3S0PA

Copper-reconstituted tomato chloroplast superoxide dismutase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
153
structure length
124
Chain Sequence
b'TKKAVAVLKGNSNVEGVVTLSQDDDGPTTVNVRITGLAPGLHGFHLHEYGDTTNGCMSTGAHFNPAGDLGNIVANADGVAEVTLVDNQIPLTGPNSVVGRALVVHELEDAGGRLACGVVGLTPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn], chloroplastic
publication title Biophysical properties of Tomato Chloroplast SOD
rcsb
source organism Solanum lycopersicum
molecule tags Oxidoreductase
total genus 27
structure length 124
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3s0pA00
1YSOA 2C9SA 1EJ8A 1U3NA 2VR6A 1XTMA 2WZ6A 3F7LA 1E9PB 1F1DA 5KBMA 2AQNA 3ECVA 4BCZA 1E9QB 2VR7A 1SDAB 1IBHA 3H2QA 4N3TA 3MKGA 1YAIA 1BA9A 1SXZA 3LTVA 1ESOA 2AQQA 1EQWA 1F18A 2K4WA 2VR8A 1SRDA 1SXSA 2Z7WA 2ZKXA 3GTTA 1BZOA 3L9YA 3K91A 1N18A 3KBEA 2GBVA 4OJAA 3T5WA 1SXCA 4N3UA 4A7QA 2WKOA 2SODB 2WKOF 4MCMA 2APSA 2XJLA 1XTLA 2V0AA 4BCYA 1F1GA 1QUPA 2Z7YA 5KBKA 3MNDA 1TO5A 4A7SA 1SXAA 2AQTA 1B4TA 1HL4A 3GZOA 1PTZA 3CE1A 3CQQA 2GBUA 1JK9A 1P1VA 2E46A 1JCVA 1DO5A 3KH4A 1SXNA 2R27A 5CU9A 4A7TA 3ECUA 1L3NA 1Z9PA 2WWOA 3HOGA 4BD4A 3S0PA 2ZKYA 1PU0A 2C9VA 2WYTA 1CB4A 1HL5A 4L05A 1AZVA 1OZUA 2WZ5A 3HW7A 1IBBA 1SOSA 2AEOA 1JK9B 2JCWA 4MCNA 4A7GF 1KMGA 1IBFA 2AQRA 1F1AA 2ZOWA 1MFMA 1UXMA 1OALA 2AF2A 5KBLA 3GZPA 3GQFA 1FUNA 1YAZA 2Z7ZA 1E9OA 1COBA 2C9UA 2WYZA 2LU5A 3GTVA 3QQDA 1N19A 4U4IA 3CQPA 1TO4A 2XJKA 2NNXA 3KBFA 2Z7UA 1RK7A 4OH2A 2ZKWA 1CBJA 1Z9NA 3ECWA 3RE0A 2GBTA 3KM2A 4FF9A 3H2PA 3KM1A 4A7VA 3GZQA 4A7GA 4B3EA 1SXBA 1UXLA 1E9OB 1Q0EA 1PZSA 3QQDB 1OZTG 1DSWA 1IBDA 3L9EA 3SODB 1E9PA 2AQPA 1XSOA 2JLPA 1OAJA 1E9QA 3F7KA 1SDYA 4A7UA 2E47A 2Q2LA 2WWNA 3HFFA 1OEZW 3PU7A 2WZ0A 1IB5A 2AQSA 1B4LA 1SPDA 3KH3A 1S4IA
chains in the Genus database with same CATH superfamily
4IOFD 3VI3F 1V5JA 2QSCL 3RVVD 3EHBD 3UMTA 1BQ5A 3GDCA 1AR1C 1ZVNA 1XIWB 2RMNA 5HDBF 5BS0A 2VDPL 4P4KA 3ZYOA 1EZVY 2Q3AA 3O45A 4U6HA 4JHWH 4LOUC 1SXZA 5DHVH 3MRPA 2FAUA 3VFSA 3CCHB 1PG7W 3BPNB 4BUGA 1CGVA 1FYTA 1W0WA 4K7PH 4MB4A 4K9EL 1O7DE 1EERB 3KR3H 4AOFA 4YSTA 4XBPA 3UEZA 1MRDH 2DEWX 4FEMA 4LSVL 4O51B 4OJFH 3VGEA 4OFQA 5KTEL 1WICA 1HDMB 1Q8MA 3K71B 1KC5H 3PWVA 5F7DA 5FKPB 3K2UH 4NFDA 2XACC 1S9XA 1FAIL 2R2EB 3CPLA 3KVPA 4M6OH 4N0YL 4Y5XA 4IRSD 5CBAA 2E4FA 4KZDL 3BEWB 4ZXBC 3RZCB 3WL9B 5IB4A 5E99L 1L0PA 3CSFA 3GXMA 4PH8A 3FFDB 4ZZFA 4DGYH 2VLRE 4IRZH 4ZX6A 4LE8A 2ZKYA 5I1KH 2CIIB 2AMUA 4YDMA 3QDGE 1N5YH 1B0GA 1OHQA 3NAAL 5EOTB 4J3OD 4R2GD 3K2IA 5DHDA 4FQHB 2J44A 1QKZL 2G5BA 3BO8B 4QRSB 2EC9U 4AIZA 1VCAA 3GSNB 1RMFL 1MFMA 1TUPA 2CSPA 4LPCA 1AC0A 1TMCB 3VXTB 2IDTA 4QR7A 4AG4L 2LU4A 4M1CC 1KGCE 4OGAD 4FKEA 3ULUF 1A02N 5C7XH 2LT9A 3VVVA 1LM8V 2ZCHL 3RIAF 4JL2A 4ODTH 4HGMA 1XF3B 1HL9A 2Z92B 2QSTA 3L95A 3LNHA 3F65A 4HOXA 3IMTA 5I5MA 2FO8A 1WUNT 2Z31A 3L2NA 3SKNB 4AKOA 4G82A 2YD4A 4NKIH 1KWKA 1J5OH 5F7AA 4OZFG 1SXBA 3SOBL 2CKNA 3VWJC 1FVCA 1QMUA 4AM0B 5JIKA 3EFOB 1QBLL 4LASL 2C34A 5D1ZC 4B9JA 3TURA 5J9PA 4DGVL 1TU2B 5CR8A 2RQ8A 2MTPA 1IIIA 3ZN6A 5JOFA 1KIRA 1JS4A 3T04D 5E94A 4H1LB 1CT8A 2ZX6A 3P3SA 5DS8A 5I71B 1E4JA 2F58H 4Y88A 5GZNA 5GGVL 3TYFB 1U41A 3WD5H 1G7QA 2WLIA 2AANA 3O2DL 3TXAA 4CA4A 4N2EA 1EUTA 4PJ7E 3L9RB 1JRHI 2ZUYA 1ZHBA 3LZRA 2EVFA 4PREB 5EA0L 3WS3B 3FQWB 4PUBL 1F3DH 2FQGA 3QNXB 5C92A 2K78A 3HC0B 4ELMA 1DQVA 1RUAH 1Q0YH 3B2UC 2XZQL 5TQ0L 4ERSH 4NZTH 5DC4B 2J1WA 5I1GL 3HE6C 4NM4H 3BGFC 3P73B 1OB1A 2KLTA 4HXBL 3GXTA 3H0TA 3KJ4C 3M45A 3QI9C 4KVPA 4LSRH 3T0AA 3OKLB 5LDUA 1VCBC 1MY7A 4LNRB 3EGDA 5EFIA 4HUMB 2D4DA 1BHGA 4ONHA 3AITA 1CFQB 4Y4FC 3F05A 3BPLC 1U8OB 1G7LA 5FA3B 2OYLA 3ZXAC 4G8FB 1JV5A 3B5TA 2WWMC 1E7VA 1CL7L 4ZUSA 3KS0J 3NBNA 5IEHA 3DOSA 1E8XA 1XSIA 3QCUH 4MX7A 4J3TA 3JVFC 4FCAA 4M3JA 4UQ9A 3R06A 4Y16D 3GMLA 3GNML 3LMJL 2NY6B 1I1AC 2APFA 2CHDA 2YGOA 1XD1A 3GO1H 3PLYA 4FQQA 1Y0LA 3IDMA 1VACB 1RHFA 2XPGB 1ZHNB 5A2JH 3BP5B 4GIAA 3HUJF 2YFOA 1P5UC 4M8QB 2IPKB 4V2CB 1IEBA 4N1HB 1U8LA 4XN7A 1M05A 1A14H 5CMAB 3ILQD 4CN4A 4J1UB 3AABA 5IB1A 2VR9A 1ZEAL 4LSSL 1M7XA 3ZT6A 2VN6A 1MF2L 5D70L 3JWDL 5LAPA 1H3GA 3SGDI 1ZJBA 2VRKA 4X6CB 1IGMH 2VDNB 4HJJL 1ZA3B 4UB0H 4XHJC 2BSTB 9PCYA 3OGCB 4LCCC 1JUFA 1P9MC 4F20A 1M9WA 3HPLB 3WELA 1LO4L 4I9WE 2ADIB 2OMVB 2VN3A 5EC1A 2R4RH 3IFNH 4QRRA 3F6LA 5D1QD 4G6KL 5HD8D 2D7OA 5KYYB 2JI3A 2NZ9D 4JQVA 2OA9A 2GTWA 2JKXA 3Q2CA 3UC0H 2GHZA 2HJKA 3QS2A 3TF4A 1J05B 5EU6D 1INQB 1U33A 2VZ3A 4N8VA 1S7XA 5K59E 3V4VL 3EGSB 2V37A 3QEHA 2FEDC 3S3BB 1J0IA 4I3RL 3OR6B 2J21A 1EANA 1WT5A 3MJ8A 4JB9L 1X4YA 1KEGH 2AXGB 4YLCA 4PJ8C 3WLBB 5B39G 3NGBB 2OMYB 5EH1A 4N2NA 1N8ZB 3X11A 3QEQE 3R19A 4IKKA 3GSQA 2EICA 3M7OA 4I5BA 4JPVH 2JQZA 4JO4L 5I8OL 4P4KB 3JUZA 1JPEA 3O45B 3LRLA 4HQQH 4MA8L 1NCGA 5JW5B 4U1NB 4M5ZH 1D2OA 3SE6A 1FYTB 1W0WB 4I18A 5C0GA 1MN4A 1VPOL 1A7PH 4XBPB 4F2ME 4OT1H 3N85H 2EKSB 3P2TA 4PCKA 1BGXH 2ZSWA 5F7DB 5T3XE 3FO0L 1WD9A 1ZRUA 2V3EA 4CJ0A 1S9XB 3CPLB 3WNOA 3LRGA 4Y5XB 4L05A 4LSTL 1D5IH 4KI1A 1NWOA 2X42A 2OZ4L 5I66A 2VDOL 5CZVL 4IM8A 1YJDH 3FQRA 1FNGB 4KK5C 4JFEB 1WCBB 5H37A 5IB4B 4Q0XH 4HJ0D 5KBPA 1PD6A 1KMGA 4HPOH 5FYKD 4MXVE 3NP4A 2GK2A 1KJMA 3MRKA 4I0PC 4LP4A 2I5YL 1XGYL 4WWID 2H2PC 3BLKA 1YAZA 2OAAA 1B0GB 2PW2A 2EJ1A 3GRWL 3WIIL 3KPMB 3OSVA 3BPCA 1QAWA 4ZMPA 5CJXC 1KY6A 4AIZB 4N2FA 4WUKH 5AZEL 3TBTA 4UQAA 2RBLA 4NCC2 5CINH 4F92B 1WP6A 5L88L 3P4NA 5FA4B 1YEJH 5T3ZE 2BFVL 4FQJL 5DF0A 1VKXA 5JTWA 2KC0A 3HB3B 4M93B 1PZSA 2FD6L 4WI8A 4BDVA 3AQDA 1JGLL 5KOMC 2EDYA 3NSJA 2HRHA 4M7ZC 2H26A 3VXRA 3MUGA 3L95B 4UQBA 3QNYA 4XVSL 1R4XA 5HHQB 3RWHA 5T1MA 4Y5YA 1B4LA 2ICWI 4A2HA 3GSRB 4WI6A 3KYNA 1GGCH 1FVCB 2G75B 3SDXA 1ZLDA 5KSBE 4J6RL 1YEHH 1OAKH 4NUQA 5B3SB 5HI5C 5E1HB 4XE5B 4KJPC 4QRTA 4Y1SA 1FYHB 2HRPL 4PJAF 4N3TA 4P5TC 5EUOF 2FWSA 5JOFB 4AUUA 2XDHA 4KDWA 3UO1H 1C8QA 3VH8A 5DS8B 3O9WC 5I73B 1SXSA 1CGSH 1OCWL 4ZNCD 1L5GA 3D33A 5DZNA 4G8IA 3QDAA 2PMZA 2ZJSH 4Z7VA 1G9MH 2JCCB 3UTTA 1NDGA 3RG1C 3OC5A 1KIUA 3SPVA 3MC0A 4YXHH 4ADGA 4MCMA 4GUCA 1CFVH 2O6FA 1ZHBB 3DIVA 4A63A 3CFCL 3OXSA 4I1RA 3Q2NA 3WHXA 3AROA 4GB9A 1BZ9A 3EAKA 5H94A 3BIAX 4ELMB 2JELL 1QBAA 2C4FT 1ITBB 3DNKA 3RWJB 1TYRA 3S5LA 1WGVA 3IRZA 4N20A 1OB1B 5TDPA 3H0TB 3QUGA 4X9GA 5CU9A 5CEYB 5ISZD 1DJSA 4I87A 2P26A 4L4TB 3IMBA 4M29A 3VCLA 2CJTA 1IBZA 1KBKA 3EGDB 1W6LA 4JQIA 4URTB 5EFIB 1NAML 3C9NA 1W0VA 2D9QB 1OTSD 3PIQA 1G7LB 1OAZL 1YMME 3IJ7A 1BQLH 1NUFA 4DP4X 1F6AA 2F0CA 2XRAL 1UH3A 4P2RE 3PXHA 1V8HA 1FNAA 2TRYA 4WO4A 3EJRA 4YDKH 3DOSB 4NGHH 5IEHB 1MJJA 2YAEA 3ALXA 3KYKH 4MX7B 4QTFA 4M6MH 2Z6FA 2QDVA 1U6AH 1EO8L 4WCYH 5IG7B 1KDIA 4S1SH 1LL1A 5GSVB 3QUML 1RUMH 3S9DB 4OM0H 4MZRA 5JQ6H 3AJ7A 3N1MC 2Q8AL 4BK5A 5HHMB 1Y0LB 1CBJA 2V5MA 2WBJC 4HU8A 4NPYB 5FO7B 2W0KA 2OMXA 4OZFH 2GUOA 3APDA 4FNPA 2F6AA 2DQIL 3MA7A 1MUJB 1OGPA 1IEBB 4N2DA 1W0YT 4U0RB 1DLFH 5T5NG 1U8LB 1M05B 5A2FA 1EV2E 4GRLD 4YXKH 1ZV9A 5HXMA 3U0PB 1RSYA 1KTDB 5IB1B 1TR7A 5KJ4A 5E6YA 3OG4B 4JDTL 5DFVD 5BUGA 3B7SA 4JQXA 4LK4A 3TA3A 3ZDYF 4G8EA 5FUZL 3RWEA 3FB7B 3Q8EA 3ARGD 5AW5B 1K5WA 5DO2C 2NR6D 4NNYA 1YEFH 3SSGA 1NBVL 4A55A 3CFKA 1E6OL 1WHPA 4PJHF 5GISH 1HINH 4YO0B 25C8L 4PJFB 1J8KA 1X9QA 3JTTA 2EO1A 4HWBL 3TOPA 5BOPA 1FE8L 2HCZX 3QT2A 4IU3A 3TJPA 1JI2A 2EAEA 1JUFB 4PIRF 4OAWA 3GSVA 4KX9A 2AV1A 3LRSA 4R4NC 1KT2A 5EC1B 2H3XC 4PQXA 3QUHA 4MD5A 4PJCB 2F15A 1OGSA 4BRJA 4Y1AA 1FIEA 5HDLA 4PY8I 1IAIH 2Q7YA 4OFIA 3P4MB 2HJKB 4PP1C 5DRZA 1KPVB 1JHTA 1S7XB 2E74C 4N8VB 4X5XA 4QO1A 3V4VA 4OZ4A 5GGQL 1GGIH 1G4RA 5T5FA 3MJ8B 5I18H 4G7QB 3QWNA 5F1OB 5IWLA 3NRPA 5C2UB 4IOSA 4ZTPL 3ESVF 3LEVL 2HT2D 4OD3L 5CO1A 1K4CA 4XNXL 3GBNL 3GSQB 4NO5A 4APQC 4BZ1H 4TNFA 2PCPA 4I5BB 4ONGH 2EXWC 1HE7A 2F7QA 2OL3H 1ZHLB 1WGOA 1RZIA 2XTJE 4UAHA 4Z78A 3FOMB 2YPLE 1WAAF 3NQKA 4FQCL 2D3LA 3VX0A 5DC2A 3S3CB 3DTDA 1NAKL 1A6WL 2FIKB 4I18B 4HF5L 4LIQE 4ZUVA 4OIIL 4Y2OB 2EIEA 1N6QL 1AFVL 2BOBB 1J8HA 1AQMA 3OPZL 2RALA 3TBYA 2FO4A 4F9PA 2ITFA 4UT9H 1NMAH 1A9VA 4QYOB 2FLMA 2Q7NA 1LLAA 3F7RA 4XP1L 1KXVC 3NCCB 2IWEA 2ZSWB 3ESPA 4QJ3B 4CVUA 4PJ5B 5FS5A 2VAJA 1OSPH 2MCMA 4X6CE 5I66B 1COBA 1U8PB 1OOAA 4K71B 2KKQA 2LU5A 4PR5A 2D7NA 2DLGA 5IW1A 1HHKB 1BFVH 3M1BA 2CM6A 2EACA 2VUYA 5DT1L 2OZ4A 3POCA 3X1GA 4X4YA 4YWGL 5I8KH 5ALBL 4XCEA 4HCIA 5D93B 1KJMB 2D2OA 2Q2EB 3NK3A 5GS0D 1ET8A 3U7YL 4NCC1 3WU1A 4YL4A 4XP4H 5JA9A 2CPCA 2EQDA 2I60H 5IHUL 5B38A 1P7KB 2VM3A 4HHGA 4OLZH 3NJIA 1ZMYA 4HCRH 4F27A 3BWUC 1V3KA 2Y23A 4Y5VB 2P3YA 4C8XA 1MCJA 2YLHA 5C08D 3P4NB 3PABA 3QDHA 3WEBA 1VKXB 1Q94A 2W0LA 4XMUA 3DVNA 4BDVB 3E80A 2OPCA 1CCZA 3H9SA 3IWVA 4L48A 2H26B 4N28A 5BS0E 2QTEA 2JMRA 4JFDD 2X4PB 3RWHB 2YRPA 3FQUA 2MH4A 4J3WA 1Z9LA 3LX9A 5T1MB 5HYFA 4OKDA 1Z7JA 3WHE1 3R8BB 3EBAA 1AQ8A 2DMGA 3GRBA 1T89C 3KYNB 1ED3A 4K7FA 4KMTL 3SJVD 1N4XL 5IQ9A 1H15B 3QPKA 2J7LA 4QRTB 1FWXA 1L7IL 1E4XL 1TTAA 1WZMA 1ZV5A 5L6YL 1A3LL 1KCVH 3IJEB 3RWCB 2W91A 3O6FB 2IEPA 3VH8B 3WNMA 1L5GB 3RLSA 1CD0A 4EN3A 5DYOA 2XG4A 4G8IB 4GQPH 1PY9A 2KL6A 5AVYB 1OAUL 3UTTB 1KIUB 2OI9C 3SDDC 4NX0A 2Y22A 4NXKA 1YPZA 4EDXA 4UT7H 1WZAA 3WKPA 5PAZA 1A4JB 4I7ZC 4N9OB 2ZAGA 5ANMA 3WHXB 1NEZG 2D7TL 1BZ9B 1BFOA 5H94B 2EIJB 4YHOH 1DVZA 3HFMH 1CFNA 3DBSA 4X4MA 1D5ZA 1PL3A 5KW9L 4M7LL 5EEYA 1AHWC 3ZY7A 5KAQF 4OKVA 3S5LB 2K4AA 2IAMA 2PTVA 1RP8A 3HE6A 1HAUA 1BBDH 5TDPB 1U8CB 3B83A 1P7BA 4UV4H 4IBLT 4BSWA 3BDYH 3VCLB 4R8WH 4MYPA 3SO3B 3OKMA 2YEQA 2W9DL 4NHUB 5F0LB 2B5IB 1S3KL 1W0VB 4ZMXA 3NSCA 4HK3J 5B21A 3PIQB 3NJKA 1XF4A 5BZXA 1SYSA 2YGVA 3A6CH 4Y4FA 2I24N 3RDTC 3ZJAA 5CUSH 1WV7T 4XPGL 3QH3B 2FX8H 3V5DA 3VG0H 1JD9A 4X4KA 3W2DH 4Z3GA 3TZVA 2X9WA 4XVJH 3QUXD 4NLAA 1CLZL 3VSQA 1CICC 1LEGA 4JDZB 1KZQA 5FHAL 1MCKA 4N8PA 2IFFH 1N0LA 3QUMA 4GMTL 5HJGA 3HLKA 4ZFGH 1ZD6A 2LLGA 3QJHA 1JZ4A 4G8GD 1MQKL 1YYLL 3ZU8A 1A3ZA 5GGUA 1DDHA 2Q7AA 2OMXB 4KV5F 2GUOB 1UM6H 3TA4D 1P5UA 3MA7B 2E76C 3WKML 2QHRL 2AJXL 5E23A 5AAMC 4PJBA 4Y19A 1HI6B 3L8QA 1OE1A 3VMNA 4MAUL 4OLVH 2J88H 4KROB 4UDUB 3TA3B 4G8EB 3RWEB 5JO5B 3L4UA 2C1PB 3WNNA 1ZVSB 4H0IA 4NNYB 4R7NA 2BCKA 2HFGH 3HAEB 5MERA 1F18A 3CFKB 1OCRB 3TIDA 4NLHA 3TPUA 1KBGL 3T1WA 4Y0GA 4E5XA 2QFRA 2YD5A 2DDQH 3HI1A 4ZUUA 1Q0XH 4IGBD 3VU1A 3NIDB 5F9JA 5GRZA 4TVPH 1SXCA 4HWBA 4IU3B 4HC1H 5LCVH 4OAWB 1F3JB 3GSVB 2AV1B 4LCCA 2HWZH 3LRSB 1IT9L 4XPTL 5F72S 1KT2B 2XA8H 5E9DD 4MD5B 1T6WA 1PZDA 5JPMC 1MFBH 5GGTL 4Y1AB 5E6UB 1QWHA 4GJTB 3CVIL 4PJEF 4NQDD 2AEWA 4MXWL 3K6NA 5KUMA 4FNLH 3VXOA 1JHTB 2KYIA 2GQHA 2VH5H 2VAAA 1JCVA 4DTGL 4QO1B 5BMFL 1AHMA 5EBMA 4H8QA 4P2QD 4NUJB 2ERJC 3MV7D 2OK0H 1UB6B 4JRYA 1PX3A 1U8QA 3AQXA 3N44B 5EF1A 3RYMA 2BNUB 5DDHA 3K6FA 3JYBA 3WTSA 1WF5A 2VXTH 3QQ4B 4O58H 4DP9X 2PCPB 5HI4D 4NWUH 5HHME 5ERWA 4Z78B 1RZIB 4ALAC 5DK0A 2DD8L 3C6EA 2AQRA 5HI3D 1QTYT 3ULVH 5C0JB 5DURB 4EJ1C 3STZB 4F9LC 1PKQB 3L3GA 3QJZA 4N2LA 2PP8A 3DUHA 3S2CA 2WY3B 2XWCA 4F37K 1WJ3A 2IIJA 1RZ7L 1NIBA 5DK3A 3SYPA 3NIGF 3T3PE 3SKOB 4ORGB 1J8HB 4E9QA 2FO4B 3CPUA 1M53A 1LO0L 1NL0L 4HJEA 5DJ8B 3SIKA 3J7HA 3VGAC 2XKNA 4LB8A 1NSNL 3F01A 1R9FA 1Q9KB 4Y1TA 2X38A 1QLFB 3HMXH 2UY7A 4M8UA 2YA2A 3HHRB 5L8LB 1BM3H 3W1ZA 4WI7A 4PR5B 3U9PL 2XZAH 3M1BB 1TZIA 4X4YB 3N1FC 4FQ1H 2E9WA 4XCEB 5E9AA 2NQCA 4QRRE 1PGRB 3CZFA 4G6FB 1S7QA 4ZAKA 4H1LG 1DQLH 1XL6A 3DI3B 4LHQB 1IQDB 2ZCLL 1NKRA 5T1DL 5TJWK 4N6RA 2PR9A 3JSSA 1TDQA 1TQCB 3UAFA 4AUJA 5E2TH 5C0CA 5DSCA 3SQRA 1A21A 1QZNA 2HMID 4P2OB 4Z7QB 3FL7A 2AEQL 3LEXA 3RTQB 4CVXB 2FJFA 3LPOA 5LNGA 5CJXA 1UUSA 5EWIH 1XF2A 3D4GA 5JMRA 1R5VB 2GJ6E 1BQSA 4Q7DA 4FKHA 4BFFA 2KT6A 1AY1H 5L7XL 1MDTA 4LARL 3PABB 4QWWD 1Q94B 1ZE3C 1QFWH 3QQ9C 4NWTL 1B4JH 1IILE 3IDJA 4XMLH 4AGOA 3H9SB 3Q8CA 1U58A 4PHZA 1I9IL 2EINB 4GFXA 2QLYA 2YPVH 4I0CC 1NICA 3LIUA 4JVPA 1E3XA 2XBTA 4RGND 5DMIH 1D5MA 2PXYD 1ZANL 4JVWA 1JV2B 2OJZL 1MFVA 2PO6D 4NIYE 4KMQA 1CFSA 5JR1H 1FPTL 3S88L 5IJCC 1PS3A 1BJMA 3D0LA 1ZTXL 3ARYA 4OLWL 4EUPA 5LBGA 1RIVL 5C9KA 1QWNA 4OLUL 1W8EA 3CDGA 1IM9A 3RNQA 4S1QL 2CMRH 4IBZA 1ED3B 2CXKA 3MOBH 5K9KA 1KELH 1PEZA 4PJ9C 3KXFA 1CGXA 2EIDA 2IV9A 5AAWA 5ADPL 4WENB 1RUQL 5IQ9B 3ETBF 1ZLVH 2EH8L 1F6LL 2L7JA 3N06B 3NZ8A 5DJZB 4KKZA 3KPSD 5DWUL 4JRXB 2YLKA 4BQBA 3D2UD 4FA6A 3O9WA 4EN3B 3KYOA 1KTRL 2XG4B 3ZR5A 3MREA 4XBEL 1ASQA 2VXQH 8FABB 2EDNA 3LKOA 4FFWD 1FNSL 4KFMA 5F0MB 3UJTH 1RPUA 2O5XH 5I76B 4WUUD 3ARFA 2I85A 5IMLA 5DD0H 3DSFH 1NLBL 3IE4A 5HGBA 4NIKB 1OALA 5D4HA 2VMFA 2ODHA 5ANMB 1SMAA 1BFOB 1CE1H 4G6AD 4F1ZA 2CAKA 1CFNB 1T22A 4LAQH 1NJ9A 2H8PB 4NRZB 5FDYA 3ELQA 1D5ZB 4FXTA 3EOTH 3HNVH 1CK0L 1E7UA 2BW5A 4FXGA 4LDLB 4OKVB 4FFYL 2AQ1A 2IAMB 1QSFD 2LGNA 4YK4B 3L1FA 3R0NA 2VZOA 3BT2L 3HZKA 4BSWB 4BGDA 1XD0A 5J56B 4RIRA 2J1ZA 1IC7L 3OKMB 1HKLL 3B37A 3KGUA 5DHYB 3SE8H 4YUEH 2W38A 4G71B 2PWHA 4JY5L 3EYUL 1XF4B 1SYSB 3VXRE 4NOBA 4MDIA 2XWBA 3AY4C 3X17A 2NSMA 1EJFA 3ARDD 1WPCA 1HOEA 4P2YA 3ZZQA 1JPTH 1Z3RA 1NFDF 4UNTA 4WW2F 3OMIB 2GIMA 3K6OA 2XPZA 2Q86A 3Q43A 4LRNH 1AE6H 5E8NA 4OZIF 3GKWL 4UQEA 3V7MA 1WIPA 3HS0B 3EO0B 4B5ZA 3SDXE 4NDMA 3TZVB 2ZCKL 3DUSA 4HMDA 1IRAY 5IHZA 1LEGB 4E2OA 2X88A 5J4MA 1KB3A 2MCPH 1NCHA 1EEZA 3M07A 4JPKH 2ZXEB 4QY8A 4B3VA 3QJHB 4IIZA 2B1AH 4IK6A 2NY2C 4DZ8A 4LVHB 1YAIA 3O6MH 3BSHA 5GGUB 5EZIH 1DCLA 1DDHB 1UXSA 2NYZA 4G2AA 1N64H 2YD1A 3QJUB 3EJZC 4OCYL 1T66C 4JM2F 4Z7VE 3TYGH 4QHNA 1N3NA 3UTTE 1DQDL 2BW4A 2VLRD 3E8UL 2X4OB 3VUAA 1ZSHA 2AXFB 1HSBA 3QDGD 1OVZA 1XWVA 2BSED 3A3YB 4N4YB 2AJVL 3ARPA 3GI9L 2KZWA 2NSQA 4R7XA 3T08A 4HWEL 4PV1C 4E5XB 1G7PB 3HI1B 4I2XE 2AJZA 1LD9A 2NY3C 4ZD3L 5FUCC 5DVLA 2NUPA 4W9ZA 1J5CA 1IAOA 2A4ZA 1XGUB 4EZJA 3LZNA 3SGJC 1Z9SB 5DFWH 3VVWA 5C9JA 4LCCB 3LPFA 3ZO0A 2D31A 3L16A 5E1IA 4YL9A 4JPIB 2OMWA 3HG1A 2ZD0A 2GI7A 4OCLC 3OLGA 4TLTA 2X2JA 5FLVA 4Z9KB 3VXOB 4JM2C 2VAAB 4PRPA 5EBMB 1TITA 1XH0A 3F7VA 2H32B 1PX4A 2AQ2A 3V0WH 5JIIA 3WNIA 5DD6A 4U1MB 1UT9A 4UIKL 3IFLL 2QADB 4FG4A 1TZOA 1HXMA 2AEPH 4JRYB 1LNUA 4MB1A 1AYRA 1U8QB 4H25A 2X12A 4OV5A 5T8IA 5JW4M 4K94H 5GS2D 3X3GL 2OR7A 4KQ3H 1WO2A 3FHEA 2PCXA 1TVBA 1X9LA 3WIFA 5SWSA 1VLXA 1W6WA 3WLWD 5L0QC 1MSPA 1F90L 3FFCA 5ERWB 3IMUA 3MBWA 4ALAL 4HZ1A 5DK0B 1QWUA 3H4FA 4WKXA 3UTPE 4XTRC 2HG5A 3N55A 1OTUC 2BRRL 3MRLA 3R1GH 5CXPA 4AY0A 5AW8B 3GC3A 3KM2A 5B3NA 4WF7A 1EUUA 3WUWG 4Z7NB 1A7RH 1GKEA 4OZGB 5BO1L 3WENA 5I1HH 3GYRA 4YX2L 3GIZH 4X6FA 3SODB 4CMHC 3I50H 1A7QH 2ZKHL 3EYOB 1SDYA 1AIFA 4ORZC 4LDCA 4Z23A 4LSPL 1M7IA 1O7SA 4WJ5B 1ZDQA 4BCXA 2Y4SA 5ITFB 2UY7B 3A67L 4LEXH 1S4IA 3FW6A 5KBDA 2Z0BA 2QV2A 2Y2TA 4H8WH 4EEEA 3VTMA 3GMMA 3QZWA 4UM9A 1TZIB 3IWUA 4XMPH 3BLBA 3ZSTA 4ZMNA 1JGVH 3IDNB 1E2WA 4TV3A 1P84J 3DUUB 3BQUD 3GFUA 3I84A 2JWYA 3CZFB 5DU7A 1S7QB 2FT8A 4Y1AE 4ZAKB 5AW1B 1NQBA 1AXSA 1A66A 4QRFA 2JJTA 2WVSA 3EH2A 4AV4A 5DSCB 2AK4A 3P0VL 3FU3A 4HKXA 5HHNA 1BQUA 2K6WA 2WXLA 1R33A 3FCBA 5EHFA 5TF0A 1LP9E 1KGWA 5DC9B 2XI9A 3N04A 3DJZA 2FJFB 1JYWA 1UYWL 1G9NC 1XF2B 3ILEA 3T77B 3S4SA 2VO8A 2V7NA 5I1CH 2FWLB 4HGWB 1SMDA 2CK0L 3NEOA 5D2NB 4YN3A 4JG9A 4PLJC 4X2UA 3KWUA 4B95C 5IVXB 1A3QA 1FNFA 2VM9A 3OZ9H 4KGLA 3DO4A 1Q90A 1JK9A 1MXGA 4J27A 3N1QC 4N0UA 3RURA 1M6OB 4WEUD 3L3OB 4M7ZB 1D5MB 1NCDL 4K7PX 5IVZB 4ZUWA 2NY4D 1CFSB 2BCMA 2V9UA 3D0LB 3C87A 2C9RA 4EUPB 5JIQA 1PZ5A 1KGUA 3QXTA 1CD1A 3CDGB 1IM9B 4KQ4L 5AB1A 1QRNA 4MMXC 4OCXH 4POZC 1J8HE 1T89A 1BJ1J 2AEOA 3DETD 3KXFB 3PDDA 4JGUA 4QYAA 3NZSA 3NOIA 1R3IL 4C4KT 5I1JH 4WGVB 3ZTDC 3GSNH 3V5KA 3LS5L 4XC3H 1CI3M 4F24A 1UFUA 3NZ8B 1X9UA 2O5YH 2A74C 2WQWA 4OLEA 4QHLB 2R2HA 1KN2H 3LKPA 1L9OA 1U92A 3CFJB 5SWZA 3V52H 5D7JA 4X4XA 3MUZ1 4U6YA 3KYOB 4F37F 5I2IA 2Y36H 4DVRL 3WV0A 4O2CA 4I9WD 3MREB 4XP5H 2EUXA 3CQPA 3SDYH 4JJHA 5DGQA 1UGNA 5F9OL 3ARFB 1S5HB 3SDDA 3KLHD 3G08B 5HGBB 3K2KA 4W4NA 3CDZA 2WK2A 4JG1L 3CWGA 4J3OF 3KWVA 5D5MA 4P9MH 5C09A 1NJ9B 3BWAA 4BV1A 2ODIA 3VA6A 5J12C 3QB7C 4QRPE 5TGBA 5J6GA 4YSPA 4M9PA 2H6UA 4FXGB 4GS7B 4MVBD 2D2CC 3HNTL 3O0RH 4XNUH 3W37A 3HZKB 4UV7L 1YEIH 4HBCL 4H1LH 1AXTL 4RIRB 2AQSA 1DJIA 2Y5TA 4U7KA 2ZXGA 4XC1L 4BZ2L 1TTFA 4XRCA 1ZLSL 4ZMLA 1ZGLM 2P47B 3H9SE 4KY2A 4MB5A 1TJGL 5LKNA 4PBXA 3U83A 2DTSA 4NZRH 3L13A 5DD5H 3D6GA 1JGEA 1G6VK 2CJUH 3K4DA 3T4AA 1DL7L 2AFNA 2Z8VC 4FLQA 3I9GH 5E8NB 3BVXA 3MXVH 1BA9A 2E7BA 2AQQA 4FLHA 5F6HI 4NDMB 4TVUA 4BSVA 1JPSL 2H0PA 2H1PH 4HV8B 5EZLB 5IHZB 2OJ1A 1TNNA 4LLAA 5T3XD 4J3OC 4R2GC 5IVOA 3RX7A 5FYKU 3ZBMA 3EFDH 1R75A 4QY8B 3S35H 2E5EA 1RULH 2DKUA 3QUYC 1IKFH 4FFVD 1IC4L 4AQ1A 1QEWA 2WNXA 2XLLA 1TTBA 1UXSB 5E6IA 5JOPE 2XQ0A 5ECJE 4G1MA 1T21A 4FI8A 2NY7H 1BQHA 4QHNB 4AITA 1N3NB 3NESA 1MIEH 4QKTA 3TFBA 1U2YA 2P44B 1YPZE 3FPXA 4JFZH 4Z7OB 5ICYB 1HSBB 1E4WH 3MX0B 1FVDA 5ANME 4CSTA 3GPEA 2BP8A 2PABA 3OJMB 1AP2A 5EEVA 4GBXD 1JZIA 1S7TA 2VMJA 2P24A 2XX1A 1CTMA 1TQVA 3BHBA 2AJZB 1LD9B 4XOAA 2DMBA 2NUPB 4WWKD 2EDMA 4RAVA 3V9EA 2E7DA 4QRUA 1IAOB 5CN1A 3VA2C 3MA9L 5T3ZD 4CSZA 3K1KC 5JIHA 4K3EH 2YD0A 2VDKB 4NJAL 3M8OH 5C9JB 2HTLD 3PAVA 2VNCA 4NQVB 5D4QA 1U3JA 4NNPH 3CXFA 2NY1B 2OMWB 1R3JA 2VXUH 3D50A 1URZA 1WZ1H 3RAJH 2HRGA 5JPMA 3PY9A 2YMXH 2BIIA 1LEIA 2CWRA 2D3VA 1QSVA 2LE9A 3O3DB 5BNXD 2VW7A 4M62H 2ARWA 4PRPB 5H37G 3KW8A 3QWRA 3OKNB 4KKLD 4IU2A 1XB6A 3NA4A 5I1DB 2BJML 3F7VB 1F42A 3AG3B 5DD6B 2W60A 1HXMB 4M1GH 4PJ6A 1LNUB 2LVCA 4OV5B 1ERNA 3H2PA 4YVNA 4Q9RL 5KSAC 2VDNH 1TVBB 5SWSB 2BY1A 4IIQC 1IX2A 4NN5B 3KPRB 4GXVL 1SLUA 3FFCB 3MBWB 1XCXA 3P2BA 4GW5A 2HG5B 2CKBL 4JFQB 1IKOP 1LYQA 3MRLB 4TUKH 3RZCD 2AHIA 2GEQA 5AW3B 4EBQH 2R51A 2I32A 4ENEC 3LXAA 3LKSA 3ZE0E 4PJBE 4Y19E 3T0XA 3PV6A 2VXSH 2B7DT 2EZ0C 3JWNG 3K46A 3PPSA 3HC4H 1IM3D 3ZYIA 4X6FB 1ID2A 3ARZA 1FC1A 1WA0X 3O2VH 1XGRA 5CP7B 1AIFB 3BKCL 3QJVB 4Y4HA 2CA4A 1CF8L 4YHZH 1ESOA 1RLWA 4OF5A 1T1XA 1QO3B 2Q3ZA 4RFNB 2HT4D 1RCYA 1Q72H 3GMMB 3QZWB 4LFHD 3HZVA 3SKJH 4E9VA 5E5LA 4GSUA 4ODVL 2WKOA 5JQIB 1ACXA 4X8XA 1T7WA 5SX5K 3LH2L 1JZDC 1YMMD 3QDME 4GRWF 3VH8G 1GVIA 1AXSB 1QFUH 2GK0A 1V05A 2G60H 5D2LA 5I17B 2AK4B 5JDSA 3SN6N 3FUFA 4P2RD 3H7LA 5DQJA 5EU4B 1ZA6A 2W9EL 3CMOL 5HHNB 5T1KD 2DM7A 2E46A 4YPGA 3IVKB 3TS8A 1K2DA 1RQ5A 1OF2A 1OK8A 3OAUL 4C54A 4PCTA 4Z76B 4D0CA 5IJKC 2N7BA 1G9NL 4AE1A 1P4UA 2HPOA 3KGTA 3S4SB 2VZTA 2V7NB 3UZQA 3C5ZC 5DUPH 1RIUL 4X7SL 4BINA 4POUB 4M5YL 4YFDB 1RK1B 5HJDA 4A1RA 2DPKA 3HW7A 4GSRA 1GKOA 4CGTA 2Y69B 4R83A 4HJSA 1JK9B 4N0UB 2X3AA 1KXHA 3BLPX 1A6UH 5L8JB 2ZXQA 1MVUA 1GGYA 1X5GA 2KZ1B 1LO3H 4ZUWB 2ZOWA 4CN6A 4N8UA 4YGAB 1QPPA 4PJGA 3Q6GH 3U25A 5IMOA 1MIMH 1PZ5B 3L4VA 3SQBA 1KY7A 4MHHG 4DW2L 2NZ9C 3CFTA 1QRNB 4GO8A 2IPTL 4NBXB 5KVDH 4PJ9A 2EXYD 4HKZA 2HT3D 3STLA 3DRQB 1E2VA 3P4OA 4V1DA 2WLJA 2NNAB 5CGBA 3TO4C 1UM5L 3PDGA 5SWZB 3RWFA 2BSRB 1DUYA 1F58L 2EE3A 1WYJA 3IPEA 2Q76B 4JRFA 4KKNA 4X4XB 1XCTA 2JB5L 5D7JB 3S97C 5I2IB 4CNIA 2ZOLB 3QE5A 4O2CB 5E7FA 1T03H 1SYVB 1KFAH 5K9KB 2A1WH 2DY2A 3MRDB 4R6UA 3QR0A 1T83C 5E8EB 4HS8H 2EEXA 2P7TA 5AZ2L 4AQ8C 3DPBA 3NIFF 4XVUC 5BV7B 2DQFA 2WQRA 5KYNA 3HFFA 3CDZB 1CDBA 1N26A 1N0XH 3MYZA 4MS8C 1TFPA 3HG2A 3QA3B 4WIQA 5C0CE 2ZUQC 5D5MB 1OP3K 2V7HA 4PBVC 1L9QA 5C09B 5TE7H 5IKCA 1JXJA 5AQ0A 5HYQA 1CGUA 1FG2B 5TGBB 5J6GB 4P57A 2CXGA 3ZE2F 1BIIB 4AENA 3ESUF 3EYVB 1SNRA 1J7VR 4FJYA 4UNUA 3QHTC 5DI8A 1FL3A 3OXRB 2A9CA 2N01B 3HAEG 3SYCA 3TO2A 2Y5TB 1JYNA 1SRDA 2XTJD 1E28A 5AVXB 4XRCB 4J6IA 2YPLD 3DGDA 3SB3A 1S9VB 4EOWL 1KN4L 3CLEH 3O4LD 3K8KA 2P80D 3FB5A 4FYTA 1DBJH 4XOCA 5CSGA 3T4AB 4AGLA 1BWWA 1YNTA 1C5BH 2D73A 2WGXA 2YZ1A 5JLZA 4LCUB 3KXFE 5J1AA 1LDPH 1R3HA 4P04A 4R26L 4FLOA 4Q14A 4XGZA 5CHNA 1FGVH 2YD3A 4LOEA 3B7YA 1WCQA 4OZHF 4AQ1B 5ILTH 3BVNA 1DZ0A 2EDQA 1P53A 2AJUL 3K4AA 1MNUL 1U93A 5E6IB 2C9VA 3JWOH 4NRXA 3TLRA 4G1MB 1T21B 2FQEA 2NY5H 3FUIA 3NJXA 2DM2A 4LESA 1B0WA 1E5UI 4NFCA 1ILSA 1VDGA 1N12A 2GYSA 2JKLA 4M3HA 1IBFA 4KXDA 5DJ6A 4X6DE 1NCCH 5C0BA 3A4DA 1ZV2A 1H3VA 2BP8B 2JVUA 1OGAA 2UZIL 5M94B 2COQA 1SJEA 2GIYA 2XQYG 4RRPG 1S7TB 3T6WA 1X44A 3G04B 4G9DA 5JHAA 4PLKC 4Z77A 3QQDA 1IVLA 5E5UB 2ZUUA 4IMLA 4QRUB 1TO4A 1DYZA 2CE6A 4ZFZB 5ADOH 4IHOA 3NRFA 1U8NA 4XO8A 4WFFE 3OX8B 1G1KA 3REVA 4YNYB 2CDEA 4WY7L 2Y7LA 5BS0D 4P4KD 5DD3H 4W9FC 2P5EE 1VGEH 2X70A 1AANA 3B6SA 4J3XA 3FT3B 2EP6A 2GC7C 3RGVD 5AW0B 1JXGA 3QRBA 4XMVA 4RX4A 5IQNA 4I89A 1KB5L 1J86A 1RUKL 3LHAA 3QORC 5BVJA 1AZCA 1A64A 1W80A 4WNQA 1SHSA 1A47A 3H7BA 3QG6B 1AJ7H 1YMHA 2MNJB 2VR6A 3DYPA 5EUKA 1QI5A 4L0ZA 2QR0B 4GW5B 1SDAB 1AI1H 2IOIA 4Z7WF 4ZMQA 1YVLA 3OZKA 4FKKA 3H56A 3MGTB 1OXYA 3VFUA 3DVIA 3SQOL 4NZFA 4GMSL 4L29A 4K5LA 4LRIC 5CJ8A 3PWPA 4Z7OE 2B08A 5BRZB 1H6EA 5B3JE 2CUHA 5I6MA 5HHOA 4XPBL 3HR5B 4YVUA 4Y4HB 1AGCB 2BWDA 3MJ6A 2WLKA 1DSFH 1JPGA 4PI2A 3BP4B 4HJUA 1QHQA 2Y24A 2XKUA 4Z7UA 1RK0B 4MQXD 3HZVB 4RNRA 1J5DA 3HG4A 4LO9A 4RH4A 2GITA 4TXVB 2ESVE 3NTCH 2E75C 4TYUA 4CGUB 3HG1E 2JKRM 1IGJA 1QUNA 1UH2A 4MCZA 4BFNA 3CGTA 4QT5A 2HVJB 4XO4A 3WJMA 2V33A 5D2LB 2Z31D 2QVFB 3GSOB 5A1AA 4ZS6C 4JHWL 5DQJB 2D4FA 4PRPE 3PYCA 4GRLC 3IDIB 3WMQA 5BUAA 4YPGB 1K2DB 3L1OH 3PUCA 2C8NA 2X4RB 4K7PL 4FXKA 4U3HA 1T5KA 3SO5A 3VAEA 2O6CA 3KR3L 2EVJA 2DMCA 1F4YH 1MRDL 3IXTA 4QNPF 4OJFL 3VGGA 3RUGB 1UG9A 2JF1A 2HJFA 1BLNA 5ID0B 1KC5L 2DWDA 3FFCE 5H37H 2CRMA 3UTOA 3K2UL 5GZND 3P3TA 1ROCA 4KJYB 2XXMB 4M6OL 1MVUB 1JNHA 3F58H 5TE4H 2B0SH 5GSRA 3WEXB 1MCEA 4PS4H 3GMRA 1S46A 1YJDC 4PJGB 1FZOB 4UOW0 4IJ3B 5EOCJ 3B1UA 1ID5I 1H3PH 4GPVA 2NXYD 3SQBB 3OKDA 4MNHA 3NCYP 4RAHA 5F7LB 2IADB 5ALCH 4DGYL 4IRZL 4KUCD 5AKRA 1OAXH 2VYRE 4UQ3B 5I1KL 4MBRA 2RHEA 3LZOA 4V1DB 1N5YL 3VRLE 1DTUA 2R9HD 2XU9A 3BRDA 1M7DA 3FQ2A 1RPKA 3RWFB 2XVGA 1GZQA 1KCKA 1DUYB 2MQCA 2X3BA 1XCTB 1QPKA 3JWNH 2YA0A 3HZYB 2M1KA 1XQ4A 4CNIB 4ICWA 3SE3A 5FECB 2HT2C 1EJ8A 3QR1A 2HKAA 4KXZI 4J4PA 2PPCA 3OKKB 2LQRA 3SBPA 1TETH 3MRRA 3UGEA 2P7TB 3DPBB 3GM0A 5D7HA 5C7XL 1AD0A 4WTQA 1MHHA 4ODTL 4K9JA 1SN2A 4KO9A 2AK4E 4PCYA 2J55A 5HYQB 2XBDA 1Z5LB 5FOBB 4Z7AA 1T80A 1FGNH 3WSQH 1YEKL 4AIEA 4AENB 3AY2A 1IIKA 5AYUH 1J5OL 3PP3H 4S1DD 3R0MA 2XJLA 3LH8A 1HXKA 2J8HA 3LRKA 3LVTA 3N0PB 3TO2B 1O75A 5ACZA 4B9GA 1H9VA 5C07A 5HHMD 5DHMC 5K5YA 3DROA 4ANXA 2O4EA 3ATEA 3C5XA 3UZVA 4N0UE 2F8OA 3TVMC 4OF7A 1T2XA 1KIQA 1TZGH 3D18A 3FB5B 3KGRA 2VLJA 4QJ4B 3GPSA 5EO1B 2F58L 3PREA 1AOHA 4OJEH 2WIMA 4X7TA 3WD5L 2DAVA 1YNTB 1G9MC 2ZYIA 2YPKA 2B4CH 5E08H 2F8VA 4ZBJA 3WN5C 5J1AB 1R3HB 3GT6A 4MNGA 1XMWA 4BHUA 3EF7A 4AL8H 3UIZA 3T2QA 5FLUA 2KLRA 1G0DA 2JKIS 1RUAL 4JQIH 1Q0YL 3BVNB 5SWZE 4HSAC 4LHUA 1I7UB 2ZX9A 1KIPB 4NZTL 4ERSL 2HB0A 1U93B 3RWIA 1OW0C 1PLGH 4NM4L 2NYYC 2QGEA 3J07A 3QZBA 1MLCB 4LSRL 3MGOB 4QRRD 1M2VA 3ARBC 4GG6A 3W0WE 2IANE 2DIEA 2BM3A 1HCYA 5JZ7C 1TYJA 1OGAB 3HLAB 1SJEB 1YEEH 4L2YA 5D5ME 2GY7B 5C09E 3BI9X 4CADA 1RURH 1CL7I 4G9DB 5KZCB 4JGJA 3T0EA 3J8F7 3FUKA 4Z77B 2GJ6D 3QQDB 2H6PA 4IMLB 3WNKA 4QAWA 2AQPA 3QCUL 2JLPA 7PCYA 4F1SA 5H4ZA 5IQOA 3CLFH 3REVB 2CDEB 2WLMA 5AOIA 1YC8A 3V95A 4XVTH 2X70B 1BOYA 2NXZB 3B6SB 4DN3H 3V9FA 5C0FB 2Q9OA 3UZEC 4BZYA 4GRMB 1CLCA 2Y3NA 3GMOA 2MKLC 3HAEH 3IBOA 3V6BR 3AREC 1KB5A 1A14L 1BVNP 4ZO7A 3TONA 4DJMA 4YSQA 1F97A 4WNQB 3UTSA 1J9QA 3DGCR 3H7BB 5KSAA 2ICEC 1XMEB 4GW1B 5FWQA 3AAZB 1N18A 2ZP0T 4FFZH 5FW8A 5EUKB 2ZP9A 4IHBA 4WNSA 1HHIA 1IGML 1UOKA 4JE0A 3T8XA 2V3DA 4CC0A 1H3WM 5EIIA 2EEDA 4MXQD 4DFHA 3NCBB 4UB0L 4PW3A 3FB6A 3TN0A 1THAA 3PWPB 1KXQA 2R4RL 3IFNL 1VGKA 1H3TA 5T5FH 2R83A 1EHKB 4KK9C 2DWEA 2HLFD 3QIWD 3UC0L 2BVPA 5C0EA 2KERA 2Z3FA 2K7QA 5HHXH 2CBMA 3CFIC 3WFDH 3ZKSD 2C9QA 4DSYA 1UD6A 2QPDB 5A6IA 4PB9H 1KEGL 4Z7UB 4RNRB 2GITB 2I69A 3O2WH 4AKPA 1D2PA 4HXAH 3CX5J 2QGCA 2WYHA 4XP6H 5LO7A 1ETB1 3DJTA 3VXRD 1IGJB 1QUNB 3OF6A 4L1TA 4MCZB 1PJ9A 1GGTA 2XC8A 4QT5B 3ZGIA 4JPVL 1HILA 2KPNA 3PGDB 2BXYA 3WJMB 2IBZX 4DUVA 4HQQL 1XR9B 5FW7A 2TSAA 2JJSC 5B1JA 4IKJA 3PPEA 1OWRM 1A25A 4RETB 1KYFA 4M5ZL 2L7QA 2WCPA 1GR7A 2EIMB 4FXKB 2Z93A 1W8NA 5HPMA 1XO8A 1A7PL 1D6EB 1QSEE 1MDAA 3CSYA 3LN5A 4OT1L 5D55A 3N85L 1JWMA 3D0VA 1FRGH 2HJFB 2OZ4H 1BLNB 2QZ5A 2DWDB 1BGXL 4K5NA 3TT3H 4HZLA 3JTBA 3LN4B 4O2EA 1JNHB 1NMBH 4TLSA 5FC9A 5GSRB 1D5IL 3KPNA 4DGWC 1YJDL 1S7VA 2AXHA 4P07A 3WY2A 4Q0XL 1Z5HA 3HRZA 4HPOL 4EAEA 1PLCA 4MNHB 1HCFX 1Z6JT 5FV1L 4FI7A 1R19A 4PJIF 3E2HC 1Z0MA 3C60A 5CZXD 4FA7B 4HIHA 4IRZA 1JHKH 5AOJA 5GGVY 1FAKT 1M7DB 3SYAA 3TO4A 2HKHH 3BXNB 4FRWA 3BPOB 1CBVH 1JN6A 4G42A 2DQ6A 3T0VA 3NSXA 4WTZG 4WUKL 5EORH 4JY6A 3EJQA 4NFBA 5KG9B 4XT1C 5CINL 1HX0A 3UPCA 3IDGA 3VXQA 2BY0A 2LVEA 4N3UA 2YK1L 4FL4C 2RA1A 4MMZC 2Y1VA 4MTMA 1AD0B 1M71A 2NW2A 2WTOA 3QIBB 3SPHA 2WAQA 3SZ6A 1KSRA 3WNJA 4AIXA 4WO4D 5L2JB 3ROLA 5D6DC 4N1EA 5F88A 3TH4T 3U7AA 1K6QH 3OVUB 3OZLA 5J6HA 1UZ6F 5L9DH 4IKNA 5IBTH 5IHHA 5J5EA 2QBWA 5D1ZI 2ENJA 5IV2A 1GGCL 1EHNA 1YEHL 1OAKL 3SY6A 5ACZB 2ADFH 3SDAA 3S5YA 4AQZA 5AKSA 3BRGC 3VB8A 2GTZA 3UTPD 1HYSC 4HWNA 3BFWA 3UZVB 1JMXA 1ACCA 3WTWA 3UO1L 3MZTA 2XZCL 1KIQB 3GBDA 3ZPDA 1R17A 2VLJB 1CGSL 5E4EC 2BOLA 1TVDA 1C08A 1XBRA 3O41A 4G59C 1MOEA 4BUHA 4CC1A 4X7TB 1BX2B 2ZJSL 4KROD 4MB3A 1G9ML 1GS6X 3FTSA 3ZRFC 2A38A 2YPKB 3NFSH 2DJMA 4YXHL 4DAGH 2I7SA 4NN7B 1CFVL 4MNGB 4MAYA 2HMIC 4V1DE 4PRHA 1UWEH 3QDJA 2Q87A 4YHNA 3GMNA 5EF0A 3B9KD 4LHUB 4NC2B 1F4XH 2CBTA 3RWIB 4KVNH 1SVZA 4HD9A 3L7EA 3KL3A 2BSCA 2YARA 1M2VB 3IMVA 4XNZC 4DT2A 4H26A 4EKJA 3WYRA 1ROWA 2WUCH 3U6XS 3Q8FA 3RI5K 3UYOD 4ZDHB 1UURA 2PO6C 5IHBA 2KPWA 5ESQB 3IGLA 1G0XA 3F12A 5IF0A 1BQLL 2PP9A 3HZ3A 4OIFA 2A9MH 2CRYA 1JE6A 3T0EB 3TCTA 3IT8D 3Q6FA 3RVXD 5K9JH 1GZPA 1G7JB 4G43A 4IOSD 3FCSB 4KDTA 4YDKL 3OAZK 1F1DA 3KYKL 3MODH 4WW1A 4ZPTA 2FBOJ 4FERA 1FL6A 4M6ML 1U6AL 2EC9T 1H3UA 4WCYL 3QISA 1XAKA 4S1SL 1AR1D 3MV8D 1RUML 4I77H 4OM0L 1E4HA 1YEGH 4HBQA 4HEMA 5JQ6L 5BW7C 1I1CA 1W2KT 4AKQA 1VSCA 4LOUD 2D0GA 3QZWG 8CGTA 2ZUTA 3JBG7 2GBVA 4B9ZA 1VB9A 3QJRB 1RLBA 5I1LB 4XCFH 3RNKB 3IAQA 1O9VA 5EF3A 1DLFL 1J8HD 3I3DA 1KB5B 4YXKL 1HN1A 4AC2A 1CWVA 1KXTA 4QGTA 3UTSB 1TZAA 4G6AC 3GHBH 1WIUA 5IFHH 4NERA 1YEFL 2C4XA 5FDWA 1ADQH 4AEIH 1RL1A 3FBKA 5C0AB 3T2PA 1HINL 3T8XB 3AT8A 2A9AA 5EIIB 1DQQA 2QKSA 1HXYA 1MHCB 1IFHH 2OTWA 4G6FD 4MLIA 3V55A 3FB6B 3PL6C 3TN0B 1CLVA 2IDQA 1CR9H 1NPNA 4HIQA 1VGKB 2H32H 2Q8BL 1MG2C 2OW6A 5HJBA 5C0BE 3EJCA 5EO9B 1OGAE 1IAIL 1JOIA 3G5VA 2BVPB 4LU5H 1ES0A 3ASOB 4QRPD 4A38A 1PZBA 4BFOA 4PWJA 2Z7ZA 4JEGB 1GGIL 4NBZB 3N42B 3WFEH 5FUCE 5I18L 3FN9A 4XVOA 4XX1E 3UX9B 2LAGB 1AKJD 4ZMTA 4ZMVA 2DL2A 4AVJA 2E86A 4WAFA 3H9SD 1PFOA 4HIJA 3NJMA 1HCZA 2MNWA 2EDEA 2VLKD 4YHPA 5E5RB 1FP5A 4HS3B 4BZ1L 1UWXK 4ONGL 2DI9A 3HKFA 2OL3L 3QXDA 3BH8A 5I28A 1HILB 1UD4A 2UUDH 4G1EA 3T2NH 2EABA 2NUTA 3ULVC 2WNWA 1J9RA 2EYSA 3A6OA 1T6VN 3K74B 1ANUA 3FO2B 4Y9CA 4E9WA 2Z93B 3H9YA 5ICXA 4MJ2A 3D39E 3U9UA 5JXEC 3GLZA 5HPMB 5D1ZD 3V6OC 2BNRA 3CSYB 2JK5A 3LN5B 5I6KA 1I85A 3U4KA 4OY9A 2F53A 1JWMB 1RVFH 3D0VB 1NMAL 4UT9L 2FR4B 2ALWA 1T20A 1ULVA 3SBRA 3K8MA 3L4YA 4KRNA 4PMEA 5DT1H 2WMPA 4HZLB 3CUPA 2UZPA 3P2DA 1OSPL 2NX5B 2AQNA 3N9GL 5F7YC 1UENA 3OJ2C 5LN4A 1HWGB 3KPNB 5BQ7A 3C6LA 3GXNA 2NZ1A 2ZT9C 4PJ7F 3W57A 1WSST 1BFVL 3ZKXB 1S7VB 2HTKD 3HRZB 3ETSA 3PWPE 4LLMA 2EDBA 3AS3A 4AYFA 4B9KC 3C60B 5HHOE 2X4TA 1Z9OA 4LCVA 4K3HA 2R0ZH 1IAKA 4XP4L 2OMZB 3FTVA 3L2MA 4QTIH 3B2UD 2I60L 3ZTJG 3AB0C 4ES9A 4OLZL 3L3HA 3V4LA 3PJNA 3HE6D 2IAMD 4ADJA 3MLSH 4FHJA 4HCRL 1UWGH 1BXUA 3VFNB 3FRUA 4JY6B 4PJAA 5JYLA 3IDGB 3VXQB 4HHAA 1ZVYA 3EZJB 1HK6A 3MTRA 3IGUA 3K0YA 4Y4FD 4TNWK 2YGNA 1FH5H 3GJFK 3QAZC 4EUPH 4OJYA 4JZNA 5C2BL 4G72B 2DMHA 1FZJA 1UWFA 3HJEA 5A2AA 1SFDA 2L7EA 5J6HB 2FRGP 3BAWA 4M5SA 4N2OA 3PHQA 3D8MA 1EJ6A 5IOPB 1BPLB 4FCHA 5I0XA 1FNHA 2X9YA 2FGWH 1QSZA 1I1AD 1N10A 2YJQA 1CXLA 1SM3H 1E4XI 3SDAB 2YSSA 2IMMA 2GTZB 3FDWA 5HHPA 3PJLA 1KCVL 1JNLH 2UXVA 5IREA 3RVWC 3ESNA 1TLMA 3TVMA 2EEFA 5ICZA 1AO7A 4WGKA 1C08B 3BCDA 3O41B 4Y19D 2X09A 4U1SB 4QXTA 1LWRA 4IK7A 3X1BA 2AZUA 5I1AA 1AHKA 3G9VA 3NK4A 4UT7L 3FTGA 3QUKA 4MAYB 3JV4A 4RBPK 1X4XA 4X9FA 3BYYA 3JZ7A 1E9PA 5D6CA 3QDJB 3VW3H 1HCVA 4KTDH 4YHNB 3GMNB 4YHOL 4MNQA 3HFML 3HE7C 5J11C 3ATDA 5C86A 1I8UA 2W9DH 1UACH 3Q2WA 2H7WA 3ZT7A 4G9FA 1S3KH 3L7EB 4R5XA 2J8OA 5EU5A 1BBDL 2EUVA 4NQEA 4UV4L 3BDYL 1MG3C 3QDMD 4XNQB 3WDJA 4R8WL 3X13A 3T3ME 1JVOA 1T7XA 3D85A 3HUJB 4HWZA 1II4E 2IGLA 2WTPA 4ABUA 1N5AA 5K59F 4GKZA 3RA7H 2M8XA 5DEGA 3A6CL 4KI5E 4ZPVB 2FEDD 2K4WA 1IGIH 1WBYA 3PQYA 3Q6FB 3BQVA 2FX8L 3VG0L 4G43B 4ZPTB 4I4WA 3KL0A 3Q1SH 4NKOA 4GQ9H 4R0LC 4WW1B 3IAPA 2WP3O 1FL6B 1OL0A 4RZCB 3W2DL 3S5ZA 1BVOA 4XVJL 1QR1A 5C07E 1YYLH 1U3YA 4E41B 5F3HA 3M17A 4PB0H 4IS6A 2IFFL 4OD2A 5T33H 3BSGA 3BAIA 4ZFGL 4EXPX 4LQ1A 4HJGA 3UBGA 1JHLH 4U1GB 2VLJE 1QRKA 1WEJH 4RCAA 5FGCE 3II2A 4UUJB 1UM6L 4QXWA 5AD0A 4OZFA 4U3XA 3B5HA 2BHZA 4J39A 1IEHA 3L9BA 4GSDH 3RJDA 4UYQA 3HOGA 2AAAA 4OLVL 4D0DA 1KXTB 5FF6A 4JKMA 1JF5A 2J88L 3S35X 5T1LB 4LCYA 2WVTA 3CHXA 5KN5A 2HFGL 3LNFA 2VDKH 4ZMZA 2W59A 3PWJA 3SPJA 2DDQL 2XTLA 1FFOB 4CDGC 1Q0XL 4KK5D 3GWJA 43CAA 5HGDB 4MXVF 1HXYB 4CKQA 5KVGH 3GQFA 3RFZC 4TVPL 2O30A 4HC1L 5LCVL 4PV8A 2WC7A 4GG6E 1WAAA 2HWZL 4B0MB 1FHGA 3F7QA 2XA8L 2EDTA 2H2PD 1H0DA 4PGDA 4CC4A 2B9BA 1MFBL 5C0CD 3LKQA 5ITBH 3MLYH 1BD2A 1Q9WA 3L5JA 4GLRI 3FU0A 1UC6A 4M7JH 2J73A 3MLVL 3ARVA 3G5VB 4FNLL 1EHAA 2PTTB 2WYIA 2XXCB 4MJ5B 4J3VA 2VH5L 2IOOA 3MLZH 3T0EE 5IROC 4UU9A 3UABA 4OB5H 5BXFB 4J3BA 1EVUA 1M42A 2A3TA 2BZ7A 3IN0A 2OK0L 1I1YA 3MACH 4TPRH 4TSCH 3DMMC 4K94C 3RI5F 3DJRA 4FFVC 2FBJH 4HIJB 4P23A 1AZZC 2VXTL 3AU1A 3BD5A 4YHPB 4O58L 3SDCA 1F2XK 4AJWA 2QPFA 2XN9A 3BH8B 4NWUL 4FC3E 2PETA 3DXAA 1RZ7H 4G1EB 2OMTA 3IS1X 2NUTB 4X5LA 5JPNA 3F85A 3TH2T 1AOZA 4ZFFA 3ULVL 2JJSA 1AKPA 3IS0X 1IE5A 5KSBF 2X4QA 1IM9D 2MQGA 3VQ2C 3VWKC 3K80A 4PS3A 1AQDA 4Q9QH 1CXEA 3KXFD 1KFGA 5ABZA 5ESAA 1HZLA 1U8IB 2BNRB 4IKIA 3FCTA 4TTDD 4UDTA 3HC2A 5HGHA 5ESVB 2F53B 3UP1A 1D7DA 2VO5A 4P5TD 2EYTB 4UT9A 1JMZA 4LVOB 2WMPB 4OSUH 3CUPB 3O9WD 3ISWA 2VCOA 3HZMA 3HMXL 1CLYH 4NPKA 5IM7A 4Z5RA 1BM3L 1TQBB 2AABH 2APSA 2ZUXA 2Q6WA 3F8UB 4H8WC 3C6LB 1XIWC 2Z7YA 4FJZA 2OKMA 5BQ7B 2XZAL 3HPJA 1RU9H 2ISDA 3GJEA 2YBGA 4M61B 5I8CA 4FQ1L 5CAYB 4UILL 1PTZA 1KXQE 4ZQKA 4AV0A 3BPNC 4MQTB 4X7DC 2R4SH 1FIGH 2X4TB 3CFUA 1DQLL 4JREB 3WEOA 2V2WA 2AEQH 1IAKB 1RHHA 4MA3B 1KLFA 5F1NA 5E2TL 2CJ3A 3L3HB 5L7XH 1NGYB 1TEYA 2ZYSA 1CE6A 4CDHA 1S9YB 2D8KA 5FCUL 4WFFD 1DVFB 3DBXA 3FRUB 4PJAB 5EWIL 5EUOB 5EIQA 1AY1L 1ZLUH 2ZPKH 2BY3A 2P5ED 2E27H 3QFDA 1A6TA 1QFWL 4YSCA 5DQDH 1KTKE 1B4JL 1GZHC 3TTYA 4LLYA 4W68A 3RZCC 4XMLL 3BESR 5F7WC 4XCNB 1PMYA 3RBSA 1FZJB 1KB9K 4AH2A 5I0WA 5J13B 3RTLA 4UANA 1UD2A 2X1XR 1CVSC 1FVEA 5DMIL 2CM5A 4F57H 2KQMA 3KS0H 1GY1A 5JR1L 1DEEA 4QRBA 2DI8A 5B39A 2X0WA 1UD5A 1ZPLA 1YC7A 1JP5A 2H6OA 5TK4A 5JW4Q 2CMRL 3MOBL 4Y8DC 1KCSH 1KELL 5E2WH 2YSSB 2BVEA 4UWQB 3VACA 4JX0A 4DP7X 1AAJA 4HT1H 3MRHB 4AXWA 2WBJD 2L4OA 4DP8X 5BV7H 5ICZB 2XWTA 4YIQA 4WK4B 1AO7B 3UAEA 2FQFA 1V3LA 2ICWJ 5G5DB 3DVGA 4EKXA 4GAYB 1CO1A 4JZOA 1YECH 5I1AB 5FV2A 4OCSH 3UJTL 4ICXA 4QI3A 3FU6A 5B7EA 4PWHA 3VFGH 5DO2D 2R29H 3ILDA 5DD0L 4DEPC 3FU7A 1E9PB 4FQXA 1K8DA 1CE1L 4XBGA 4MNQB 1T0MA 4H0GA 4KH2A 3ERXA 1FNLA 3EOTL 3HNVL 2O6DA 2VR8A 2W07A 5F7EH 5EU5B 2ESVD 3BGMB 2WBXA 4R4ND 1GIGH 2NY1D 3HG1D 3LSOA 2ZWYA 4FYRA 4M03A 3X13B 3EADA 4F15B 5I71C 3ZSSA 3D85B 5FEBA 4HWZB 4R7DA 3ZTJH 1N5AB 3SE8L 3TGXA 4GKZB 4YUEL 5LGKA 5DEFA 4PP1D 3KHOA 2WWKO 5DEGB 5CN3A 4PRPD 2EH7H 3UBXA 2IBGA 4L3AA 5AW6B 1EAPA 1NGXA 3BKJH 3BUYB 3PGCA 1WBYB 1JPTL 1RH8A 3PQYB 3ZDYB 2C3GA 2N3JA 2VL5A 4MRBA 2DBLH 4LRNL 1AE6L 4K8RH 4I4WB 4NKOB 4C4UA 3BUBA 4JHVA 3BN9D 2HT3C 3ZIYA 1MCWM 1CGYA 4APQD 1T0PB 2DB8A 2HH0H 4TNWF 3JV0A 3M17B 2EXWD 4KO5A 1AZNA 2MCPL 4OD2B 1MWAA 4JPKL 4HFUH 5BW7A 1PNDA 3TX4A 2A5UA 3MRGA 1EWHA 2B1AL 4LCWA 1S7SB 2AV7A 1QLRA 3BN3B 1A1NA 3ARUA 3CHOA 4HJGB 3O6ML 1X5IA 3U0WH 5EZIL 1N64L 1RZJH 3BEVA 1TTGA 4OZFB 2AITA 3TYGL 4PJEA 3TTSA 3ASWA 1H9DA 2HFEA 4HWEH 1E0OB 4YBLB 3NJNA 4D0DB 1AC6A 2X87A 1CTOA 3O8XB 3ZT5A 1NCWH 2JXMA 4LCYB 4X6CF 3O6LL 4GAAA 4PRHE 1PCSA 1MI5A 2HVBA 2JQAA 4UM8A 3BSZL 1RJYA 3PWJB 1MFUA 2NY6C 3FK3A 4UM9D 2HG0A 2IVFC 4G6MH 2A73B 4BWUA 2GSIA 1Y7VA 1TZHA 43CAB 7TAAA 4RSVA 4ETQA 4PV8B 3FCGA 1QACA 2V5RA 4H0HB 5LCVA 4YDLB 1PYWA 5FM5M 4AGQA 1R5WA 4PGDB 3IB4A 2YN5A 3FJTA 3SYQA 3LKQB 2AK4D 2B3RA 3KNBA 1BD2B 1A9EA 3UACA 3KE0A 3ZKMC 2DBJA 1AQKH 5E0FA 1NM4A 1JGIA 5IIEA 2PR4H 1KTCA 4UU9B 1PFCA 1CQKA 3KPOA 4OGYH 3V0WL 2VSDA 2QSVA 2OXGA 1F90H 2AEPL 1I1YB 2AQ3A 4OD1H 3BZFB 4AZ8B 2VUOA 1ZXKA 4KQ3L 1QA9A 4KKBC 5MENA 1C8PA 4HEME 2JB6A 4N8CH 4P23B 4BH7A 3CXDH 1JZ6A 1SQMA 3SDCB 2XN9B 4PY8J 3DXAB 4J3UA 2PYEB 4PWGA 5IUSA 3IJ9A 1P5VA 2OMTB 3DHJA 5JPNB 3R1GL 4OUOA 4ZFFB 1YUHA 5AVWB 5J89A 2X4QB 3QXVA 2UWEE 2J2ZA 3LKNB 5AYQA 3ILPA 4U1LA 3ZDXE 2DQGL 3O4OB 4KOBA 3O3AA 4LSPH 3QXUA 1A7RL 5ESAB 1S9KC 1QUPA 1CU4H 2YFNA 5I1HL 3FCTB 5KBKA 1HTYA 4UDTB 3GIZL 3GBEA 3RVTC 3V7AG 3I50L 1A7QL 3NVQA 2IH1A 1SUHA 2JKTM 2P5WA 1DBKL 5FHBH 5SWZD 3NGBC 3I9IA 2F54A 4NKDB 4FD0A 1NIDA 3HZMB 5IM7B 4WK0B 2Y1AA 4LEXL 2IDSA 2Q6WB 4Z5RB 2R27A 2UVEA 2ZKMX 4H8WL 4JRWA 4M48H 5CEZD 1XR8A 3HPJB 1DE4A 4N5UA 3GJEB 2IAND 4L9LA 1EXUA 3W0WD 3OKOA 4XMPL 2WGNB 4N25A 4P4KC 3SDDD 5I8CB 3GGWA 3VI4F 1JGVL 2ZONA 1GMIA 3ABMB 3UAAA 3P0VH 2P52A 4B9YA 3MBEB 4DIXA 3G5WA 1SHXA 3CSGA 2V2WB 1KBPA 5C09D 4G3YH 4OFKA 4EI5B 1UYWH 2NNFA 3H3BC 1KGYE 1KLFB 3WNLA 1HQ4B 5F1NB 3VO0A 2WBWB 3FPYA 4FI6A 1CE6B 1MJ8H 3FSZA 4DP5X 4HX1A 4M6NH 3DBXB 5K1VA 4UTBA 1QZ1A 4AEFA 4OFVA 2FO1A 5I0VA 4Y5XC 1REIA 3QFDB 1SBSH 1A6TB 1FLRL 2FVNA 3D1MC 3D69B 3ZGHA 3QS3A 4Z1PA 4LHUG 1ORQB 3HEIB 4J23A 4LLYB 4X5WA 5CU5A 4AH2B 2MKWA 4Q9BA 2DQCH 3V5HA 5KUKA 3NA9H 3HS9A 1FVEB 3TASA 3VM5A 2D0HA 2HA1A 4P2AA 2WXKA 5FKAA 1SEBA 3MUY1 5TQ2H 2VZUA 2DYPA 3VGBA 5CCHE 3H42H 2BNRE 3CJJA 1CICD 4OCXL 2ZAIA 2N56A 1L0XA 2ZP8A 4K8RD 2W94A 2V3FA 4DFIA 5I1JL 2P9RA 3GSNL 3DX4A 1D5BA 2DIJA 4XC3L 5I26A 4DVRH 4AXWB 4RWYL 4U1HA 2O5YL 4RWHA 1B3IA 1ET7A 5E6ID 2FUTA 1KN2L 2HSIA 4M00A 4AGMA 2H47C 3MRBB 4YIQB 1OCCB 5CLTA 5F9OH 3HB3C 4M93C 3ECVA 3OV6A 1OARL 5EN2A 3IJHA 2Y36L 4LAJH 3LNGA 4XP5L 3SKMB 1RAMA 3DVGB 4NRYB 2FX7H 4JZOB 3UCQA 4TN9A 3SDYL 5AW7B 1WK0A 1T1WA 3GK8H 4ETYA 1LJMA 4KUCF 3BWSA 1NFDA 4YAQA 3RY6C 3A4FA 3FU7B 4FQXB 1K8DB 2XWRA 1IC0A 4P9ML 1T0MB 1XTLA 4U1KA 1N59A 2BP0A 3DTUB 1DCEA 3WKQA 2W07B 3U6RB 4FZ8H 2IQ9H 2J4WL 2X44D 3O0RL 4ISVA 4XNUL 2ATPA 2XA3A 3B34A 1YEIL 4G83A 5I73C 5L4MA 2IXQA 3H9HA 5GZNC 4R7DB 3RPIA 43C9A 1J1XH 3KH4A 5DEFB 5MP6H 5CWSA 3FH5A 4A7TA 3QWRD 4HLJA 3UBXB 2VSCA 1NGXB 4YDNA 4NZRL 1I8KA 5DD5L 3RU8H 4DUWA 3CHSA 2BX5A 2DS4A 2CJUL 4U7SA 1D9KB 2VL5B 5DJ2B 4ZW5A 1P6WA 2A6DA 3IKKA 1QSED 4LZKA 3I9GL 5L8KB 4RGOH 4HKBA 1MFAH 3VXUB 1NEUA 3QYCA 4NO0D 3MO1A 4R0LA 4JHZA 2RJMA 4FQPA 2H1PL 1IC4H 1P7HL 3BKYH 2IAAC 4EQ2A 1B4RA 4L3CA 2M2DA 4M7KH 1M1SA 2UZYB 4XZUA 3I6SA 3EFDL 1MWAB 3S35L 1UXWB 3MBXH 1RULL 4N2GA 2AI0H 3MRGB 1IKFL 2O61A 4LCWB 2DQTH 1QLRB 2YKLL 1A1NB 4R3SA 3MV9A 1AO7E 1ICTA 3NMEA 1L6XA 3T3PF 2NNXA 4YLBA 2CO7A 3JWOC 2NY5C 1F86A 2NY7L 4P5KA 4PJEB 4C57C 4NP4H 4U49A 2HFEB 3TCLA 1MIEL 1YY8B 4HG4K 1WFOA 3MR9A 3VGHA 1QX1A 4KK6C 1E4WL 1T6BX 2JXMB 3TJEL 2WZAA 3JUYA 4YEFA 2G2PA 1MI5B 4TRPH 2DRUA 1J5HA 4MNQE 3AGWA 2HVKA 3BSZA 1RJYB 4S1DC 3II3A 3WY1A 1L9RA 4W9HC 4XB7A 4G9FE 2GSIB 4L3EA 1H8OA 1TZHB 2V8LA 2VQ1B 3CFMA 3CDCA 1QVOB 1Y6NR 1P0SE 4ETQB 4NQEE 3ZDZF 3RFZA 4DP6X 4K3EL 1RZ8A 3M8OL 3IFPA 1DN2A 1R5WB 2WUBH 1NEZA 4K07A 2LV4A 4PWFA 4U0RC 4XNBA 3ZK0A 2VXUL 1G6RB 1WZ1L 2WQAA 3RAJL 5IB5A 2YMXL 5K39A 3X3FH 3QIUB 2H0FA 4IBQA 1X6LA 4ODWA 4M62L 2BMKB 3H55A 3VXPA 1Z9MA 3PQYE 3UTZA 5IIEB 3ZHDA 3MCKB 1EDQA 5IROA 1NFIB 5E8PB 1XDTT 4IRJB 2OXGB 1JDDA 3A5VA 3C75A 4OTXH 3QZLA 2VDNL 3DMMA 5MENB 4PMFA 1EGJA 1N70A 1M57B 2VN4A 5H2BA 4DZBB 1NCAH 2XWEA 3OD3A 2AQTA 2JV6A 3G6AA 4CN1A 1BZ7B 3S37H 1W16A 3HHMA 4MJIB 3CDFA 4NT6A 3LCYA 4TUKL 4PGEB 4EBQL 1BJ8A 2R1YA 4HLZG 1S9WA 2J2ZB 4JQVC 1VEOA 3ILPB 4M1DH 2EVHA 2IALA 2MOQA 3O3AB 5F7UA 4PJ9D 2VXSL 1D6VH 2Z34A 3HC4L 5I1IH 1TQUA 2A6IA 4V1DD 4ODBD 1WT5C 3KCWA 4JHAH 2WM0A 1XL4A 5AG8A 5KYXA 2Z64C 1AZVA 3GIVA 2P5WB 4TQHA 2YEVB 3DDFA 5ES4B 4W4OA 1GJIA 2F54B 2B14A 2VN5A 4YHZL 5KWYC 2CD0A 5D7LB 5C0ND 4ZK8A 5DUMH 3S6CA 3QAQA 5F7HA 4RMTA 4ODXB 5I19H 2OCFD 3HN8A 3PUUA 5BJTB 4L9LB 1XIWA 1EXUB 3I6GB 3SKJL 3V4UH 3ZZ1A 1ZGLP 2DICA 1G43A 4ES8A 4KXBA 3THMH 2BOCA 5E2JA 2FHCA 3IK2A 3CCHA 1BD2E 2VKWA 1QFUL 3GMQA 4I18C 4ZX5A 2WLNA 3ARSA 3VFPA 2G60L 1RV6X 4XMWA 2CO6A 4GFTB 4F91B 1NBCA 4WHDA 3OBAA 3ZL1A 4PI0A 4D9LH 4O51A 4HX1B 3PJSA 4UI2A 1DVYA 3QC5X 5FKPA 4LSQL 1IGYB 3K6DA 5TDOB 3P3UA 3MUJA 4RDQF 5DUPL 1MLBA 1I3GL 2N7SA 4GAGH 4K71C 5GRYA 5LJYH 4YBQC 1OEZW 1LK3H 2XN9E 4X5WB 1BOGA 3QAZB 2UXTA 4MXQC 4DEWA 3TV3H 2H2SC 4LKXB 3CHPA 1A6UL 4DW2H 5I6XB 4F58H 5D93C 5FKAB 4JKPH 1SEBB 1LO3L 1TPXB 3FFDA 3BRFA 3SDXF 4JFXA 5HTSA 2QGBA 3Q6GL 3T9WA 2DYPB 1MIML 2NTSP 2KLSA 3WOVA 5EOTA 3UDWA 1UM5H 5I6OA 5KVDL 3FF7A 4Y9BA 1BF2A 2W1NA 2HN7B 1T7VA 4K55A 4XI5C 2NQ3A 2ADYA 2JB5H 3BO8A 4QRSA 4Y5VC 1D5BB 1QOKA 3Q48A 4MS6A 4Z7VF 4YHMH 4ZTEA 3VD9A 2XY1A 1CXFA 3VXTA 3EJZD 5FGBA 1T66D 4ONFL 2VW4A 1J11A 3BUTA 4PW4A 5AOMA 3JWNC 2ICCA 2VLLA 1T03L 1KFAL 2WXPA 2A1WL 5L2KB 4HS8L 5K93A 5C0BD 1SXAA 3X12B 3F83A 1ACYL 1MKFA 1T1WB 4OF6A 1OGAD 1HL4A 3GZOA 1NFDB 2HP4A 4YAQB 3CU1A 4HS6B 4NAMA 2D0FA 2R0LL 4OZIB 5KZCD 1ZT7A 4PWKA 3OMNB 2ETWA 32C2A 4Z3EA 1HZHL 5TE7L 2P28B 1N59B 5E4IA 2BP0B 3UTQA 4MGXA 2H0EA 4GXUM 5K9OA 3ISYA 3QHZH 4QF1A 1TU2A 1TZ8A 4ISVB 2WO3B 2ATPB 4Y4KB 3O6FC 1FI8C 4FQIH 4EOWH 2X6VA 3BZ4A 2IXQB 4H1LA 5CM1A 3RX5A 3RPIB 1GHFH 3QJOA 2BSSB 4DO5A 2A4CA 5CWSB 4DPRA 4JM2D 5K69A 4XN8A 2GUYA 3CLEL 4RX4D 3ZOAA 4YHYB 1C12A 2R56H 2YMOA 3D39D 4X8CA 2K45A 2A6DB 4PREA 4OU3A 1DLHA 3NRQA 5CZXC 2FT7A 3FT4B 1C5BL 3HC0A 2EVGA 3MO1B 3NEEA 4BK4A 1RK7A 2B4CC 4BHUI 1AGDB 5AL8A 1LDPL 4LCIH 4L3CB 4I48B 1X7SA 4XZUB 3HCVB 1FGVL 4YOKA 3P73A 4G5AA 4AL8C 4MQSB 5C70A 1OTUD 1UXLA 4XWOC 5B7FA 4IDLA 5ILTL 3SO3C 4R3SB 1QNIA 2WSKA 5DYFA 5LN8A 2B5IC 3BIBX 4B5EA 3OG6B 3TH3T 2CO7B 3JWOL 3V4PA 4JO8A 2NY5L 1CFQA 1I7TB 3PWPD 3B2DC 3IEAA 1DBBH 2ZG3A 3IU4H 3GF8A 3TCLB 5HHOD 4MBOA 3TWCL 4Y7OC 3FSOA 1NUDA 2V9TA 2I9LA 15C8H 1CDIA 1MVFA 3MR9B 5T1JA 1NA8A 3UROR 1NCCL 2WN3A 1QHPA 3VDBA 4WWOA 1FC2D 4JZJA 1CVRA 4Y16A 5A3ID 3GLDA 4KDVA 2HVKB 3L08A 3UJJH 4ABWA 5JHLA 35C8L 1SJHA 1BAFH 4L3EB 2P8MA 1AGEA 3RZWA 1RXLA 4QMEA 3VYNA 5ADOL 4LKCB 3FQ1A 2XPGA 1ZHNA 2HYMA 3IFPB 4X9YA 3N6YA 3ML8A 4BYHA 5DD3L 3CFDA 4UTAA 5IB5B 1KB5H 5K39B 3VFMA 1LP9F 3GSXA 3Q9PA 4PJDE 1G7MB 4TF4A 5CMAA 3NFPB 2Z9TA 4ODWB 4KROC 3HRPA 3VXPB 3RHWF 3TA3C 1H6TA 2YRBA 3FRPA 4UNVA 2WVUA 1SOKA 3DV6A 4M4RA 1Y1UA 3LZFH 3PAYA 4FZEH 1TCMA 4PLJD 4QPEA 1KTLA 2QMJA 1FCGA 3CK0H 3MKKA 2PYFA 4I9XA 4YQXH 4FTVE 5E4OA 2Z8WC 1AJ7L 1VF5C 1OGTA 3FC8A 1G9EA 3QO1A 5JOEA 5DO8A 3SQOH 5CIPB 5F1KC 2BSTA 3G6AB 3OGCA 1T0OA 3HPLA 4CSSA 1AI1L 4APXB 1IBBA 5D1QA 1BIHA 4HCGA 1S7RA 4XPFL 3BWZA 4CJ1A 1S9WB 4PVMA 1OP5K 1QFHA 2JCWA 5DFAA 2WQSA 5EU6A 4K73A 4POZD 2ZE0A 1J05A 3BH4A 1INQA 2AF2A 2XVBA 5LBSA 3EGSA 2XVLA 1AD9A 1GH7A 2A6IB 2FL5A 2OMNA 4LVEA 1VFMA 4NQCB 3OR6A 5F7NC 4O9HH 2XIDA 1EEUA 3GIVB 1MI5E 3RVXC 1UKSA 4QOKE 4AYBA 3WLBA 4W9EC 1W72A 2BVOB 3EHBB 4JJ5A 3U2IA 2B59B 1N8ZA 3I9PA 3ZQ9A 1CYWA 3AXLA 1USZA 1JTPA 3DX1A 5HYSG 4F5CA 3STBA 4TVPE 5BVPH 2V2XB 1AACA 4AC4A 3PAZA 3F00A 3NTCL 4HUNB 1Q0EA 4HAGA 5JW5A 2BOCB 3GXUB 4U1NA 5DZ9A 1QTSA 3GMQB 4XHQA 4ZYKA 4LMQE 4O5LH 3IM1A 3VFPB 4KRPB 5FFOA 2CO6B 3FSVA 4FNSA 4XXCA 2WWNA 4W9IC 5D8JH 3LB6C 4F9PC 1URLA 2LABA 3LDBB 1X6NA 1MEXH 3FO9A 3MJ9H 3L1OL 4YS4A 8PAZA 3MLWH 2EKSA 3PJSB 1CZ8H 2ZNWA 5C07D 4KX7A 4XCCH 4WSGA 4DPAX 4E0RA 4KPHH 3ZHKA 2Z65C 4HAKA 4BKSC 2YAPA 4F3FA 1MLBB 2YD7A 4GSXA 1F4YL 5MENE 2HZHA 3ULUH 5F9AC 5JNYA 5CP3H 4I3GA 1JTTA 3CC5B 3PXJA 4W1TA 2DQUH 4A66A 2UZXA 4B9PA 1BOGB 1FNGA 5GS3A 2NY0B 4JFEA 1WCBA 4RMWA 4YZWA 1K5NA 3FB8B 4YXLH 1BMZA 3NCWA 4H2AA 3ZKQD 5FO9B 1XV8A 3F58L 5TE4L 4PPTA 2B0SL 1S7UA 2VT0A 3QWQB 2K8QA 4AGNA 4JFXB 3ULVE 4PS4L 3K91A 1IV8A 1DJZA 2J20A 1Q9OB 1A6PA 2H3NB 2R1XA 4A2FA 1TQCC 1H3PL 2AXJA 3QPQC 2ZAHA 3QFJA 4H7VA 3V6OE 1B0RB 2DM3A 4L4VE 4P2OC 5GRXG 5ALCL 1K3IA 3VRIB 3RTQC 3KPMA 3A23A 4F7TA 1OAXL 3QUYD 1KCRH 1O0VA 1E8WA 5KANG 5IP4A 2WXQA 3PP4H 2N59A 2XZZA 4HLZH 2YSTA 1LEKA 4HDIA 3NCJH 4PW9A 4X80L 4BQ9A 1A6VH 4LBAA 5FA4A 4HEPG 3WUWA 5AOZA 1YPZF 3UG3A 2VLLB 1NDMA 2AVGA 3V0AC 3WTYA 1TETL 2CHNA 3N41B 3AGVA 3D4ZA 2XQBH 5DJ0B 3FHAA 2WZ5A 3N3EA 4AZUA 5HHQA 4DEPB 3QJFA 3RY6A 1ZT7B 1YEKH 3GSRA 3T0ED 1VZGA 1OAYH 32C2B 3OHXA 4F7PA 2G75A 3QZOA 4QXVA 1TNMA 4JCWA 4ANWA 3UTQB 4MDRA 4LOFA 1FGNL 5K9OB 1ONQA 3WSQL 4QF1B 4DKEH 3U4EA 5I5IA 4BA0A 1EJOH 4KXCA 5AYUL 2YHGA 5CN2A 4JFOB 3BZ4B 1XGQA 4U4BA 5FM4A 4EN3C 3EOAA 2X4SB 3CSTA 3RL1A 3X1EA 1KG0B 1HHGA 1JZJA 2KZBA 1N7MH 1GW6A 1JVLA 2ZCZA 2JCCA 4WI3A 4OCWH 1TZGL 2HTKC 1C12B 2NYKA 1DLHB 1MELA 5FPIA 4JMNA 4L18A 1ETJA 1DHKA 5DA0B 2YUZA 3F64A 5KSAD 1DANT 2B4CL 3OB0K 1NGWA 5E08L 3EBIA 5GIRB 1KCUH 4KWUA 3B7UX 5F93C 3V8OA 1FSKB 2IAMC 3AS0A 3RWJA 4YK4C 5ISZA 4AL8L 4DO4A 4K23H 2WB1A 5DJAA 5CEYA 2BP3A 2VITA 3I6LE 4L4TA 3N1GC 4JQIL 4AQEA 3CU7A 4RFEB 4PJBF 3ZE0F 4L2LA 4ENED 5HDOA 1PLGL 4AE0A 3V4PB 2EZ0D 3P11L 5FXCH 5F6HJ 2H41A 4RWYH 2VE6A 4AK1A 5IB2A 1YN6A 4AM0Q 2I9LB