A 3NH7L 1DLFH 2HKFL 2JSFA 3PGFH 4ILDA 1ZXKA 1Q1PA 3PL6C 4HCGA 2OQJA 3FXIC 2UXTA 5DEFA 4Z8FH 3B8SA 4EDXB 2E6JA 1H5BC 3BWZA 1D6VH 4AX3A 3WDHA 2QVIA 3SY6A 3D50A 5GRJL 3RBGA 3DHJA 5FKAB 3VWJD 5EIIA 2QGDA 4OJCA 4TRPL 4FC3E 3TA4D 3ARZA 5AL8A 5EU7E 5F2FA 3QXDB 4ZQKA 5FWRA 1AKJA 4JRLA 3TIDA 3UH8A 5JIQA 1KNOB 1JV2B 4B0MB 2EVGA 1BCIA 3K46A 1TPXC 2NNAA 3GSNA 5CD3A 5FHAL 3Q06A 4XB8A 4R5VA 3AS0A 3MLVL 3MV9E 1B2WL 2ARJQ 2DQGH 3PABB 5IVXB 4XWGH 4L5FL 4HHGA 3ASOB 4RDBA 2OW6A 1A6WL 3ETBJ 4BDVB 4QTFA 1CDJA 1AH1A 5E7BA 3UBFA 3HNSH 4ZTOL 5IJVB 4GRWB 4ZPVB 2OTUB 4NQEE 4XBGB 1DVQA 3GHEL 4S1DC 1EBAA 3G3LA 4DP0X 4OM0L 1J1XH 2XZAH 3QJSB 2CZNA 4O58H 1PL3A 1Q90A 3MGAA 1BPLB 4NHCH 5D7KD 4EI0A 4JX0A 4XVJH 2AABL 3ECBA 4OFVA 4AGPA 4J4PC 2AXWA 5AVWB 3EJYC 3MLWH 4PJ5E 4ONHB 1YEJH 1J0KA 2ICWI 3NIFE 4MB4A 4KKQA 4IRSB 1TIUA 4JM2B 1WO2A 1UC6A 3AMKA 3NQIA 4R84A 2KMWA 3CVHB 2VDMB 3WAKA 3GSVB 2ZKXA 1RUQH 1VLXA 4FN0A 4OFKA 4C56A 5LDUA 4NO0A 4KMTH 3QUXC 5HHOD 1BJ8A 3H9YA 3AG3B 4ATTA 3PV6A 4HWBH 3MKKA 4K07A 1GXEA 3PG2A 3AVEA 3FN3A 4S1QH 4ES9A 2WJ7A 3NN8B 4PG9B 5SWQA 3BXNA 3CLWA 3QDGA 1QSEA 3GSRA 3LHAA 2OR9L 4FFZL 4EIUA 2XBZA 4K8RH 1U2YA 3QI9B 3ATAA 3GSUA 3MA7A 1F90L 4QXGH 3V7AE 2NR6D 5DK0A 4Z3JA 3NIGF 2Z91A 1N6QH 4AQ8A 1FNHA 5KANI 1KPVA 3WENA 2CKBB 4DAGL 2WANA 2CJUH 5ESVB 1MRDL 2P5EA 2ZKHL 2IGTA 4LEOA 3WIIL 1WC7A 3HS0B 3TV8A 1HCVA 3VXQB 2MOVA 1A9EA 3W57A 1D5IH 2IWEA 1B4LA 2YD0A 1R9FA 3IFOA 4PGDA 3I3DA 4WJ5A 2WLJA 3VG0H 1Q9OB 3G7TA 3ZSSA 3WD5L 1YECL 2CHWA 2Z8RA 2P42B 1U58A 5GGVL 3QNYB 1E4JA 3RB7A 1YEFH 2XA8L 3TN0C 1WCQA 3NJNA 5CKGA 4FTVA 1KUMA 1Q94B 1EXGA 3U7WL 1DL7H 1X5JA 4R7LA 2QZQA 4LRNH 1FO0B 1DJSA 2NQDA 7PCYA 5EZIH 1G5GA 4FP8L 1W6WA 4GEIA 1HINH 5FUCE 1G7QA 3U7YH 1MCHA 4C58B 4H25A 4PLKC 2DJUA 5E0QA 1KT2A 1WIUA 3H54A 1HN1A 4KJWC 4Z7VF 1AKPA 1CFTB 2WWMD 2XWTB 3V8CA 3RVTC 3KJ4B 1OGTB 5I16A 3MJWA 4E5XG 5DRXA 2VC2B 2XY2A 3PWNB 5FYKE 2ID5A 4JANA 2CGRL 4J2QA 3LZLA 5ES4B 2CXKA 5KYWB 5DFVC 2O61A 4N9OB 2OJEB 1PSKL 1XIWC 1MJ7H 3QIBD 1TTUA 1D7BA 1RMFH 3RI5K 1EGJH 4B3VA 5EU3B 1TOXA 4JKLA 2VOTA 3CIQA 4N25A 3QRBA 4XBPA 3D3VE 3P4MB 4Y4FA 3FOMA 3VGHA 3CN1A 4LPCA 3B9VA 3BSGA 2EXYC 4G8EB 3SGKC 1UADC 3MBWB 4K7PH 2LT9A 3Q13A 3P4NA 3PL6D 3CZSA 3UX9B 2E9BA 3ZL1A 4IU3A 2Y36L 3IS0X 5KVDE 3L3DB 4XO9A 5CLZA 1XT5A 4M1CC 5MI0B 3RWCA 3BHBA 1H6UA 3UO1H 5DD0L 4EI5C 4KDWA 4GAJH 3V8OA 5H37G 1JGUH 3EFDL 3UCRA 3K6SB 2VXVL 3KLLA 2ZUQB 4OKVA 4U4IA 3MR9A 1CXIA 2YPKA 1XL6A 1H19A 1NAMA 1USQA 4PW3A 3DJRA 3MRBB 4KDVA 3AABA 3UTSB 2JKRM 2CGYA 4YSOA 4D8PA 4BRVA 3EGDA 1GC1L 1KPUA 4JJHA 4BXSV 2K70A 4F7TA 4L8DB 4I3RH 4EZLA 1FPTL 3DX8B 4OT1L 4OZHA 3UEQA 3DUUA 1HI6A 3RHWF 3BGMA 4PRNB 3D85A 4RFOL 4Q2ZB 5D1XA 3JXAA 2BNRA 3K2IA 1W72L 5CZXC 2YAMA 3D0LB 3DIDA 1NIAA 3KPSB 1J5CA 4S1DD 2DTML 2OLDA 1JMZA 5L0QC 4H8WC 43CAB 1F41A 1FCCA 1UB5B 3OSKA 2CH8A 3SO3C 4Z7AA 2B1OA 2XBDA 1PJ9A 5DURD 3WTVA 4AKQA 3TBSB 3EOAB 2ZSWB 4J4PD 3CFKA 4LL4A 3EYSL 1AQ8A 1HQRB 3EJYD 4NN5C 5JA9A 1RIUH 3KBHE 4EOWH 1VFMA 1BQRA 3UXFA 1I1CA 1JGVL 5TPWL 3WJMA 1AR2A 1XEDA 3VFGL 4IOIA 4XBEH 1A5FL 2ZWSA 4LLYA 5D7SL 4RMQA 1FNSL 4NERA 1QBMH 1DVUA 3L2LA 1F4YH 3L4ZA 4G3YH 3COOA 3H1ZA 4ANWA 4EZKA 3QQDA 4YSRA 4AGQA 3KD4A 3QUXD 1XF4A 1LD9A 5EIIB 1NIEA 1HQ4A 2ZOUA 4Y5XA 4X2UA 3AFLA 2XVGA 3B7TA 1MCBA 2KS0A 2F8OA 4ZQKB 1AKJB 1PGRB 3TIDB 3BT0A 1PX3A 1NUNB 3KVQA 3UAAA 3UIZA 2OS7A 1WVZA 3GSNB 2NNAB 5IMMA 5CD3B 2F15A 5EOCJ 4JKNA 1BDYA 4K9EC 1PF3A 2VLRE 2B1HH 1GZHA 3IPFA 4N2EA 4NN6B 3S3DB 1NZRA 1T1XB 3OV6A 5HI5C 5LLIC 1VPOH 4F2FA 4NFCA 1E40A 3QWOA 4WTXA 4XNXH 3UG4A 5ANHA 3STZA 3A22A 4QTIH 5EN3A 3MA9H 3QUMH 5CSGA 4CNIA 1WBZA 2VDPH 3T1FA 5I75C 3U2IA 3VFSA 4ALAL 1RZFL 4PJ6A 4Q56A 2DJMA 2KH2B 1IC0A 4NQDD 5DQDL 2KLSA 2VQ4A 2UXVA 5EB9A 1X4YA 5F9OL 1VGEH 3ECBB 3VH8G 4PCYA 4X0KA 3TN0D 4DPCX 5CEZD 3VRJA 3RPBA 3ALWA 4LDOB 3FUDA 1ZA6A 1J87A 4HFWB 3V52H 3FPYA 1UOVA 5EV7A 3IKKA 3N43F 2IANA 4HIHA 5EF0A 4TTDC 2OXGA 1BM7A 1YYLH 4WI8A 4MD5A 5EDSA 2Z7YA 4C56B 1Q0EA 3LNFA 4NO0B 3CVDA 2Q76A 3HVNA 4PLKD 4M5ZH 5ABDE 1T03H 4MB1A 3CFDA 4KJWD 4Z23A 1MVUA 2QVMA 5JIKA 4OCMC 3PV6B 3RVTD 1ZT1A 5AW0B 2HWZH 2VN3A 1ZDSA 2JNZA 5SWQB 5DRWA 4FL4B 3BXNB 3QDGB 3BUBA 4D9QD 1QSEB 3GSRB 4GMSL 2QKIC 4XMPH 1RJCA 3BDYL 1WZLA 1M05A 4F9LA 5DFVD 3GSUB 1XIWD 3MA7B 4NRXA 1D3CA 5GHWL 3W56A 4ZW3A 2EE0A 5FOBA 2R0KL 5D2NC 5DK0B 3SJVE 2YGVA 2Z91B 1JIBA 1KPVB 2IGLA 1WZ1H 4KJYA 2EUWA 1D2OA 2JKXA 2P5EB 3NZ8A 1T5KA 4LEOB 1WC7B 1A9EB 2YKKA 2W80C 4JFDA 3L6FA 5IVXE 1FZJA 3IRCA 2EXYD 4MJIA 4BA8A 4ZYKA 3IFOB 4PGDB 4WJ5B 1F4XL 4IDJH 2CM5A 5EO0A 1OCWH 4WY7H 3AY4A 2ZWNA 4AKOA 1QO3A 4OKDA 1U58B 5AOZA 5CU9A 3FYIB 4GG8A 1V3LA 4M1CD 4EI5D 3ARFC 3MLXL 5CJ8A 3NIFF 4P5TC 4FTVB 2XWJB 5MEQA 1WGOA 5EOQL 4BFJA 2IBBA 4KO6A 4N2GA 3BZ5A 4K8RC 1HHKA 1NGWA 1KCRL 4FI7A 1IC1A 4XZ4A 1G7QB 3QR1A 4X6DA 4Y5VC 3HW7A 3LZFL 3P69A 4H8PA 1NCWH 3H56A 1ZTXL 1SHXA 2AXFA 1KT2B 1T5XA 5MERB 3TBTA 3A67L 3S37L 1TZAA 5BRZA 4L2YA 3N40P 3RVUC 1H8NA 3EHBB 4JR9L 3PHOA 5I16B 1Z5HA 4Z5RB 1RZKL 2B20A 1DVFA 2DI9A 5DRXB 2GK0A 2W9DL 3GHBL 4JPWH 3OD3A 5C0EA 2FBOJ 3QAQA 5CZXD 3GRWL 1M1XA 1NCHA 1KXVA 5C2BH 1U4FA 3F3HA 1H3XA 1KZYA 5BO1L 4PGEA 5KVFE 4WW2F 3RY5A 4UNUA 4F7CA 3E3QE 3OKKA 1ACYH 4XC1H 3QUZA 4XBPB 1M7IB 4ONOA 5EU4A 4Y4FB 3VQMA 4EJ1C 3L4VA 3OHMB 4ZG1A 3FOMB 2VSCA 2XJKA 4MWFA 3PP4L 4GQ9L 1XX9C 4KQ4H 4LBEA 4PCKA 3SHSA 2C34A 4PJCA 1JHKL 3P4NB 4YHML 3PREA 1A7OH 2XQYK 4GW4B 3PF2A 4D9LL 5BMFH 4IU3B 3O2WH 2OBGA 4CVXA 1S5IH 3KW8A 3MMEA 4NKQB 3RWCB 3BHBB 3LV3B 2OMVA 3EIFA 3VYOA 4UILH 2A9ML 2YAOA 4KNTA 1N64H 2G9HA 4FQCH 1U92A 3L08A 5DO8A 5FCUH 3VXSA 4BEIA 4K5PA 4AGNA 4OKVB 4ACPA 1NC2A 3FT2A 2Y5EA 5C86A 2C4XA 2AMGA 3PHQA 1KG0B 4PJHA 1NAMB 1OSPH 2AQQA 2GG1A 3T77A 4XP5L 4R7XA 4K3JH 4YC2B 4D8PB 3SE4A 3EGDB 4UDTA 1KPUB 3GLEA 2FUQA 4NZRL 4ZSOB 5HI5D 5C1MB 2B1AL 4LVOB 4ORGA 5DD1L 4UT7H 1W8EA 2AQ3A 1A7NH 4OZHB 4Z7UE 1MVFA 3DUUB 1EFQA 1HI6B 2AEWA 5DZVA 3IK2A 4JGJA 1D9KA 3BGMB 3S4SB 3LKNA 4AEHL 1QFWL 5I0DA 1FV1A 4CMMA 3LRHA 4PRHA 2CCLA 1CVSC 4HF5H 2MEJB 3U48A 2GJ6B 1OAJA 3BSZH 1OAKH 3FQWA 5B3JE 1CE6B 3S34H 1SXBA 3VXNB 3CU1A 5DQ9A 1G43A 4ZFGL 4XOBA 4JQIL 4Y1AA 4N8UA 5L2KD 3BD3A 1I9RL 2OMZA 4WNQA 5CSBA 2IPTH 3WJMB 4UAOC 4WSKA 5FA4B 4N20A 3X14A 2D2OA 4LLYB 3KE0A 3OB0H 5ANMA 3DK2A 4LGSB 4TTDD 3AW5A 3F83A 3N42B 4H5SA 4U0QB 5AKRA 5AW9B 3O4LA 5E4OA 4HOWA 5K1VA 5H2BB 1G0XA 5F0LB 3QQDB 4QJ5B 1SBSH 4E9YA 5FK9A 1XF4B 4YXLL 2PW2A 3U2SA 4GMTH 2VDRH 1HQ4B 4Y5XB 3WTWA 2EILB 1NPJA 1TQCC 4X7FC 5T5FL 1NEZB 1GS7A 1HT6A 4YVNA 3LS4L 1D5XA 4F2EA 3TA3B 5AUMA 2E0PA 1IIKA 1HU8A 4L1TA 4I1PA 1JPEA 4PMFA 1JMXA 4ZOEA 3APNA 1GZQA 1NKRA 1Z9OA 2WPGA 4KO9A 4YNYA 5KUMA 1BFSA 5AVSB 3WN6A 4NAJA 3ZRFC 1ETB1 5D2LE 3NRQA 4DP2X 4XOEA 4F1SA 1FVCA 3GEWB 4QHKJ 3QWOB 1NGPL 5FM4A 2IH3A 3STZB 1EX0A 3OHXC 3E8VA 2IEPA 1XF3A 1KGYE 3NA9L 3KYMA 1UOKA 2M8XA 3UTSE 4CNIB 1WBZB 2CPCA 3T1FB 2XPGA 2VQUA 3H42H 3VFSB 1Q72H 4GP4B 3GUTA 3ARDA 1BQ5A 1YEGH 4XHJC 1J10A