3S0XA

The crystal structure of gxgd membrane protease flak
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
231
structure length
225
Chain Sequence
SGSMIEYIIGALGLIIASVQDEIEDYIWIFLAVFGVLFAIYSSITLLDYSILINSISGFVICFILGYMMFLSGIGGGDGKMLIGLGALVPKFQMPIYTSLGTLLNLNYVPTFPIMVFINGIFFMVFLPFVILFRNILNGARPKTGKEFILMFFGEKMKVNVAKEQKRLIMGQNDKINFFPADEDFSKYSNNEEIWVTPQIPLIIPITLSYLVTPIIGDRILDFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidase A24B, FlaK domain protein
publication title The crystal structure of GXGD membrane protease FlaK.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Hydrolase
total genus 56
structure length 225
sequence length 231
chains with identical sequence B
ec nomenclature ec 3.4.23.52: Preflagellin peptidase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01478 Peptidase_A24 Type IV leader peptidase family
A PF06847 Arc_PepC_II Archaeal Peptidase A24 C-terminus Type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1220 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3s0xA01
3.30.1360.160 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3s0xA02
3S0XA
chains in the Genus database with same CATH superfamily
5IYDK 4ZLCA 2EPNA 1MMDA 3FOFA 4CS8A 4A3JC 2KNHA 3QVYA 3CZ6A 2KQ9A 2Y39A 2OU6A 2QY9A 1Y4CA 2NUPB 5AC4A 3GDZA 1I3QC 2QUPA 3RVZA 3K7AC 2JX0A 4G0WA 2W4BA 2NVQC 1TFOB 3RKOF 3BUEA 4GTEA 1Y1VA 2J46A 2CFAA 1U0BB 4L6RA 4J30B 1VLSA 1YZCA 2L6HA 3K1HA 2UUHA 1J6XA 3GIRA 3SZZA 2R7ZC 2YL1A 1IL2A 1F9NA 1VGXA 4PAAA 3AG4C 1O25A 2NVXA 1LE4A 3FKIK 1F7UA 3M3YC 2LFFA 2EBBA 4BJTA 4CDAA 3VF0A 4IB4A 4MNDA 1M56C 1RXQA 4J3NA 1VOMA 4CSAA 4KB4A 2KJGA 3GTMA 3A11A 1F1MA 1IQ0A 2W9YA 3F47A 3U8VA 3HOWK 1RJ9A 2BC5A 3NYMA 1IS1A 3AQOA 4C7OA 2JA7C 2L6GA 3QVZA 4Y7NK 2HZ8A 3QW0A 2XXAB 4YFKA 4F4BA 2PMZD 3H2UA 4C3JK 2J9VA 3KKBA 5KYWA 4C2MC 5D92A 3C8ZA 1VRQC 2HJMA 1O87A 3SNHA 2WZLA 1GE9A 2NUTA 5D91A 2YRFA 1NFNA 2GSOA 3S17K 2PNOA 4WJ0A 3GODA 1RKEA 3FOEA 4DBQA 2C04A 4U5HA 3K6BA 2JH3A 1Q0MA 5EGEA 1QKRA 3QMKA 3DI5A 4E7SA 3LLKA 3GTMC 1D0YA 4XPYA 3ABLC 1MQVA 3OWTA 1VK5A 4KMHA 4X6AC 1O28A 4OINA 3NMJA 3M4OC 2QE9A 1GGQA 3MLGA 2BE5A 2IXPA 1FAPB 5JVOA 1ZHWA 4XEKA 3ZSUA 3NYLA 1RMVA 4JURI 3ECSA 5M5WK 1D0XA 5FLMK 1O3UA 3KH2A 3MMLB 4PR9A 3LS1A 2DYSC 1UG7A 3ZIBA 4N6CA 1AVOB 2A68F 4BEMJ 3RH3A 4PFPA 4BJ1A 2J45A 4DVZA 4EKWA 4OD5A 1YVIA 4XLPA 2X0CA 1J8MF 3GANA 3M4CA 5DS4A 1TWAK 1YX2A 1B4BA 5A69A 2E2HK 3U8PA 1YLMA 1Z5ZA 2CDQA 3PO3C 2R92K 2JA6K 3GTLA 3N2ZB 2R93C 3U3BA 3S29A 4AH6A 5DVWA 5JSLA 1YARO 4B6IA 4QJVB 1R9TC 3HJCA 4U5EE 4WABA 3BP3A 3QZCA 2NVYC 3UR3C 4LLEA 1O2FB 5L0CA 3C7JA 3FKIA 3GEHA 4KI2A 1WCMK 5IYDC 4Y52K 4AE4B 4DOZA 1SYQA 3TOMA 1OCRC 4DBRA 3RQFA 4WJ3M 1O27A 1JOGA 3AGUA 2RH6A 3L0IA 5TMCA 1NZEA 4MEXA 2V6UA 5CIVA 4NC3A 2DYRC 4HEAJ 1QQ3A 4RMFA 2I15A 1EK8A 3HKZL 4YK5A 1TWHC 1B68A 3S84A 2GFHA 2B63K 2ASRA 1DCHA 4KN4A 4Z9IA 2WZGA 3DE8A 3RVYA 3S90A 1OCOC 1EA8A 1DD5A 5AGFA 1T6IA 3T02A 4OD4A 1ISEA 1Q0GA 2XM4A 1DCPA 3I4NK 5E33A 3WAQA 4MTOA 2AWCA 1Z23A 3JSTA 4DRJB 2FAPB 4DRHB 1EH1A 1T9KA 4N6HA 1D1CA 5L0JA 3DJNB 1HW2A 3DAGA 1SFOK 2HKVA 3GM1A 256BA 3VRCA 1CGNA 2CFAB 1MMAA 1BS2A 2R7WA 2XCOA 2Q00A 1WQGA 3EZHA 2OKUA 3QX3A 2Y3GA 2KWAA 5FCLA 3DZAA 3KL4A 2ZUEA 1Q0DA 4K0DA 1WQFA 4KDDA 3HKZD 3OEOA 4CJGA 5A6BD 1J8YF 1CPQA 3H2VA 5JRAA 2LFDA 3NMKA 2GSNA 4CBEA 4C3EA 5A6BA 1PJ6A 3C62A 1OR2A 3L4JA 1INNA 4C3JC 2EINC 4U5BE 4A3CK 2YZSA 4NTFA 2NPUA 1VTMP 2VUMA 2H7BA 3BRJA 2IM8A 4JCZA 1DOWA 4DJ9A 4E18A 4EUKB 2YLGA 5L0HA 4AYBL 3S17C 4C7OB 5B3IA 4JCHA 3AQPA 5L3VA 2YL0A 2Y3DA 1V5VA 4ER9A 4MW8A 3V5ZA 3B29A 3CAXA 2R7SA 3AG2C 2E2HA 1LKXA 3LEVA 4KATA 3PO2K 2LD6A 2V26A 1MNDA 4CJOA 1T5OA 2WVQA 5A6JA 2R92A 4G7HF 1RKEB 4KASA 1ZVUA 3TQOA 1Z6AA 4P6IC 2NVTK 2XS1A 1VLTA 2Q7RA 1OXKA 5T3WA 1UV7A 4R32A 5FLMC 2HSBA 4XWJA 2IYLD 2IBFA 5CJ9A 1WN0A 1M2VA 3U9MA 1WCMA 3TFHA 5C4XK 4JC7A 3HOXC 5C4JC 2GDCA 2MYSA 3H3VD 4KM9A 2IXMA 1TWAC 4BJ6C 1ZZPA 2LCHA 2B63A 3RQGA 2R7UA 5C3EK 2A68A 1K83C 2R92C 2JA6C 1I6HK 3J06A 1WSRA 3KYIA 2ZPAA 2NVXK 3NYJA 2IXOA 4UDVA 1FMVA 1QLEC 3C63A 3F46A 3I5PA 1S7ZA 4JIOA 1NLXA 1WCMC 5JP7A 4AK9A 3WODF 1M2OA 5DLJA 2R7OA 1TWGK 3NKEA 5B1BC 1EQRA 1FFHA 4XEVA 1ZYRF 1BDJB 4H4KC 4LDRA 4BBSK 4JW1A 4J7TA 3TK0A 2UUIA 1I4YA 3CEXA 2RD9A 1O2BA 3JYYA 2O9XA 1DOVA 2WAQD 5IOSA 4KNWA 2YWAA 4KN7A 3E70C 2Q9AA 4BJ5C 3OA1A 2ZXPA 3I4NC 3SZRA 1FFTC 3N24A 3K33A 2XL4A 4BG0A 1WASA 4C3IK 4C3HK 3S1QK 1V55C 3SXKA 2F22A 1VJEA 3L8JA 4AL1A 2XCRB 3L4KA 2Z15A 1SFOC 5DQZA 3AQCA 1A41A 2HMZA 4PFOA 2P1AA 4PJJA 4HFFB 3S27A 4A3DK 3EJNA 1ZW3A 2Q9CA 2J7PD 1F93A 2WZFA 2Q3TA 3VA7A 1OCCC 2WB1D 1BZ4A 2P8TA 2PHCB 1A7VA 4U5CE 4OIRF 4YT8A 2RGRA 3LAYA 1XPPA 2YU9K 1D1AA 4FZBA 4KC9A 3FXHA 5M3FK 2EIJC 5HL8A 4Q5SF 4WJ4A 5HV9A 5IYBK 2GAHC 1WIHA 4A3CC 3LUTB 2V6TA 3CSKA 1JMWA 3NG1A 3NRHA 4LR2A 1WQHA 3ZDLA 4JEBA 4HFKB 1BR4A 3I4UA 3T6BA 3UMHA 3Q7LA 1ZHZA 2CCYA 5F28E 3NUHA 1HI9A 3GTLK 1FR0A 4PACA 4BY7K 3AG3C 4U5DE 5TJ5E 2YVKA 5JVEA 1TWCA 5COGA 4YT5A 2PMZL 1OR3A 1R4TA 3PO2C 2ETSA 1SR2A 1CPRA 3HTKC 2OCCC 3QTHA 2X51A 4H54A 1S05A 2ZXWC 1PD1A 3S1RK 2NVTC 3TOLA 2VCAA 3RW0A 4W8KA 4CS8C 3MX3A 3N3YA 2NSGA 2W4MA 4FESA 3OPFA 5KYNA 3S16K 1WGWA 2E2JC 2WB7A 1ORSC 1V74B 5C4XC 4XSXA 2PX3A 4G7HA 5DS5A 1J6VA 1TWGA 3GM2A 2L81A 2R03A 1L0WA 1Y1VC 4M63A 5A6AA 2JD3A 3A8KA 2JA8K 1XZPA 5IYCK 3IQ6A 5IOTA 4LQYA 3KMIA 2PBEA 4LK1A 1HMOA 3S14K 3A8JA 4MVSA 3S28A 2PA8D 1M2VB 3HNIA 3FOOA 3S15K 3LLIA 4CIHA 4PABA 1I6HC 2YLIA 5JUAA 3O39A 2NVXC 3CAGA 4LACB 3JRMO 1C17M 1GM5A 1LVKA 3ABKC 4E7ZA 4NCQA 4IRUA 3T00A 1PCXA 5EHHA 4CSAC 1BDFA 4AL0A 2D6FC 4A3IK 2YKZA 4GTDA 3AQBA 3GTGA 2KSFA 3TD7A 4BBSC 3L8IA 3PHF2 2M4EA 3S1MK 3JZ0A 1MNEA 1IW7F 3MYFA 4GT9A 1TKNA 3RYLA 4LDQA 3WODA 3GTJK 4CIPA 3UNGC 3FDQA 2YU9A 2VUMK 1ZYRA 4GTBA 3ZC4A 5A6KA 4CS9A 3L1MA 4YJWA 3KPHA 3H0GA 3GTQK 2P61A 1EKYA 5K0IA 1X31C 1OW8A 2EIMC 3S1QC 3QW1A 1JAFA 4JRZA 5BUOA 1KNYA 5BQHA 2J9UA 3IQTA 1RU0A 4CDYA 4P5BA 4ANJA 3IPMO 3AD7C 3HXAA 5E3CA 3K1IA 5KYYA 4BEJA 4IGGA 2ZXRA 5L0DA 4KM8A 4WGZA 2PF4E 4MVQA 2J0WA 1YNNA 4LJZA 2JA5A 4A3DC 1KU2A 3EFOA 2GA0A 2ZUFA 2AU5A 5IP9K 2YQYA 4CDVA 2XL8A 1OQCA 5TMFA 1ZHTA 3LPXA 2YU9C 4CS9C 4BXXK 3RIPA 3X1OA 3TFJA 4KARA 4JTCB 2Y3PA 5IYBC 3PCVA 3U3FA 1M57C 3SXZA 1FNTc 4RDAA 3RZOK 4A3KK 5KYUA 3SZYA 4OIRA 4Z9HA 1O5HA 3I4MK 1HY5A 4DVYP 4BBRK 3U0CA 3R2PA 4Q5SA 3GTLC 4PJNA 4BY7C 2D5RB 1XZQA 4QIWL 4I3MA 4MVOA 3DWWA 3GTPA 2C03A 3EGDA 3O10A 3O55A 4IJJA 4XLNF 3ZQVA 1USMA 4BY1K 3MBGA 3SXYA 4CS7A 1PD0A 4U5GA 2L7AA 3C8GD 3FKIC 1TWFA 1O29A 1AUEA 3TTGA 3S1RC 4O6MA 4OIOF 1PJ5A 2FFHA 1OXBA 2VCCA 2VB6A 3M1CB 4MTGA 2E2IA 2HFIA 1U6HA 4XPXA 1SF8A 1YCLA 4KB2A 3DXJF 4U9EA 4IARA 3LESA 1ZHXA 4C45A 1WOLA 3T6GB 4CX9A 1D0ZA 3HOWC 3IEEA 3UMKA 2ZFZA 1I50K 2A0UA 2XLWA 5IYCC 4Y7NC 2D4UA 4QIWD 2L6FA 1VB5A 3EHMA 3Q6MA 3GTJA 3S15C 3JRTA 2XCQA 3EH2A 3A8IA 1RJ9B 2HJ3A 2XSEA 3JTLO 4O7GA 1V54C 1YJGA 4A3LK 1D1BA 1I4ZA 1Y6DA 3GTQA 1NU7D 1YA9A 2OQMA 5E3AA 2A6HF 3ZQYA 3ZTMA 2R7VA 4G7ZF 1MMGA 3HOZK 5TJ3A 3H3VL 1H7IA 3A9CA 3DM9B 5KYWB 4A3EK 4A3IC 4MTFA 1F7VA 1HE1A 2NUTB 3HNJA 1ST6A 4EBBA 3UGOA 3EZIA 4ZLDA 3M15A 3HOVK 3S1MC 2JPUA 3GTKA 3L34A 1VLOA 3U2LA 3ITFA 3DAFA 1BGWA 2G3VA 2O5IA 2Y3HA 2P6VA 2PX0A 3EGXA 2Q9BA 3GTJC 4JE9A 2G62A 1G4US 3BEHA 2VUMC 1HE9A 1NG1A 3JSZA 1FMWA 3DE9A 1PJ7A 3RQEA 5T3TA 3RFYA 1IW7A 1QZXA 5EK0A 3ZVRA 4O79A 3AOUA 4MVMA 2XXAA 2R05A 4P9SA 2AP3A 2OJED 5L3QA 1E2XA 3ERED 4G0HA 4JK1A 2HV6A 1TWCK 1WOSA 2E2HC 4BLAA 2WAQL 3JYHA 2MWQA 3N0BA 4KNVA 1O24A 2XLHA 3Q6NA 2XLEA 3ASOC 1SZIA 4Q7CA 5IP9C 2DGJA 3W4YA 3FMSA 4ULVA 4GQHA 4KBLA 2HS5A 5KYXA 3NMIA 4DRIB 3Q7GA 4GTLA 4N06A 4BXXC 4Y52C 1YYXA 3W2VA 5KYYB 5DQTA 1WOPA 1SMYF 1L7CA 3TJ6A 3EFOB 2A69F 3U5SA 3T4RA 2CW0F 4YFXA 2J0XA 2H7VC 4O6YA 3RZOC 4A3KC 4YL3A 3I4MC 1AEPA 3LNRA 2WB1L 5M5XK 4PK4A 4BBRC 1VYIA 2B63C 1C0AA 4Z9JA 2GAGC 3LAJA 3UMIA 1CGOA 1I50A 1UFBA 2KYHA 1WORA 1C02A 3GTOA 1YZAA 2H7OA 3G4ZA 1L3PA 4A3BK 3TFIA 5KYUB 4E0HA 3W8IA 2ICWG 3FHZA 5BQGA 1A0BA 1O26A 1XZQB 3SEOA 3B0VC 3GTGK 4FM9A 2GWWA 4XLNA 1LS1A 4JTAB 3HNKA 2HUJA 5AC5A 4MEYA 2KW3C 2CYDA 1I3QA 3IQCA 1E86A 3LNMB 3B9QA 4OIOA 4EIYA 3LAPA 1Z7Qc 3EQLF 1U89A 4EHPA 1LE2A 4EBJA 5E2QA 2J7PA 3V7OA 1I50C 3PDMP 1AB4A 1N1CA 3S9OA 3HKKA 2VASA 3DXJA 1YYJA 2IXNA 2LP4A 3H0GK 2Y0SD 1E83A 2R7ZA 2NG1A 1O2AA 1E85A 2M64A 2DI3A 4XPWA 4A3LC 1PV3A 2YEVA 2JA5K 4MW3A 2O5JA 5COFA 3HOZC 4JEAA 1G4WR 3WHNA 3EH1A 4N4WA 5EGHA 4A3EC 4C3DA 1LM3B 3IPJA 2KK1A 2PA8L 1TWHK 3GEIA 1OKKD 4EWCA 3V4GA 3HOVC 1VYKA 2EILC 2A6HA 2JA7A 4NOIA 4G7ZA 4P9TA 2R7QA 1OKKA 2L9JA 4A4AA 5EGYA 2P5MA 4KMAA 1K04A 4X0RA 5DS6A 4JZAA 4YL0A 1JQWA 2GSUA 4YFNA 4A3GK 1YNJA 3ASNC 3FOPA 4OIPF 3ADAC 1VMAA 5FJ8K 3EGXB 1H9TA 3AGTA 4KMDA 3JCUQ 4J7YA 3GTPK 4W8PA 1TWCC 1OW7A 1C03A 4A3FK 5C3EC 4JJFA 1Z63A 1IBAA 5C44K 2R25A 3RF3A 5D4DA 1TWFK 4Q4ZF 4PJLA 4XCHA 4ZH4A 1TFKB 5CHPA 4ULWA 4A93K 4XTKA 4GTAA 4DXWA 5IY5C 4ILDA 3V5YA 2E2IK 3EPVA 4GYTA 2Y3BA 1DCOA 4KAWX 3FVYA 1J98A 2VC9A 5L0GA 4U9DA 2A0BA 1TWGC 2Y69C 1XWJA 2LK4A 4XQ1A 3G4AA 4A3MK 3OREA 1KTMA 2PFDA 3T6JA 5KYXB 3Q3QA 2PPBA 2OJQA 3DKAA 3B71A 1JRAA 1JR8A 4E17A 1HMDA 4XSZA 1SMYA 1Y1WK 3G4CA 3S1NK 2WL8A 2A69A 2R93A 2YHSA 2CW0A 5FZTA 3W8HA 5HSWA 1G8XA 3M4BA 4MQ9F 4XEFA 1YA7O 4LLGA 4FAPB 4C3IC 1IE0A 1USOA 1R9TA 4C3HC 2DB4A 4JJGA 4A3BC 2OG2A 5IP7K 1MMNA 2NVYA 5F5HA 2ZXOA 4EBKA 2R7TA 3S2DK 2HMQA 4GFQA 4BLBA 4G7OF 3B0UX 3T01A 1XXCA 4I1MA 4PJMA 3HOXK 5C4JK 3HOUK 3GTGC 3FHDA 2A6EF 4RD9A 3CQZK 1K05A 1ORYA 5JFEA 1WOOA 4BKWA 2QTVA 3GTKK 2XLOA 5B3SC 1FTSA 3SP1A 5IOQA 5M5YK 1XXBA 1ORJA 4D4NA 3X2QC 1TWHA 1XXAA 3IHUA 4MS2A 2B0JA 2EPOA 1K83K 4GTFA 4BPMA 4WILA 3MYIA 3NDBB 3EHNA 1VH2A 4J32B 4YL1A 3U2MA 2GAQA 3H0GC 1EQ1A 1HQMA 2OEVA 2XS8A 3PMRA 2EPKX 3EQLA 1Q0KA 5L0FA 1KQ4A 1EI6A 3RZDK 5BQIA 5JT4A 3JT1A 4QDLA 1QPUA 1LS4A 4O6NA 4DDQA 4NY3A 2ZD9A 4P5AA 3K1IC 1YAUO 2JA5C 3ZWIA 2XM0A 3K66A 2LSEA 2E87A 4OIQF 3FAPB 2XLDA 3S2HK 3VM6A 3W2WA 3G4XA 1JOEA 2QNLA 3BP8C 1RCPA 5JS5A 4QI0A 3FAJA 2G3KA 1ZU4A 3SXMA 1TR2A 3H65A 2NSFA 4K1OA 1LIHA 1APCA 3O6XA 3C8GA 1GQAA 3C18A 3S16C 4JTDB 3EG9A 2WVNA 2J9WA 1OCZC 4A3GC 4YT2A 4IAOA 1LI7A 1R5ID 2LQGA 4KC6A 2YL7A 3AD9C 3HNLA 2JA8C 2FQTA 2LIGA 3HOYK 3UGPA 1HW1A 2YLDA 2W45A 3G50A 3GTOK 3GTPC 1TQGA 2P7VA 1Z3IX 3MFNA 3M79A 3S14C 1T01A 2NUPA 3KYJA 4A3FC 4WGYA 1ZW2A 2CGEA 1Y1WA 5C44C 4GEHA 4QI2A 4OIPA 3TULA 1TWFC 2XLVA 3AH5A 2AVKA 3GWLA 3DJUB 3TJ5A 4M1XA 4A93C 1XZPB 1K40A 1NSGB 3R7CA 4LK0A 4A3JK 4G78A 3K7DA 2E2IC 1JPNA 2J9BA 1WATA 1I6VA 2MHRA 3VAYA 1Q0FA 1I3QK 3I5QA 4NTAA 4D4XA 4Q4ZA 4U5FE 1G51A 3K7AK 2NVQK 3GEEA 4A3MC 3CQZA 3ABMC 2P0NA 3E9VA 1BR2A 4K7BA 2H8AA 4YWQA 3AJMA 5L0IA 3AD8C 1TWAA 2EPLX 4BJ6A 1QSPA 1H6GA 4YN0B 4RBNA 1OW6A 1Y1WC 3S1NC 2R7ZK 1K83A 2JA6A 3DMDA 1NU9C 4IWBA 4KMUA 2FGYA 5IORA 1W2WA 1G5ZA 2FQOA 3POVA 3LEOA 3M3YK 3ZTZA 3GTQC 5IP7C 3GM3A 2VCBA 3S2DC 1T6UA 2I8BA 3GSIA 3IQ5A 4NTBA 2E2JK 3N0CA 4LOWA 4AYBD 4MQ9A 2YL3A 1ZBSA 4FWVA 1J6WA 4MVZA 3HOUC 2BL2A 3ATPA 2XL6A 3CQZC 3SYNA 1BBHA 4HE8D 1Y1VK 2TMVP 3GTKC 2JA7K 4YT4A 4JKVA 1A7DA 3ZG1A 1I5NA 3DD7A 4LDKA 4G7OA 3GWNA 2B0HA 3LJBA 2J8WA 1E84A 2EPMX 1V4AA 2PP4A 1ZU5A 2HV7A 4C2MK 4BJ5A 4AX2A 2A6EA 4I1OB 3S0XA 4GTCA 5GPGB 4YG2A 1B4AA 4LERA 4OINF 5L46A 3VYWA 2WVOA 3V5XA 5M3MK 1WSVA 4I44A 2KGOA 1ZHYA 3NKDA 2BE5F 3RZDC 2A1DD 1SFOA 2KC3A 2R02A 3GTMK 4G0VA 2XRHA 4O2DA 1ZVZA 4MVUA 5CI8A 5CI9A 2Q4FA 2IOQA 3GORA 4X6AK 3B0PA 1YDIA 4JVSA 1JVIA 2CNWD 2OOCA 2QLAA 2HSQA 3M4OK 2AWYA 3T9OA 3S2HC 1WTYA 4C3BA 2Y0SL 1WWPA 2VH3A 4BY1C 5E68A 2OEXA 2CNWA 5COMA 1NFOA 4XLPF 1BJTA 1CGME 3AG1C 2R7XA 4NQFA 2V3CC 4ONSA 1IZMA 4A2NB 4OIQA 4E0IA 4FX5A 1RKCA 3EGDB 2R7RA 1EFWA 4QJVA 5JLIA 3WG7C 1EI7A 4G0UA 1NBBA 4IAQA 4GZYA 2W7VA 4P9FA 3OEPA 2XLMA 1QVXA 5F5FA 1LI5A 3JSEO 2RSEB 4AE4A 1ZXOA 3US6A 3HOYC 3PO3K 1GS9A 2R93K 1A7EA 2V6SA 3C8GB 3GTOC 2EIKC 3U9JA 1BR1A 1R9TK 3EG9B 1H9GA 3N0TA 1ZQ1C 2NVYK 1LPEA 1JPJA 5B1AC 1T6QA 3DM5A 5T1DB 4MVRA 2R9RB 3HLZA 3LS0A 4LLCA 1M6TA
chains in the Genus database with same CATH topology
2FFHA 2IXMA 4ZLCA 1MMDA 2VB6A 3FOFA 4CS8A 4BJ6C 2KNHA 3CZ6A 3M1CB 2B63A 2R7UA 2E2IA 2KQ9A 2Y39A 3G4CA 2QY9A 2WL8A 2NUPB 1SF8A 2ZPAA 2R93A 4KB2A 2YHSA 3DXJF 5HSWA 3W8HA 3NYJA 2IXOA 1G8XA 4MQ9F 3LESA 1ZHXA 4C3IC 1R9TA 4C3HC 4JJGA 1FMVA 1QLEC 2OG2A 1D0ZA 3F46A 2W4BA 4G0WA 3I5PA 3IEEA 3UMKA 1MMNA 3RKOF 2NVYA 2ZFZA 5F5HA 2ZXOA 2R7TA 3BUEA 4GTEA 1S7ZA 4GFQA 1Y1VA 2J46A 4BLBA 2CFAA 4G7OF 3B0UX 4J30B 4AK9A 3WODF 1M2OA 1XXCA 3K1HA 4I1MA 4PJMA 2R7OA 5DLJA 3EHMA 3NKEA 3Q6MA 5B1BC 3GTJA 1FFHA 1ZYRF 3FHDA 2A6EF 4RD9A 3JRTA 1F9NA 4H4KC 5JFEA 2XCQA 3EH2A 3AG4C 4JW1A 4BKWA 1O25A 2NVXA 1RJ9B 2QTVA 5B3SC 2XSEA 1FTSA 3SP1A 5IOQA 4O7GA 1O2BA 1V54C 1XXBA 1D1BA 2O9XA 3X2QC 3GTQA 1NU7D 1TWHA 1XXAA 4BJTA 5E3AA 2A6HF 5IOSA 2R7VA 2B0JA 4KNWA 1M56C 1MMGA 4MNDA 4G7ZF 3E70C 4GTFA 2Q9AA 4BJ5C 4J3NA 5TJ3A 3OA1A 2ZXPA 1VOMA 3DM9B 3NDBB 3EHNA 3SZRA 1FFTC 5KYWB 4CSAA 4J32B 4KB4A 3N24A 3K33A 2KJGA 2XL4A 4BG0A 3GTMA 2NUTB 2W9YA 3F47A 1RJ9A 1ST6A 3PMRA 3NYMA 4EBBA 3UGOA 1IS1A 3AQOA 4C7OA 1V55C 3EZIA 4ZLDA 1KQ4A 3GTKA 3L34A 2XCRB 3L4KA 3ITFA 3DAFA 2Z15A 1BGWA 3JT1A 2G3VA 2XXAB 4QDLA 2Y3HA 4F4BA 2P6VA 4O6NA 4DDQA 2PX0A 3EGXA 4NY3A 2Q9BA 5DQZA 3AQCA 4P5AA 3K1IC 2J9VA 2G62A 3KKBA 5KYWA 4C2MC 4PFOA 5D92A 4PJJA 4HFFB 3K66A 1O87A 3S27A 2WZLA 3SNHA 1GE9A 1NG1A 3EJNA 3JSZA 2Q9CA 2LSEA 5D91A 2NUTA 2E87A 2J7PD 1FMWA 4OIQF 2WZFA 2Q3TA 2GSOA 3VA7A 1OCCC 4WJ0A 3W2WA 3GODA 3FOEA 4DBQA 5T3TA 3RFYA 4OIOF 1QZXA 2C04A 4U5HA 3ZVRA 3K6BA 4O79A 2JH3A 5EGEA 2PHCB 4QI0A 2XXAA 4U5CE 4OIRF 3FAJA 4YT8A 2RGRA 2G3KA 3LAYA 1ZU4A 1D1AA 1TR2A 3H65A 4KC9A 4FZBA 3QMKA 5L3QA 4E7SA 2EIJC 3LLKA 3ERED 4Q5SF 4G0HA 1D0YA 2HV6A 3ABLC 3O6XA 4BLAA 1WIHA 3OWTA 3JYHA 2MWQA 3N0BA 1VK5A 4KNVA 4KMHA 3CSKA 1O24A 3NG1A 1O28A 3NRHA 3EG9A 4LR2A 2WVNA 1WQHA 3Q6NA 3ASOC 1SZIA 2J9WA 1OCZC 4Q7CA 3MLGA 4HFKB 1BR4A 2DGJA 3I4UA 3T6BA 2IXPA 3UMHA 3Q7LA 1ZHZA 4IAOA 4YT2A 5JVOA 1ZHWA 3ZSUA 4KBLA 3NYLA 4JURI 5KYXA 3ECSA 1D0XA 3Q7GA 3NUHA 4KC6A 3KH2A 3MMLB 3LS1A 2DYSC 3UGPA 4GTLA 4N06A 3AG3C 4U5DE 2W45A 3W2VA 5KYYB 5DQTA 1SMYF 1Z3IX 2P7VA 3ZIBA 2NUPA 1TWCA 4YT5A 3EFOB 2A68F 3RH3A 2A69F 2CGEA 4PFPA 4BJ1A 3T4RA 1Y1WA 2CW0F 4GEHA 4QI2A 2J45A 2J0XA 3HTKC 2OCCC 4DVZA 2H7VC 2X51A 4O6YA 2ZXWC 4OD5A 3AH5A 1PD1A 3DJUB 1J8MF 3GANA 5DS4A 4M1XA 4W8KA 3LNRA 4PK4A 4CS8C 3MX3A 1B4BA 1VYIA 3N3YA 3K7DA 3LAJA 3UMIA 4FESA 2W4MA 1JPNA 3OPFA 5KYNA 1Z5ZA 2CDQA 1I50A 1WGWA 3GTLA 3N2ZB 2WB7A 3S29A 3VAYA 5DVWA 2PX3A 3GTOA 4B6IA 3I5QA 2H7OA 5DS5A 3HJCA 4U5FE 4U5EE 1TWGA 5KYUB 3QZCA 3UR3C 4LLEA 2L81A 3CQZA 3ABMC 4M63A 3W8IA 2JD3A 3E9VA 1BR2A 3FKIA 4K7BA 3FHZA 4KI2A 5IOTA 4YWQA 4LQYA 3KMIA 4AE4B 1TWAA 4DOZA 1O26A 1OCRC 4DBRA 3S28A 4BJ6A 1M2VB 3SEOA 3B0VC 4YN0B 1O27A 4RBNA 3LLIA 4CIHA 4FM9A 1LS1A 1K83A 2JA6A 3DMDA 3O39A 1NU9C 4IWBA 2RH6A 2FGYA 5IORA 3L0IA 3CAGA 4LACB 1NZEA 1W2WA 2KW3C 1I3QA 3POVA 2DYRC 4HEAJ 3B9QA 1EK8A 3LAPA 1LVKA 3ABKC 3EQLF 4E7ZA 2GFHA 5E2QA 2WZGA 2J7PA 1OCOC 3V7OA 2I8BA 4IRUA 1AB4A 1N1CA 1DD5A 1PCXA 4OD4A 1ISEA 5EHHA 4CSAC 5E33A 3N0CA 2VASA 4GTDA 2IXNA 1ZBSA 4FWVA 3AQBA 3GTGA 3SYNA 3TD7A 2R7ZA 1Z23A 2NG1A 1O2AA 1EH1A 4HE8D 3PHF2 1D1CA 2M4EA 4YT4A 3DJNB 3ZG1A 1MNEA 3DAGA 1IW7F 3DD7A 4GT9A 1TKNA 3RYLA 2CFAB 1MMAA 2R7WA 3LJBA 2XCOA 1WQGA 3EZHA 2YEVA 2PP4A 1ZU5A 3UNGC 2HV7A 3QX3A 3FDQA 2Y3GA 2YU9A 3EH1A 2KWAA 5FCLA 3ZC4A 4BJ5A 4AX2A 4GTBA 3DZAA 5EGHA 4CS9A 3KL4A 4I1OB 3S0XA 4GTCA 4K0DA 1WQFA 4YJWA 1B4AA 4KDDA 4C3DA 4LERA 3H0GA 3OEOA 4OINF 3VYWA 2WVOA 1J8YF 1OKKD 2EIMC 4EWCA 3V4GA 4I44A 2KGOA 1ZHYA 3NKDA 5BUOA 1VYKA 2BE5F 2J9UA 2EILC 2JA7A 4P5BA 2GSNA 4ANJA 2R7QA 4CBEA 2A1DD 4C3EA 1SFOA 1OKKA 3L4JA 4G0VA 2XRHA 4C3JC 2EINC 4U5BE 2L9JA 5CI8A 5E3CA 2YZSA 5EGYA 2P5MA 5CI9A 5KYYA 4BEJA 2ZXRA 2IOQA 4KM8A 4KMAA 2PF4E 3B0PA 2J0WA 4JVSA 4X0RA 2JA5A 5DS6A 1KU2A 2CNWD 4JZAA 2H7BA 2VUMA 3EFOA 2GSUA 4C7OB 4JCHA 4C3BA 3ASNC 4OIPF 2VH3A 3AQPA 5L3VA 2CNWA 1ZHTA 2Y3DA 1VMAA 4XLPF 1BJTA 3LPXA 3EGXB 3AG1C 4KMDA 3JCUQ 4CS9C 2R7XA 2V3CC 3RIPA 3X1OA 1IZMA 4A2NB 4KARA 2Y3PA 1M57C 3AG2C 2R7SA 2E2HA 1LKXA 4JJFA 3LEVA 4FX5A 4KATA 2V26A 1Z63A 1MNDA 3EGDB 2WVQA 2R7RA 2R92A 4RDAA 3WG7C 4G7HF 4G0UA 4KASA 4Q4ZF 4PJLA 5KYUA 1ZVUA 1O5HA 1Z6AA 4P6IC 5CHPA 4ULWA 4DVYP 3OEPA 5F5FA 4XTKA 4GTAA 5T3WA 5IY5C 4ILDA 3EPVA 4GYTA 2Y3BA 4XWJA 4AE4A 1ZXOA 2IYLD 4KAWX 3FVYA 4PJNA 2D5RB 5CJ9A 1M2VA 1WCMA 4I3MA 3GTPA 2EIKC 1BR1A 2C03A 3EGDA 3EG9B 2Y69C 4IJJA 4XLNF 3N0TA 3G4AA 1JPJA 3OREA 5B1AC 1PD0A 4U5GA 2MYSA 4CS7A 3DM5A 2PFDA 5T1DB 1TWFA 1O29A 3HLZA 3T6JA 3LS0A 4O6MA 4KM9A 5KYXB 4LLCA 3Q3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0X A; 
#chains in the Genus database with same CATH topology
 5IYD K;  4ZLC A;  2EPN A;  1MMD A;  3FOF A;  4CS8 A;  4A3J C;  2KNH A;  3QVY A;  3CZ6 A;  2KQ9 A;  2Y39 A;  2OU6 A;  2QY9 A;  1Y4C A;  2NUP B;  5AC4 A;  3GDZ A;  1I3Q C;  2QUP A;  3RVZ A;  3K7A C;  2JX0 A;  4G0W A;  2W4B A;  2NVQ C;  1TFO B;  3RKO F;  3BUE A;  4GTE A;  1Y1V A;  2J46 A;  2CFA A;  1U0B B;  4L6R A;  4J30 B;  1VLS A;  1YZC A;  2L6H A;  3K1H A;  2UUH A;  1J6X A;  3GIR A;  3SZZ A;  2R7Z C;  2YL1 A;  1IL2 A;  1F9N A;  1VGX A;  4PAA A;  3AG4 C;  1O25 A;  2NVX A;  1LE4 A;  3FKI K;  1F7U A;  3M3Y C;  2LFF A;  2EBB A;  4BJT A;  4CDA A;  3VF0 A;  4IB4 A;  4MND A;  1M56 C;  1RXQ A;  4J3N A;  1VOM A;  4CSA A;  4KB4 A;  2KJG A;  3GTM A;  3A11 A;  1F1M A;  1IQ0 A;  2W9Y A;  3F47 A;  3U8V A;  3HOW K;  1RJ9 A;  2BC5 A;  3NYM A;  1IS1 A;  3AQO A;  4C7O A;  2JA7 C;  2L6G A;  3QVZ A;  4Y7N K;  2HZ8 A;  3QW0 A;  2XXA B;  4YFK A;  4F4B A;  2PMZ D;  3H2U A;  4C3J K;  2J9V A;  3KKB A;  5KYW A;  4C2M C;  5D92 A;  3C8Z A;  1VRQ C;  2HJM A;  1O87 A;  3SNH A;  2WZL A;  1GE9 A;  2NUT A;  5D91 A;  2YRF A;  1NFN A;  2GSO A;  3S17 K;  2PNO A;  4WJ0 A;  3GOD A;  1RKE A;  3FOE A;  4DBQ A;  2C04 A;  4U5H A;  3K6B A;  2JH3 A;  1Q0M A;  5EGE A;  1QKR A;  3QMK A;  3DI5 A;  4E7S A;  3LLK A;  3GTM C;  1D0Y A;  4XPY A;  3ABL C;  1MQV A;  3OWT A;  1VK5 A;  4KMH A;  4X6A C;  1O28 A;  4OIN A;  3NMJ A;  3M4O C;  2QE9 A;  1GGQ A;  3MLG A;  2BE5 A;  2IXP A;  1FAP B;  5JVO A;  1ZHW A;  4XEK A;  3ZSU A;  3NYL A;  1RMV A;  4JUR I;  3ECS A;  5M5W K;  1D0X A;  5FLM K;  1O3U A;  3KH2 A;  3MML B;  4PR9 A;  3LS1 A;  2DYS C;  1UG7 A;  3ZIB A;  4N6C A;  1AVO B;  2A68 F;  4BEM J;  3RH3 A;  4PFP A;  4BJ1 A;  2J45 A;  4DVZ A;  4EKW A;  4OD5 A;  1YVI A;  4XLP A;  2X0C A;  1J8M F;  3GAN A;  3M4C A;  5DS4 A;  1TWA K;  1YX2 A;  1B4B A;  5A69 A;  2E2H K;  3U8P A;  1YLM A;  1Z5Z A;  2CDQ A;  3PO3 C;  2R92 K;  2JA6 K;  3GTL A;  3N2Z B;  2R93 C;  3U3B A;  3S29 A;  4AH6 A;  5DVW A;  5JSL A;  1YAR O;  4B6I A;  4QJV B;  1R9T C;  3HJC A;  4U5E E;  4WAB A;  3BP3 A;  3QZC A;  2NVY C;  3UR3 C;  4LLE A;  1O2F B;  5L0C A;  3C7J A;  3FKI A;  3GEH A;  4KI2 A;  1WCM K;  5IYD C;  4Y52 K;  4AE4 B;  4DOZ A;  1SYQ A;  3TOM A;  1OCR C;  4DBR A;  3RQF A;  4WJ3 M;  1O27 A;  1JOG A;  3AGU A;  2RH6 A;  3L0I A;  5TMC A;  1NZE A;  4MEX A;  2V6U A;  5CIV A;  4NC3 A;  2DYR C;  4HEA J;  1QQ3 A;  4RMF A;  2I15 A;  1EK8 A;  3HKZ L;  4YK5 A;  1TWH C;  1B68 A;  3S84 A;  2GFH A;  2B63 K;  2ASR A;  1DCH A;  4KN4 A;  4Z9I A;  2WZG A;  3DE8 A;  3RVY A;  3S90 A;  1OCO C;  1EA8 A;  1DD5 A;  5AGF A;  1T6I A;  3T02 A;  4OD4 A;  1ISE A;  1Q0G A;  2XM4 A;  1DCP A;  3I4N K;  5E33 A;  3WAQ A;  4MTO A;  2AWC A;  1Z23 A;  3JST A;  4DRJ B;  2FAP B;  4DRH B;  1EH1 A;  1T9K A;  4N6H A;  1D1C A;  5L0J A;  3DJN B;  1HW2 A;  3DAG A;  1SFO K;  2HKV A;  3GM1 A;  256B A;  3VRC A;  1CGN A;  2CFA B;  1MMA A;  1BS2 A;  2R7W A;  2XCO A;  2Q00 A;  1WQG A;  3EZH A;  2OKU A;  3QX3 A;  2Y3G A;  2KWA A;  5FCL A;  3DZA A;  3KL4 A;  2ZUE A;  1Q0D A;  4K0D A;  1WQF A;  4KDD A;  3HKZ D;  3OEO A;  4CJG A;  5A6B D;  1J8Y F;  1CPQ A;  3H2V A;  5JRA A;  2LFD A;  3NMK A;  2GSN A;  4CBE A;  4C3E A;  5A6B A;  1PJ6 A;  3C62 A;  1OR2 A;  3L4J A;  1INN A;  4C3J C;  2EIN C;  4U5B E;  4A3C K;  2YZS A;  4NTF A;  2NPU A;  1VTM P;  2VUM A;  2H7B A;  3BRJ A;  2IM8 A;  4JCZ A;  1DOW A;  4DJ9 A;  4E18 A;  4EUK B;  2YLG A;  5L0H A;  4AYB L;  3S17 C;  4C7O B;  5B3I A;  4JCH A;  3AQP A;  5L3V A;  2YL0 A;  2Y3D A;  1V5V A;  4ER9 A;  4MW8 A;  3V5Z A;  3B29 A;  3CAX A;  2R7S A;  3AG2 C;  2E2H A;  1LKX A;  3LEV A;  4KAT A;  3PO2 K;  2LD6 A;  2V26 A;  1MND A;  4CJO A;  1T5O A;  2WVQ A;  5A6J A;  2R92 A;  4G7H F;  1RKE B;  4KAS A;  1ZVU A;  3TQO A;  1Z6A A;  4P6I C;  2NVT K;  2XS1 A;  1VLT A;  2Q7R A;  1OXK A;  5T3W A;  1UV7 A;  4R32 A;  5FLM C;  2HSB A;  4XWJ A;  2IYL D;  2IBF A;  5CJ9 A;  1WN0 A;  1M2V A;  3U9M A;  1WCM A;  3TFH A;  5C4X K;  4JC7 A;  3HOX C;  5C4J C;  2GDC A;  2MYS A;  3H3V D;  4KM9 A;  2IXM A;  1TWA C;  4BJ6 C;  1ZZP A;  2LCH A;  2B63 A;  3RQG A;  2R7U A;  5C3E K;  2A68 A;  1K83 C;  2R92 C;  2JA6 C;  1I6H K;  3J06 A;  1WSR A;  3KYI A;  2ZPA A;  2NVX K;  3NYJ A;  2IXO A;  4UDV A;  1FMV A;  1QLE C;  3C63 A;  3F46 A;  3I5P A;  1S7Z A;  4JIO A;  1NLX A;  1WCM C;  5JP7 A;  4AK9 A;  3WOD F;  1M2O A;  5DLJ A;  2R7O A;  1TWG K;  3NKE A;  5B1B C;  1EQR A;  1FFH A;  4XEV A;  1ZYR F;  1BDJ B;  4H4K C;  4LDR A;  4BBS K;  4JW1 A;  4J7T A;  3TK0 A;  2UUI A;  1I4Y A;  3CEX A;  2RD9 A;  1O2B A;  3JYY A;  2O9X A;  1DOV A;  2WAQ D;  5IOS A;  4KNW A;  2YWA A;  4KN7 A;  3E70 C;  2Q9A A;  4BJ5 C;  3OA1 A;  2ZXP A;  3I4N C;  3SZR A;  1FFT C;  3N24 A;  3K33 A;  2XL4 A;  4BG0 A;  1WAS A;  4C3I K;  4C3H K;  3S1Q K;  1V55 C;  3SXK A;  2F22 A;  1VJE A;  3L8J A;  4AL1 A;  2XCR B;  3L4K A;  2Z15 A;  1SFO C;  5DQZ A;  3AQC A;  1A41 A;  2HMZ A;  4PFO A;  2P1A A;  4PJJ A;  4HFF B;  3S27 A;  4A3D K;  3EJN A;  1ZW3 A;  2Q9C A;  2J7P D;  1F93 A;  2WZF A;  2Q3T A;  3VA7 A;  1OCC C;  2WB1 D;  1BZ4 A;  2P8T A;  2PHC B;  1A7V A;  4U5C E;  4OIR F;  4YT8 A;  2RGR A;  3LAY A;  1XPP A;  2YU9 K;  1D1A A;  4FZB A;  4KC9 A;  3FXH A;  5M3F K;  2EIJ C;  5HL8 A;  4Q5S F;  4WJ4 A;  5HV9 A;  5IYB K;  2GAH C;  1WIH A;  4A3C C;  3LUT B;  2V6T A;  3CSK A;  1JMW A;  3NG1 A;  3NRH A;  4LR2 A;  1WQH A;  3ZDL A;  4JEB A;  4HFK B;  1BR4 A;  3I4U A;  3T6B A;  3UMH A;  3Q7L A;  1ZHZ A;  2CCY A;  5F28 E;  3NUH A;  1HI9 A;  3GTL K;  1FR0 A;  4PAC A;  4BY7 K;  3AG3 C;  4U5D E;  5TJ5 E;  2YVK A;  5JVE A;  1TWC A;  5COG A;  4YT5 A;  2PMZ L;  1OR3 A;  1R4T A;  3PO2 C;  2ETS A;  1SR2 A;  1CPR A;  3HTK C;  2OCC C;  3QTH A;  2X51 A;  4H54 A;  1S05 A;  2ZXW C;  1PD1 A;  3S1R K;  2NVT C;  3TOL A;  2VCA A;  3RW0 A;  4W8K A;  4CS8 C;  3MX3 A;  3N3Y A;  2NSG A;  2W4M A;  4FES A;  3OPF A;  5KYN A;  3S16 K;  1WGW A;  2E2J C;  2WB7 A;  1ORS C;  1V74 B;  5C4X C;  4XSX A;  2PX3 A;  4G7H A;  5DS5 A;  1J6V A;  1TWG A;  3GM2 A;  2L81 A;  2R03 A;  1L0W A;  1Y1V C;  4M63 A;  5A6A A;  2JD3 A;  3A8K A;  2JA8 K;  1XZP A;  5IYC K;  3IQ6 A;  5IOT A;  4LQY A;  3KMI A;  2PBE A;  4LK1 A;  1HMO A;  3S14 K;  3A8J A;  4MVS A;  3S28 A;  2PA8 D;  1M2V B;  3HNI A;  3FOO A;  3S15 K;  3LLI A;  4CIH A;  4PAB A;  1I6H C;  2YLI A;  5JUA A;  3O39 A;  2NVX C;  3CAG A;  4LAC B;  3JRM O;  1C17 M;  1GM5 A;  1LVK A;  3ABK C;  4E7Z A;  4NCQ A;  4IRU A;  3T00 A;  1PCX A;  5EHH A;  4CSA C;  1BDF A;  4AL0 A;  2D6F C;  4A3I K;  2YKZ A;  4GTD A;  3AQB A;  3GTG A;  2KSF A;  3TD7 A;  4BBS C;  3L8I A;  3PHF 2;  2M4E A;  3S1M K;  3JZ0 A;  1MNE A;  1IW7 F;  3MYF A;  4GT9 A;  1TKN A;  3RYL A;  4LDQ A;  3WOD A;  3GTJ K;  4CIP A;  3UNG C;  3FDQ A;  2YU9 A;  2VUM K;  1ZYR A;  4GTB A;  3ZC4 A;  5A6K A;  4CS9 A;  3L1M A;  4YJW A;  3KPH A;  3H0G A;  3GTQ K;  2P61 A;  1EKY A;  5K0I A;  1X31 C;  1OW8 A;  2EIM C;  3S1Q C;  3QW1 A;  1JAF A;  4JRZ A;  5BUO A;  1KNY A;  5BQH A;  2J9U A;  3IQT A;  1RU0 A;  4CDY A;  4P5B A;  4ANJ A;  3IPM O;  3AD7 C;  3HXA A;  5E3C A;  3K1I A;  5KYY A;  4BEJ A;  4IGG A;  2ZXR A;  5L0D A;  4KM8 A;  4WGZ A;  2PF4 E;  4MVQ A;  2J0W A;  1YNN A;  4LJZ A;  2JA5 A;  4A3D C;  1KU2 A;  3EFO A;  2GA0 A;  2ZUF A;  2AU5 A;  5IP9 K;  2YQY A;  4CDV A;  2XL8 A;  1OQC A;  5TMF A;  1ZHT A;  3LPX A;  2YU9 C;  4CS9 C;  4BXX K;  3RIP A;  3X1O A;  3TFJ A;  4KAR A;  4JTC B;  2Y3P A;  5IYB C;  3PCV A;  3U3F A;  1M57 C;  3SXZ A;  1FNT c;  4RDA A;  3RZO K;  4A3K K;  5KYU A;  3SZY A;  4OIR A;  4Z9H A;  1O5H A;  3I4M K;  1HY5 A;  4DVY P;  4BBR K;  3U0C A;  3R2P A;  4Q5S A;  3GTL C;  4PJN A;  4BY7 C;  2D5R B;  1XZQ A;  4QIW L;  4I3M A;  4MVO A;  3DWW A;  3GTP A;  2C03 A;  3EGD A;  3O10 A;  3O55 A;  4IJJ A;  4XLN F;  3ZQV A;  1USM A;  4BY1 K;  3MBG A;  3SXY A;  4CS7 A;  1PD0 A;  4U5G A;  2L7A A;  3C8G D;  3FKI C;  1TWF A;  1O29 A;  1AUE A;  3TTG A;  3S1R C;  4O6M A;  4OIO F;  1PJ5 A;  2FFH A;  1OXB A;  2VCC A;  2VB6 A;  3M1C B;  4MTG A;  2E2I A;  2HFI A;  1U6H A;  4XPX A;  1SF8 A;  1YCL A;  4KB2 A;  3DXJ F;  4U9E A;  4IAR A;  3LES A;  1ZHX A;  4C45 A;  1WOL A;  3T6G B;  4CX9 A;  1D0Z A;  3HOW C;  3IEE A;  3UMK A;  2ZFZ A;  1I50 K;  2A0U A;  2XLW A;  5IYC C;  4Y7N C;  2D4U A;  4QIW D;  2L6F A;  1VB5 A;  3EHM A;  3Q6M A;  3GTJ A;  3S15 C;  3JRT A;  2XCQ A;  3EH2 A;  3A8I A;  1RJ9 B;  2HJ3 A;  2XSE A;  3JTL O;  4O7G A;  1V54 C;  1YJG A;  4A3L K;  1D1B A;  1I4Z A;  1Y6D A;  3GTQ A;  1NU7 D;  1YA9 A;  2OQM A;  5E3A A;  2A6H F;  3ZQY A;  3ZTM A;  2R7V A;  4G7Z F;  1MMG A;  3HOZ K;  5TJ3 A;  3H3V L;  1H7I A;  3A9C A;  3DM9 B;  5KYW B;  4A3E K;  4A3I C;  4MTF A;  1F7V A;  1HE1 A;  2NUT B;  3HNJ A;  1ST6 A;  4EBB A;  3UGO A;  3EZI A;  4ZLD A;  3M15 A;  3HOV K;  3S1M C;  2JPU A;  3GTK A;  3L34 A;  1VLO A;  3U2L A;  3ITF A;  3DAF A;  1BGW A;  2G3V A;  2O5I A;  2Y3H A;  2P6V A;  2PX0 A;  3EGX A;  2Q9B A;  3GTJ C;  4JE9 A;  2G62 A;  1G4U S;  3BEH A;  2VUM C;  1HE9 A;  1NG1 A;  3JSZ A;  1FMW A;  3DE9 A;  1PJ7 A;  3RQE A;  5T3T A;  3RFY A;  1IW7 A;  1QZX A;  5EK0 A;  3ZVR A;  4O79 A;  3AOU A;  4MVM A;  2XXA A;  2R05 A;  4P9S A;  2AP3 A;  2OJE D;  5L3Q A;  1E2X A;  3ERE D;  4G0H A;  4JK1 A;  2HV6 A;  1TWC K;  1WOS A;  2E2H C;  4BLA A;  2WAQ L;  3JYH A;  2MWQ A;  3N0B A;  4KNV A;  1O24 A;  2XLH A;  3Q6N A;  2XLE A;  3ASO C;  1SZI A;  4Q7C A;  5IP9 C;  2DGJ A;  3W4Y A;  3FMS A;  4ULV A;  4GQH A;  4KBL A;  2HS5 A;  5KYX A;  3NMI A;  4DRI B;  3Q7G A;  4GTL A;  4N06 A;  4BXX C;  4Y52 C;  1YYX A;  3W2V A;  5KYY B;  5DQT A;  1WOP A;  1SMY F;  1L7C A;  3TJ6 A;  3EFO B;  2A69 F;  3U5S A;  3T4R A;  2CW0 F;  4YFX A;  2J0X A;  2H7V C;  4O6Y A;  3RZO C;  4A3K C;  4YL3 A;  3I4M C;  1AEP A;  3LNR A;  2WB1 L;  5M5X K;  4PK4 A;  4BBR C;  1VYI A;  2B63 C;  1C0A A;  4Z9J A;  2GAG C;  3LAJ A;  3UMI A;  1CGO A;  1I50 A;  1UFB A;  2KYH A;  1WOR A;  1C02 A;  3GTO A;  1YZA A;  2H7O A;  3G4Z A;  1L3P A;  4A3B K;  3TFI A;  5KYU B;  4E0H A;  3W8I A;  2ICW G;  3FHZ A;  5BQG A;  1A0B A;  1O26 A;  1XZQ B;  3SEO A;  3B0V C;  3GTG K;  4FM9 A;  2GWW A;  4XLN A;  1LS1 A;  4JTA B;  3HNK A;  2HUJ A;  5AC5 A;  4MEY A;  2KW3 C;  2CYD A;  1I3Q A;  3IQC A;  1E86 A;  3LNM B;  3B9Q A;  4OIO A;  4EIY A;  3LAP A;  1Z7Q c;  3EQL F;  1U89 A;  4EHP A;  1LE2 A;  4EBJ A;  5E2Q A;  2J7P A;  3V7O A;  1I50 C;  3PDM P;  1AB4 A;  1N1C A;  3S9O A;  3HKK A;  2VAS A;  3DXJ A;  1YYJ A;  2IXN A;  2LP4 A;  3H0G K;  2Y0S D;  1E83 A;  2R7Z A;  2NG1 A;  1O2A A;  1E85 A;  2M64 A;  2DI3 A;  4XPW A;  4A3L C;  1PV3 A;  2YEV A;  2JA5 K;  4MW3 A;  2O5J A;  5COF A;  3HOZ C;  4JEA A;  1G4W R;  3WHN A;  3EH1 A;  4N4W A;  5EGH A;  4A3E C;  4C3D A;  1LM3 B;  3IPJ A;  2KK1 A;  2PA8 L;  1TWH K;  3GEI A;  1OKK D;  4EWC A;  3V4G A;  3HOV C;  1VYK A;  2EIL C;  2A6H A;  2JA7 A;  4NOI A;  4G7Z A;  4P9T A;  2R7Q A;  1OKK A;  2L9J A;  4A4A A;  5EGY A;  2P5M A;  4KMA A;  1K04 A;  4X0R A;  5DS6 A;  4JZA A;  4YL0 A;  1JQW A;  2GSU A;  4YFN A;  4A3G K;  1YNJ A;  3ASN C;  3FOP A;  4OIP F;  3ADA C;  1VMA A;  5FJ8 K;  3EGX B;  1H9T A;  3AGT A;  4KMD A;  3JCU Q;  4J7Y A;  3GTP K;  4W8P A;  1TWC C;  1OW7 A;  1C03 A;  4A3F K;  5C3E C;  4JJF A;  1Z63 A;  1IBA A;  5C44 K;  2R25 A;  3RF3 A;  5D4D A;  1TWF K;  4Q4Z F;  4PJL A;  4XCH A;  4ZH4 A;  1TFK B;  5CHP A;  4ULW A;  4A93 K;  4XTK A;  4GTA A;  4DXW A;  5IY5 C;  4ILD A;  3V5Y A;  2E2I K;  3EPV A;  4GYT A;  2Y3B A;  1DCO A;  4KAW X;  3FVY A;  1J98 A;  2VC9 A;  5L0G A;  4U9D A;  2A0B A;  1TWG C;  2Y69 C;  1XWJ A;  2LK4 A;  4XQ1 A;  3G4A A;  4A3M K;  3ORE A;  1KTM A;  2PFD A;  3T6J A;  5KYX B;  3Q3Q A;  2PPB A;  2OJQ A;  3DKA A;  3B71 A;  1JRA A;  1JR8 A;  4E17 A;  1HMD A;  4XSZ A;  1SMY A;  1Y1W K;  3G4C A;  3S1N K;  2WL8 A;  2A69 A;  2R93 A;  2YHS A;  2CW0 A;  5FZT A;  3W8H A;  5HSW A;  1G8X A;  3M4B A;  4MQ9 F;  4XEF A;  1YA7 O;  4LLG A;  4FAP B;  4C3I C;  1IE0 A;  1USO A;  1R9T A;  4C3H C;  2DB4 A;  4JJG A;  4A3B C;  2OG2 A;  5IP7 K;  1MMN A;  2NVY A;  5F5H A;  2ZXO A;  4EBK A;  2R7T A;  3S2D K;  2HMQ A;  4GFQ A;  4BLB A;  4G7O F;  3B0U X;  3T01 A;  1XXC A;  4I1M A;  4PJM A;  3HOX K;  5C4J K;  3HOU K;  3GTG C;  3FHD A;  2A6E F;  4RD9 A;  3CQZ K;  1K05 A;  1ORY A;  5JFE A;  1WOO A;  4BKW A;  2QTV A;  3GTK K;  2XLO A;  5B3S C;  1FTS A;  3SP1 A;  5IOQ A;  5M5Y K;  1XXB A;  1ORJ A;  4D4N A;  3X2Q C;  1TWH A;  1XXA A;  3IHU A;  4MS2 A;  2B0J A;  2EPO A;  1K83 K;  4GTF A;  4BPM A;  4WIL A;  3MYI A;  3NDB B;  3EHN A;  1VH2 A;  4J32 B;  4YL1 A;  3U2M A;  2GAQ A;  3H0G C;  1EQ1 A;  1HQM A;  2OEV A;  2XS8 A;  3PMR A;  2EPK X;  3EQL A;  1Q0K A;  5L0F A;  1KQ4 A;  1EI6 A;  3RZD K;  5BQI A;  5JT4 A;  3JT1 A;  4QDL A;  1QPU A;  1LS4 A;  4O6N A;  4DDQ A;  4NY3 A;  2ZD9 A;  4P5A A;  3K1I C;  1YAU O;  2JA5 C;  3ZWI A;  2XM0 A;  3K66 A;  2LSE A;  2E87 A;  4OIQ F;  3FAP B;  2XLD A;  3S2H K;  3VM6 A;  3W2W A;  3G4X A;  1JOE A;  2QNL A;  3BP8 C;  1RCP A;  5JS5 A;  4QI0 A;  3FAJ A;  2G3K A;  1ZU4 A;  3SXM A;  1TR2 A;  3H65 A;  2NSF A;  4K1O A;  1LIH A;  1APC A;  3O6X A;  3C8G A;  1GQA A;  3C18 A;  3S16 C;  4JTD B;  3EG9 A;  2WVN A;  2J9W A;  1OCZ C;  4A3G C;  4YT2 A;  4IAO A;  1LI7 A;  1R5I D;  2LQG A;  4KC6 A;  2YL7 A;  3AD9 C;  3HNL A;  2JA8 C;  2FQT A;  2LIG A;  3HOY K;  3UGP A;  1HW1 A;  2YLD A;  2W45 A;  3G50 A;  3GTO K;  3GTP C;  1TQG A;  2P7V A;  1Z3I X;  3MFN A;  3M79 A;  3S14 C;  1T01 A;  2NUP A;  3KYJ A;  4A3F C;  4WGY A;  1ZW2 A;  2CGE A;  1Y1W A;  5C44 C;  4GEH A;  4QI2 A;  4OIP A;  3TUL A;  1TWF C;  2XLV A;  3AH5 A;  2AVK A;  3GWL A;  3DJU B;  3TJ5 A;  4M1X A;  4A93 C;  1XZP B;  1K40 A;  1NSG B;  3R7C A;  4LK0 A;  4A3J K;  4G78 A;  3K7D A;  2E2I C;  1JPN A;  2J9B A;  1WAT A;  1I6V A;  2MHR A;  3VAY A;  1Q0F A;  1I3Q K;  3I5Q A;  4NTA A;  4D4X A;  4Q4Z A;  4U5F E;  1G51 A;  3K7A K;  2NVQ K;  3GEE A;  4A3M C;  3CQZ A;  3ABM C;  2P0N A;  3E9V A;  1BR2 A;  4K7B A;  2H8A A;  4YWQ A;  3AJM A;  5L0I A;  3AD8 C;  1TWA A;  2EPL X;  4BJ6 A;  1QSP A;  1H6G A;  4YN0 B;  4RBN A;  1OW6 A;  1Y1W C;  3S1N C;  2R7Z K;  1K83 A;  2JA6 A;  3DMD A;  1NU9 C;  4IWB A;  4KMU A;  2FGY A;  5IOR A;  1W2W A;  1G5Z A;  2FQO A;  3POV A;  3LEO A;  3M3Y K;  3ZTZ A;  3GTQ C;  5IP7 C;  3GM3 A;  2VCB A;  3S2D C;  1T6U A;  2I8B A;  3GSI A;  3IQ5 A;  4NTB A;  2E2J K;  3N0C A;  4LOW A;  4AYB D;  4MQ9 A;  2YL3 A;  1ZBS A;  4FWV A;  1J6W A;  4MVZ A;  3HOU C;  2BL2 A;  3ATP A;  2XL6 A;  3CQZ C;  3SYN A;  1BBH A;  4HE8 D;  1Y1V K;  2TMV P;  3GTK C;  2JA7 K;  4YT4 A;  4JKV A;  1A7D A;  3ZG1 A;  1I5N A;  3DD7 A;  4LDK A;  4G7O A;  3GWN A;  2B0H A;  3LJB A;  2J8W A;  1E84 A;  2EPM X;  1V4A A;  2PP4 A;  1ZU5 A;  2HV7 A;  4C2M K;  4BJ5 A;  4AX2 A;  2A6E A;  4I1O B;  3S0X A;  4GTC A;  5GPG B;  4YG2 A;  1B4A A;  4LER A;  4OIN F;  5L46 A;  3VYW A;  2WVO A;  3V5X A;  5M3M K;  1WSV A;  4I44 A;  2KGO A;  1ZHY A;  3NKD A;  2BE5 F;  3RZD C;  2A1D D;  1SFO A;  2KC3 A;  2R02 A;  3GTM K;  4G0V A;  2XRH A;  4O2D A;  1ZVZ A;  4MVU A;  5CI8 A;  5CI9 A;  2Q4F A;  2IOQ A;  3GOR A;  4X6A K;  3B0P A;  1YDI A;  4JVS A;  1JVI A;  2CNW D;  2OOC A;  2QLA A;  2HSQ A;  3M4O K;  2AWY A;  3T9O A;  3S2H C;  1WTY A;  4C3B A;  2Y0S L;  1WWP A;  2VH3 A;  4BY1 C;  5E68 A;  2OEX A;  2CNW A;  5COM A;  1NFO A;  4XLP F;  1BJT A;  1CGM E;  3AG1 C;  2R7X A;  4NQF A;  2V3C C;  4ONS A;  1IZM A;  4A2N B;  4OIQ A;  4E0I A;  4FX5 A;  1RKC A;  3EGD B;  2R7R A;  1EFW A;  4QJV A;  5JLI A;  3WG7 C;  1EI7 A;  4G0U A;  1NBB A;  4IAQ A;  4GZY A;  2W7V A;  4P9F A;  3OEP A;  2XLM A;  1QVX A;  5F5F A;  1LI5 A;  3JSE O;  2RSE B;  4AE4 A;  1ZXO A;  3US6 A;  3HOY C;  3PO3 K;  1GS9 A;  2R93 K;  1A7E A;  2V6S A;  3C8G B;  3GTO C;  2EIK C;  3U9J A;  1BR1 A;  1R9T K;  3EG9 B;  1H9G A;  3N0T A;  1ZQ1 C;  2NVY K;  1LPE A;  1JPJ A;  5B1A C;  1T6Q A;  3DM5 A;  5T1D B;  4MVR A;  2R9R B;  3HLZ A;  3LS0 A;  4LLC A;  1M6T A; 
#chains in the Genus database with same CATH homology
 2FFH A;  2IXM A;  4ZLC A;  1MMD A;  2VB6 A;  3FOF A;  4CS8 A;  4BJ6 C;  2KNH A;  3CZ6 A;  3M1C B;  2B63 A;  2R7U A;  2E2I A;  2KQ9 A;  2Y39 A;  3G4C A;  2QY9 A;  2WL8 A;  2NUP B;  1SF8 A;  2ZPA A;  2R93 A;  4KB2 A;  2YHS A;  3DXJ F;  5HSW A;  3W8H A;  3NYJ A;  2IXO A;  1G8X A;  4MQ9 F;  3LES A;  1ZHX A;  4C3I C;  1R9T A;  4C3H C;  4JJG A;  1FMV A;  1QLE C;  2OG2 A;  1D0Z A;  3F46 A;  2W4B A;  4G0W A;  3I5P A;  3IEE A;  3UMK A;  1MMN A;  3RKO F;  2NVY A;  2ZFZ A;  5F5H A;  2ZXO A;  2R7T A;  3BUE A;  4GTE A;  1S7Z A;  4GFQ A;  1Y1V A;  2J46 A;  4BLB A;  2CFA A;  4G7O F;  3B0U X;  4J30 B;  4AK9 A;  3WOD F;  1M2O A;  1XXC A;  3K1H A;  4I1M A;  4PJM A;  2R7O A;  5DLJ A;  3EHM A;  3NKE A;  3Q6M A;  5B1B C;  3GTJ A;  1FFH A;  1ZYR F;  3FHD A;  2A6E F;  4RD9 A;  3JRT A;  1F9N A;  4H4K C;  5JFE A;  2XCQ A;  3EH2 A;  3AG4 C;  4JW1 A;  4BKW A;  1O25 A;  2NVX A;  1RJ9 B;  2QTV A;  5B3S C;  2XSE A;  1FTS A;  3SP1 A;  5IOQ A;  4O7G A;  1O2B A;  1V54 C;  1XXB A;  1D1B A;  2O9X A;  3X2Q C;  3GTQ A;  1NU7 D;  1TWH A;  1XXA A;  4BJT A;  5E3A A;  2A6H F;  5IOS A;  2R7V A;  2B0J A;  4KNW A;  1M56 C;  1MMG A;  4MND A;  4G7Z F;  3E70 C;  4GTF A;  2Q9A A;  4BJ5 C;  4J3N A;  5TJ3 A;  3OA1 A;  2ZXP A;  1VOM A;  3DM9 B;  3NDB B;  3EHN A;  3SZR A;  1FFT C;  5KYW B;  4CSA A;  4J32 B;  4KB4 A;  3N24 A;  3K33 A;  2KJG A;  2XL4 A;  4BG0 A;  3GTM A;  2NUT B;  2W9Y A;  3F47 A;  1RJ9 A;  1ST6 A;  3PMR A;  3NYM A;  4EBB A;  3UGO A;  1IS1 A;  3AQO A;  4C7O A;  1V55 C;  3EZI A;  4ZLD A;  1KQ4 A;  3GTK A;  3L34 A;  2XCR B;  3L4K A;  3ITF A;  3DAF A;  2Z15 A;  1BGW A;  3JT1 A;  2G3V A;  2XXA B;  4QDL A;  2Y3H A;  4F4B A;  2P6V A;  4O6N A;  4DDQ A;  2PX0 A;  3EGX A;  4NY3 A;  2Q9B A;  5DQZ A;  3AQC A;  4P5A A;  3K1I C;  2J9V A;  2G62 A;  3KKB A;  5KYW A;  4C2M C;  4PFO A;  5D92 A;  4PJJ A;  4HFF B;  3K66 A;  1O87 A;  3S27 A;  2WZL A;  3SNH A;  1GE9 A;  1NG1 A;  3EJN A;  3JSZ A;  2Q9C A;  2LSE A;  5D91 A;  2NUT A;  2E87 A;  2J7P D;  1FMW A;  4OIQ F;  2WZF A;  2Q3T A;  2GSO A;  3VA7 A;  1OCC C;  4WJ0 A;  3W2W A;  3GOD A;  3FOE A;  4DBQ A;  5T3T A;  3RFY A;  4OIO F;  1QZX A;  2C04 A;  4U5H A;  3ZVR A;  3K6B A;  4O79 A;  2JH3 A;  5EGE A;  2PHC B;  4QI0 A;  2XXA A;  4U5C E;  4OIR F;  3FAJ A;  4YT8 A;  2RGR A;  2G3K A;  3LAY A;  1ZU4 A;  1D1A A;  1TR2 A;  3H65 A;  4KC9 A;  4FZB A;  3QMK A;  5L3Q A;  4E7S A;  2EIJ C;  3LLK A;  3ERE D;  4Q5S F;  4G0H A;  1D0Y A;  2HV6 A;  3ABL C;  3O6X A;  4BLA A;  1WIH A;  3OWT A;  3JYH A;  2MWQ A;  3N0B A;  1VK5 A;  4KNV A;  4KMH A;  3CSK A;  1O24 A;  3NG1 A;  1O28 A;  3NRH A;  3EG9 A;  4LR2 A;  2WVN A;  1WQH A;  3Q6N A;  3ASO C;  1SZI A;  2J9W A;  1OCZ C;  4Q7C A;  3MLG A;  4HFK B;  1BR4 A;  2DGJ A;  3I4U A;  3T6B A;  2IXP A;  3UMH A;  3Q7L A;  1ZHZ A;  4IAO A;  4YT2 A;  5JVO A;  1ZHW A;  3ZSU A;  4KBL A;  3NYL A;  4JUR I;  5KYX A;  3ECS A;  1D0X A;  3Q7G A;  3NUH A;  4KC6 A;  3KH2 A;  3MML B;  3LS1 A;  2DYS C;  3UGP A;  4GTL A;  4N06 A;  3AG3 C;  4U5D E;  2W45 A;  3W2V A;  5KYY B;  5DQT A;  1SMY F;  1Z3I X;  2P7V A;  3ZIB A;  2NUP A;  1TWC A;  4YT5 A;  3EFO B;  2A68 F;  3RH3 A;  2A69 F;  2CGE A;  4PFP A;  4BJ1 A;  3T4R A;  1Y1W A;  2CW0 F;  4GEH A;  4QI2 A;  2J45 A;  2J0X A;  3HTK C;  2OCC C;  4DVZ A;  2H7V C;  2X51 A;  4O6Y A;  2ZXW C;  4OD5 A;  3AH5 A;  1PD1 A;  3DJU B;  1J8M F;  3GAN A;  5DS4 A;  4M1X A;  4W8K A;  3LNR A;  4PK4 A;  4CS8 C;  3MX3 A;  1B4B A;  1VYI A;  3N3Y A;  3K7D A;  3LAJ A;  3UMI A;  4FES A;  2W4M A;  1JPN A;  3OPF A;  5KYN A;  1Z5Z A;  2CDQ A;  1I50 A;  1WGW A;  3GTL A;  3N2Z B;  2WB7 A;  3S29 A;  3VAY A;  5DVW A;  2PX3 A;  3GTO A;  4B6I A;  3I5Q A;  2H7O A;  5DS5 A;  3HJC A;  4U5F E;  4U5E E;  1TWG A;  5KYU B;  3QZC A;  3UR3 C;  4LLE A;  2L81 A;  3CQZ A;  3ABM C;  4M63 A;  3W8I A;  2JD3 A;  3E9V A;  1BR2 A;  3FKI A;  4K7B A;  3FHZ A;  4KI2 A;  5IOT A;  4YWQ A;  4LQY A;  3KMI A;  4AE4 B;  1TWA A;  4DOZ A;  1O26 A;  1OCR C;  4DBR A;  3S28 A;  4BJ6 A;  1M2V B;  3SEO A;  3B0V C;  4YN0 B;  1O27 A;  4RBN A;  3LLI A;  4CIH A;  4FM9 A;  1LS1 A;  1K83 A;  2JA6 A;  3DMD A;  3O39 A;  1NU9 C;  4IWB A;  2RH6 A;  2FGY A;  5IOR A;  3L0I A;  3CAG A;  4LAC B;  1NZE A;  1W2W A;  2KW3 C;  1I3Q A;  3POV A;  2DYR C;  4HEA J;  3B9Q A;  1EK8 A;  3LAP A;  1LVK A;  3ABK C;  3EQL F;  4E7Z A;  2GFH A;  5E2Q A;  2WZG A;  2J7P A;  1OCO C;  3V7O A;  2I8B A;  4IRU A;  1AB4 A;  1N1C A;  1DD5 A;  1PCX A;  4OD4 A;  1ISE A;  5EHH A;  4CSA C;  5E33 A;  3N0C A;  2VAS A;  4GTD A;  2IXN A;  1ZBS A;  4FWV A;  3AQB A;  3GTG A;  3SYN A;  3TD7 A;  2R7Z A;  1Z23 A;  2NG1 A;  1O2A A;  1EH1 A;  4HE8 D;  3PHF 2;  1D1C A;  2M4E A;  4YT4 A;  3DJN B;  3ZG1 A;  1MNE A;  3DAG A;  1IW7 F;  3DD7 A;  4GT9 A;  1TKN A;  3RYL A;  2CFA B;  1MMA A;  2R7W A;  3LJB A;  2XCO A;  1WQG A;  3EZH A;  2YEV A;  2PP4 A;  1ZU5 A;  3UNG C;  2HV7 A;  3QX3 A;  3FDQ A;  2Y3G A;  2YU9 A;  3EH1 A;  2KWA A;  5FCL A;  3ZC4 A;  4BJ5 A;  4AX2 A;  4GTB A;  3DZA A;  5EGH A;  4CS9 A;  3KL4 A;  4I1O B;  3S0X A;  4GTC A;  4K0D A;  1WQF A;  4YJW A;  1B4A A;  4KDD A;  4C3D A;  4LER A;  3H0G A;  3OEO A;  4OIN F;  3VYW A;  2WVO A;  1J8Y F;  1OKK D;  2EIM C;  4EWC A;  3V4G A;  4I44 A;  2KGO A;  1ZHY A;  3NKD A;  5BUO A;  1VYK A;  2BE5 F;  2J9U A;  2EIL C;  2JA7 A;  4P5B A;  2GSN A;  4ANJ A;  2R7Q A;  4CBE A;  2A1D D;  4C3E A;  1SFO A;  1OKK A;  3L4J A;  4G0V A;  2XRH A;  4C3J C;  2EIN C;  4U5B E;  2L9J A;  5CI8 A;  5E3C A;  2YZS A;  5EGY A;  2P5M A;  5CI9 A;  5KYY A;  4BEJ A;  2ZXR A;  2IOQ A;  4KM8 A;  4KMA A;  2PF4 E;  3B0P A;  2J0W A;  4JVS A;  4X0R A;  2JA5 A;  5DS6 A;  1KU2 A;  2CNW D;  4JZA A;  2H7B A;  2VUM A;  3EFO A;  2GSU A;  4C7O B;  4JCH A;  4C3B A;  3ASN C;  4OIP F;  2VH3 A;  3AQP A;  5L3V A;  2CNW A;  1ZHT A;  2Y3D A;  1VMA A;  4XLP F;  1BJT A;  3LPX A;  3EGX B;  3AG1 C;  4KMD A;  3JCU Q;  4CS9 C;  2R7X A;  2V3C C;  3RIP A;  3X1O A;  1IZM A;  4A2N B;  4KAR A;  2Y3P A;  1M57 C;  3AG2 C;  2R7S A;  2E2H A;  1LKX A;  4JJF A;  3LEV A;  4FX5 A;  4KAT A;  2V26 A;  1Z63 A;  1MND A;  3EGD B;  2WVQ A;  2R7R A;  2R92 A;  4RDA A;  3WG7 C;  4G7H F;  4G0U A;  4KAS A;  4Q4Z F;  4PJL A;  5KYU A;  1ZVU A;  1O5H A;  1Z6A A;  4P6I C;  5CHP A;  4ULW A;  4DVY P;  3OEP A;  5F5F A;  4XTK A;  4GTA A;  5T3W A;  5IY5 C;  4ILD A;  3EPV A;  4GYT A;  2Y3B A;  4XWJ A;  4AE4 A;  1ZXO A;  2IYL D;  4KAW X;  3FVY A;  4PJN A;  2D5R B;  5CJ9 A;  1M2V A;  1WCM A;  4I3M A;  3GTP A;  2EIK C;  1BR1 A;  2C03 A;  3EGD A;  3EG9 B;  2Y69 C;  4IJJ A;  4XLN F;  3N0T A;  3G4A A;  1JPJ A;  3ORE A;  5B1A C;  1PD0 A;  4U5G A;  2MYS A;  4CS7 A;  3DM5 A;  2PFD A;  5T1D B;  1TWF A;  1O29 A;  3HLZ A;  3T6J A;  3LS0 A;  4O6M A;  4KM9 A;  5KYX B;  4LLC A;  3Q3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...