The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
51
|
sequence length |
180
|
structure length |
180
|
Chain Sequence |
DSRTVSELVTNTNTIRVAMKDAYQRDGKYPDYQAPLSLTADSIKTDSTGIAVAQLVQLGKLTPDEARNGISGDYIGIGGAITSSGSTINKGFAMELNGLSQEQCRSILGQVGDNWEYVAVGTSPSGSYDALSAGAVNMLAATDNTTILRSLAANGQVSLTAEKILKTCTATVNSITLASR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Cell adhesion
|
| molecule keywords |
CFA/III pilin
|
| publication title |
Structural Characterization of CFA/III and Longus Type IVb Pili from Enterotoxigenic Escherichia coli.
pubmed doi rcsb |
| source organism |
Escherichia coli
|
| total genus |
51
|
| structure length |
180
|
| sequence length |
180
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2011-05-13 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05946 | TcpA | Toxin-coregulated pilus subunit TcpA |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | TcpA-like pilin | TcpA-like pilin |
#chains in the Genus database with same CATH superfamily 1Q5F A; 1OQV A; 3VOR A; 3FHV A; 3FHU A; 3S0T A; 1ZWT A; 3HRV A; #chains in the Genus database with same CATH topology 1Q5F A; 1OQV A; 3VOR A; 3FHV A; 4IXJ A; 3FHU A; 3S0T A; 1ZWT A; 3HRV A; #chains in the Genus database with same CATH homology 1Q5F A; 1OQV A; 3VOR A; 3FHV A; 4IXJ A; 3FHU A; 3S0T A; 1ZWT A; 3HRV A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
