3S0XA

The crystal structure of gxgd membrane protease flak
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
231
structure length
225
Chain Sequence
b'SGSMIEYIIGALGLIIASVQDEIEDYIWIFLAVFGVLFAIYSSITLLDYSILINSISGFVICFILGYMMFLSGIGGGDGKMLIGLGALVPKFQMPIYTSLGTLLNLNYVPTFPIMVFINGIFFMVFLPFVILFRNILNGARPKTGKEFILMFFGEKMKVNVAKEQKRLIMGQNDKINFFPADEDFSKYSNNEEIWVTPQIPLIIPITLSYLVTPIIGDRILDFLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidase A24B, FlaK domain protein
publication title The crystal structure of GXGD membrane protease FlaK.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Hydrolase
total genus 56
structure length 225
sequence length 231
chains with identical sequence B
ec nomenclature ec 3.4.23.52: Preflagellin peptidase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01478 Peptidase_A24 Type IV leader peptidase family
A PF06847 Arc_PepC_II Archaeal Peptidase A24 C-terminus Type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1220 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3s0xA01
3.30.1360.160 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3s0xA02
3S0XA
chains in the Genus database with same CATH superfamily
2ICWG 2R7OA 4MVMA 2JD3A 2OJED 3AQBA 3FOEA 1YJGA 3I4NK 4PAAA 4Y7NK 3L1MA 3GTJK 4X0RA 1HMDA 4BY7K 1TWHA 3HOUK 4Q5SA 4XLPA 4O79A 1MNEA 1VYIA 1TKNA 2M64A 2XLEA 2GSOA 1ZU4A 3X1OA 2QY9A 1R4TA 1IBAA 3AG2C 5IYCC 4U5CE 4JEAA 5CI8A 4EWCA 1YYXA 4CSAA 1TWCA 1MNDA 2XRHA 4QI2A 1V5VA 4LK1A 4JEBA 1M57C 3LAYA 1VGXA 4FWVA 4DXWA 2GSNA 1M56C 4AH6A 1CGNA 1SF8A 3I5QA 3W2VA 4XTKA 2PHCB 3FKIA 3OA1A 2PX0A 3DMDA 5DLJA 2PP4A 1YYJA 2B63C 3A9CA 5A6AA 3S17K 3H3VD 1XXBA 3NMJA 3VRCA 5DS5A 3M3YK 4U5GA 2QLAA 2Y3BA 1QZXA 2NUPA 3CAGA 4YT8A 2CCYA 1JPNA 4U5DE 3ECSA 3RKOF 5TMCA 2R7ZA 1H6GA 1DCOA 1F1MA 3GTOA 2KC3A 1NU7D 5FLMK 3HOVK 2GFHA 4BY1C 3CAXA 4AL0A 1DCPA 3I4UA 4PFPA 3HLZA 2WVQA 1BS2A 4BEJA 3T01A 2OG2A 2J7PA 3S2DC 4YT4A 2V6SA 4F4BA 5IYCK 1PD1A 4GQHA 3JZ0A 1EK8A 4O6MA 3NDBB 1I4ZA 2R02A 2W9YA 2XSEA 1LI7A 2IBFA 3ATPA 1WQFA 4C3EA 1WASA 2AP3A 3R2PA 1ZW3A 1YCLA 1GQAA 4O6NA 3KYJA 1DCHA 4LLEA 1WCMA 5C3EC 1FR0A 2B0HA 2B63K 1KNYA 1ORSC 3GM1A 4BJ6C 1HI9A 3C18A 1Y1VA 5IOSA 1ZHWA 3I5PA 3OEOA 2HJ3A 3CQZA 2OU6A 2Y69C 1U0BB 3UMKA 4IARA 4KC9A 3AQPA 3RVZA 4KMAA 5A69A 1OW8A 3ADAC 3TD7A 1I3QK 1LKXA 3E70C 5JFEA 1OCZC 1ZBSA 1YARO 4H54A 1QPUA 1E83A 3TOMA 4JW1A 3S28A 3TFHA 4BY1K 2WB1L 3SXKA 3CZ6A 4AE4A 4XPWA 3JTLO 2Y3DA 3S29A 3H2UA 4PK4A 1QSPA 2LCHA 1TWGA 3RQGA 2KJGA 2YKZA 4O2DA 3UR3C 3ZSUA 3SEOA 1OXBA 3T6BA 5COMA 4OIPF 1KU2A 2L6FA 3X2QC 3RZOC 5IP7C 4YFNA 2CNWA 1JOEA 3K6BA 1F9NA 4PR9A 2KSFA 3QVZA 2VASA 5C3EK 3C62A 1Q0MA 2EPKX 2BC5A 3BP8C 3GEEA 4KM9A 1TWCK 3HNJA 4OIPA 2FFHA 1SMYF 4A3LC 1V54C 2X0CA 1B68A 1PJ5A 3IHUA 3LLKA 2NVXA 3PHF2 2A68F 1YLMA 1AEPA 3ASNC 3PO2C 2Q3TA 1OCCC 3OWTA 3ZWIA 3IEEA 3S14K 1SMYA 4MS2A 2Q9CA 3NMKA 5JVOA 1X31C 4KASA 2CW0F 4LK0A 2O5IA 1IL2A 2CDQA 2A68A 4DRIB 2VCCA 2ZXOA 4XEVA 2D5RB 5L0JA 3K7AC 4LR2A 1FFTC 1RU0A 1V74B 2JA6A 3RZOK 5IP7K 2RD9A 2CGEA 2H8AA 2WB1D 2CW0A 1NSGB 3S1NC 3T4RA 2ZXWC 3VF0A 3TK0A 3J06A 5F5HA 3K66A 3F47A 4U5EE 2H7VC 3NKDA 4JTAB 3SYNA 1T01A 4KMHA 3EHMA 3GDZA 2W7VA 2NG1A 3AG1C 4BG0A 1VOMA 3QX3A 2VCAA 1I6HC 3S15C 3PO2K 4QJVB 3DM9B 2JA7C 1LVKA 4DDQA 1HQMA 4P5BA 3VYWA 1WQGA 3C8GB 1QKRA 3RQEA 4DJ9A 4G7HF 1SFOC 2LD6A 2F22A 1OCRC 2R25A 3KL4A 3AG4C 2WB7A 1TWAC 3SXYA 3K7AK 5IP9C 4WABA 3JRMO 4OIOF 4X6AC 2WVNA 1B4AA 3NMIA 4BBSC 4YT2A 5BQHA 1HE9A 4A2NB 4N06A 1YDIA 3BEHA 4QI0A 3NYLA 4R32A 3C63A 4G7HA 3DAFA 2HMZA 2R7WA 4A3JC 2AWCA 1A0BA 2FQTA 4H4KC 3S1NK 2C04A 1LE2A 1BBHA 4M1XA 4C45A 4OIOA 1YZCA 1TWGK 3C7JA 4LLCA 1WTYA 4P9SA 1OQCA 1F7UA 2EPLX 4ZH4A 1K05A 4A3CC 2M4EA 5JRAA 4DBQA 3GORA 2NPUA 1K83C 3G4ZA 5DVWA 2V6TA 5FZTA 3S15K 4RBNA 1Z5ZA 5IOTA 2JA7K 4QDLA 1WIHA 1G8XA 3MYIA 4QJVA 3HOYC 3JYYA 1YVIA 2P0NA 1NG1A 1JQWA 4OIRF 2LK4A 1SFOK 4FAPB 3TFJA 4MW8A 4RD9A 3GWNA 1Q0KA 4LJZA 1FMVA 1L0WA 2PF4E 2WL8A 1APCA 3N0TA 4X6AK 3MLGA 2JA5C 4BBSK 3RZDC 3Q3QA 1OXKA 3DXJA 1OCOC 3LS0A 4MVSA 1J98A 1XXAA 1YA9A 1T6QA 4OIRA 5FCLA 3ZVRA 1O24A 1ST6A 4E17A 4A3JK 4EUKB 1WATA 4PFOA 2PNOA 4CS9C 1WN0A 1Y4CA 4JC7A 3ABMC 1D1BA 2OCCC 2MWQA 4CX9A 4BBRC 3W2WA 2UUHA 2R7VA 4A3CK 3JT1A 2HFIA 1ORJA 4JTDB 3AH5A 4KN7A 5F28E 1K83K 2YQYA 3LNMB 2XCOA 4J3NA 3B0PA 5IYBC 4N6HA 2B63A 3VA7A 3B0UX 2EPOA 2YRFA 1D0XA 1BR2A 4E0HA 3HOYK 1MQVA 3L4KA 1GGQA 2OJQA 2NVQC 2VC9A 2NSFA 3O55A 2NSGA 2JA5K 4G78A 4MVRA 2KW3C 4DOZA 1ZQ1C 4JJFA 3FVYA 1XZPB 5L0HA 2O5JA 1BR4A 3Q6NA 3A8KA 3US6A 4Q5SF 2PFDA 1Q0DA 2Q00A 4A3IC 4AL1A 1WORA 1WSRA 4DVZA 2R7UA 4NCQA 3T6GB 2MYSA 5A6KA 4HFFB 1W2WA 3FOOA 5EK0A 3S2HC 2XS8A 5DS4A 1KTMA 1EI7A 3MX3A 1T6UA 3JSEO 1FFHA 2YLGA 4B6IA 1XWJA 4PABA 1E2XA 2WZFA 2YZSA 3U2LA 5JLIA 1YX2A 1E84A 3M1CB 5CHPA 2JX0A 5IYBK 2JPUA 2XM4A 3DJUB 3GTPC 3B9QA 1DOWA 1Z7Qc 4BJ6A 3WAQA 4QIWL 5L0GA 1PCXA 1OKKA 4HE8D 3GWLA 2NVQK 1D0YA 2LSEA 1H9TA 2QNLA 2IXNA 1SZIA 1BDFA 4JURI 4JE9A 5CI9A 5HL8A 1OW7A 4W8PA 3FOPA 1USMA 1LIHA 1XZPA 4KM8A 2LFFA 4LACB 4A3IK 1A7EA 3U9MA 2AWYA 2QUPA 2W4MA 1XZQB 3RQFA 3LPXA 1I50C 3GTMC 4DRHB 2KQ9A 4IWBA 3S2HK 2ZXPA 5EGHA 3JRTA 2PX3A 4CIPA 5A6JA 3HKZD 4O6YA 2XLDA 3N3YA 1BGWA 3NRHA 4JKVA 1YAUO 2DGJA 3WHNA 4AX2A 5JS5A 1HY5A 2YL0A 4AE4B 4EBKA 3H0GC 2XL8A 4ILDA 1NFNA 1MMAA 1C17M 3GTPK 3U8VA 1EFWA 4GTCA 2R93C 3LEOA 4WGYA 2J45A 2L81A 5T3WA 5BQGA 1LM3B 3BUEA 4U9DA 4NTBA 3AOUA 3U9JA 2EILC 4E7ZA 4XEFA 2VCBA 3POVA 1ZHTA 4MEXA 1D1AA 1F93A 4M63A 4C3JC 1NFOA 2ZUFA 1RKCA 2VUMC 3AGUA 3ZDLA 4A3DC 5CIVA 3FHZA 1ZVUA 1Z23A 2VH3A 4Q7CA 4LLGA 5CJ9A 2AU5A 3T9OA 4KBLA 2KWAA 1FNTc 1FAPB 4BJ1A 4QIWD 5C4XC 1G5ZA 4LERA 3ZIBA 4KI2A 1IQ0A 2L7AA 3M4CA 5M3FK 2E2HC 3N0CA 1XZQA 5IYDC 4OIQA 1TFKB 1IE0A 2A69A 4XPYA 1EKYA 1O2AA 1BDJB 3LAJA 3Q7GA 1RMVA 4IB4A 3O39A 3T6JA 4CBEA 5IORA 4JTCB 2KYHA 1J6WA 3H0GK 3IQCA 3S2DK 2HS5A 1WOSA 2R93K 5JUAA 3TJ5A 2EPNA 2YLIA 3AG3C 2YVKA 4P9TA 3B71A 3B0VC 3RF3A 2G62A 3EFOB 4C3JK 4Y52C 3HOZC 2ETSA 3S16C 3IPJA 2VUMK 3TJ6A 5L0CA 1OW6A 2TMVP 2Y39A 4A3DK 3H2VA 3I4MC 3ZC4A 4WGZA 5BQIA 2JA7A 3JSTA 1E86A 1HMOA 3ZTMA 4IJJA 3UNGC 2XL4A 3T00A 1ZHZA 3GODA 3ABLC 4UDVA 1V4AA 3EHNA 1SFOA 4BKWA 2E2HK 2JA8C 2HZ8A 3W8HA 3M4OC 1TWAA 2OOCA 2J7PD 1JVIA 2WVOA 3FOFA 1PJ6A 4IAQA 3JYHA 4RDAA 2HUJA 3ASOC 5B3SC 4JCHA 4HEAJ 4BLBA 1LI5A 4CJGA 2FAPB 2DI3A 3S1QC 3U3FA 3GIRA 3QW0A 1M6TA 2HV6A 1Q0GA 2I8BA 1TR2A 5IY5C 1TWFC 2Q9BA 1GS9A 1AUEA 4Y52K 2GSUA 1C02A 3KH2A 3HOZK 3OREA 1K83A 1JPJA 3EFOA 5KYXB 3M79A 4CDAA 3I4MK 5C4JC 3EPVA 3UMHA 3TQOA 3S1MC 3EJNA 3UGOA 1RCPA 4MW3A 3GTLC 4A3LK 2I15A 3E9VA 3DE9A 3O6XA 2JA8K 2NVTC 1EQRA 5B1AC 4PACA 1YA7O 1VB5A 2JA5A 1UV7A 1HE1A 2CYDA 4Z9JA 2RH6A 3AQOA 1G4US 4P6IC 2V3CC 2J9BA 4JJGA 3LNRA 2Q9AA 3IPMO 3KYIA 5L46A 3SZZA 1WOOA 5DQTA 3DI5A 1T6IA 4FX5A 2IXMA 4CS9A 3S1QK 4GTLA 3LS1A 1NLXA 3CSKA 5E3AA 2EBBA 3PO3C 3PMRA 2OKUA 2A6HA 1RJ9B 1QLEC 1TWFK 2WAQL 2A6EF 4D4NA 3UGPA 4PJMA 4ONSA 1TFOB 2RSEB 4NTFA 4LDKA 2A0UA 4KNWA 5KYXA 4D4XA 1K40A 4NY3A 1VYKA 3S1MK 1S05A 2V26A 1INNA 4EHPA 3DWWA 3AD9C 2NUTB 2A6EA 4I1OB 1ZYRF 3U0CA 4YL0A 3O10A 2GAHC 2H7BA 3WODA 4BJ5C 4KARA 4GYTA 4YJWA 3BRJA 1I6HK 2ZUEA 3GM3A 5KYNA 1UFBA 4C2MC 1TQGA 2J0XA 2XLHA 1QQ3A 4MQ9A 3AQCA 3U3BA 3DXJF 4FESA 4OINF 1ZYRA 5KYYB 3FHDA 3PCVA 4A93C 5T3TA 2PA8L 2ZXRA 1Z6AA 1MMDA 3EGXB 3JSZA 4AYBL 4W8KA 1TWAK 3PO3K 3HNIA 4KN4A 1J6XA 4XCHA 5IP9K 3IQ5A 3GTGC 4G0WA 3HOXC 5L0FA 4I44A 4OINA 2XLVA 3S27A 3TTGA 1RJ9A 4ER9A 2P5MA 4XSXA 1M2VB 4EIYA 3QZCA 5A6BD 3GANA 5C44C 3SZYA 1O25A 2HSQA 1O27A 4WJ0A 3GTPA 4MVQA 4J32B 2YWAA 5JVEA 2OEVA 5E2QA 3ZQYA 5L3QA 4XEKA 4A3MC 2WAQD 4JRZA 1J6VA 4MNDA 2NUTA 1Y1WC 3HJCA 1A7VA 4E7SA 2EIJC 2IXOA 2BL2A 5KYWB 1S7ZA 2H7OA 4YT5A 3GTJC 2YEVA 4C2MK 2XLOA 1ZVZA 4K0DA 2A1DD 2GDCA 1I5NA 5AC4A 2P8TA 1IW7F 3DD7A 3DAGA 1NBBA 5KYYA 1PV3A 1WOLA 3EG9A 1I50A 2R92C 3GTMA 3EGXA 4G7OA 4FZBA 3TULA 3GTGK 4BXXC 3TFIA 2CFAB 4EBJA 4YK5A 3HOXK 2J9WA 3RZDK 2W4BA 3HKZL 3ERED 1DOVA 2PA8D 1IW7A 5AGFA 2D4UA 2NVYC 3JCUQ 1T5OA 4BEMJ 3U5SA 3HXAA 1M2VA 4AYBD 3H0GA 4C3DA 5C44K 2R9RB 2R7RA 5KYUA 3FAJA 1A41A 3IQ6A 3ITFA 4A3KC 2YHSA 3RIPA 2R93A 4ULVA 4BBRK 2DB4A 4YL3A 1F7VA 3EH1A 4A3MK 4LDRA 1OR3A 2YU9C 5M5WK 2KK1A 2VUMA 4NTAA 3L8JA 1T9KA 4U5BE 1CGOA 3DJNB 1EI6A 4XPXA 3C8GD 4A3BC 3EH2A 1WSVA 1O5HA 1O26A 2C03A 5KYWA 5FLMC 4WJ4A 1MMGA 1VH2A 3HOVC 1LPEA 5TJ3A 2B0JA 3LUTB 2W45A 3DM5A 3AD8C 4AK9A 4CJOA 2R92K 2E2HA 4JIOA 4BXXK 1LS1A 2YLDA 4A3GC 2XCRB 4DVYP 2CFAA 1LS4A 2Y3PA 4CS8C 2NVYK 1ZHYA 4A3EC 4CIHA 3S90A 4YN0B 3ZTZA 5E33A 1VRQC 3B29A 3GTKC 4PJLA 3HNLA 1JOGA 4I1MA 5DQZA 4A3KK 4PJJA 2E2IC 2XM0A 5E68A 3VM6A 2YL7A 4CS7A 5B3IA 4MTFA 4JVSA 4C7OA 5EGYA 4G7ZF 3RW0A 2YU9K 2OQMA 4G0UA 3IQTA 1IS1A 3NYMA 2YL3A 1VLOA 2HKVA 1H9GA 1ZW2A 3K1IC 2DYRC 1R9TC 3V7OA 3RFYA 4JZAA 1I3QC 4A3BK 3NYJA 4A3FC 3V5YA 1HW2A 1ZXOA 4G7ZA 1PJ7A 1LE4A 3GTQC 1DD5A 2YL1A 3L34A 4EBBA 3W8IA 4K7BA 1O28A 3ZG1A 4KMDA 4JCZA 4DRJB 5E3CA 2KNHA 4BLAA 4OIQF 4A3GK 2A69F 2WZLA 3AD7C 1D0ZA 1O3UA 3V4GA 3F46A 2EIMC 1EH1A 1TWHC 2JH3A 2R7XA 4A3EK 4MTGA 4E0IA 1O2BA 2R7SA 1CPRA 2J0WA 3AJMA 2DYSC 3ZQVA 1JRAA 3GTKK 1I50K 3GTMK 5T1DB 4IGGA 3SP1A 1V55C 2P7VA 3V5ZA 2E2IK 1U6HA 2L9JA 2R03A 5D91A 3SXZA 4KMUA 3LJBA 1JR8A 4K1OA 4CSAC 1TWCC 2LP4A 1FMWA 4GFQA 3HKKA 1TWFA 2ZD9A 2E87A 3K33A 1VK5A 3BP3A 1N1CA 2R7TA 1VLSA 1ZU5A 1R9TK 3RYLA 1OKKD 4CDVA 3FKIC 2EIKC 2XS1A 4A3FK 4KNVA 3S14C 3V5XA 4GTEA 3GTQK 3GTLA 3Q7LA 4KDDA 3CEXA 5L3VA 1XXCA 2O9XA 3G4CA 2FGYA 3QW1A 3KMIA 3LESA 1WWPA 2MHRA 4A4AA 4LQYA 4GEHA 1YNNA 4U5FE 3S0XA 2Q4FA 2IM8A 4L6RA 2R7ZC 3AGTA 4OD4A 4NOIA 2XCQA 3GTOC 1TWHK 2EINC 5C4XK 3L4JA 1YNJA 1YZAA 1RKEB 4C3IC 3PDMP 1GM5A 3GM2A 5IYDK 3QVYA 3EQLF 5DS6A 4KC6A 3SNHA 2L6HA 2PMZL 1VLTA 4U5HA 4IAOA 3ABKC 1SR2A 1VJEA 1NZEA 3DKAA 1QVXA 3KPHA 4LDQA 2OEXA 1G51A 4MVOA 2FQOA 2GAGC 3UMIA 1Z63A 4KATA 4ZLDA 3FKIK 4C3HC 4Z9IA 4Q4ZF 3EQLA 1WCMC 3L8IA 4PJNA 1PD0A 2R05A 3SZRA 3W4YA 3DZAA 4EKWA 1Y1VC 2IOQA 3FDQA 4YFXA 3H65A 3CQZC 5M5XK 3KKBA 5D4DA 3S16K 3G4XA 5HV9A 4BJ5A 4Q4ZA 1NU9C 1K04A 2R7ZK 2QTVA 3GTOK 2QE9A 3A8IA 2AVKA 4P9FA 1GE9A 4WILA 4DBRA 3HNKA 1O87A 4YL1A 4C3IK 2Y3GA 1WQHA 1RKEA 3TOLA 1M2OA 3M4OK 4U9EA 5L0IA 5EHHA 2XXAB 3GTGA 1TWGC 1L7CA 3OPFA 3MFNA 1C0AA 3G4AA 1VTMP 3U2MA 2D6FC 2R7QA 5A6BA 4GTBA 3S1RC 2A6HF 3A11A 2IXPA 3N24A 4MVZA 2LQGA 2XLWA 4GTAA 4XQ1A 256BA 5B1BC 4IRUA 2GAQA 3N0BA 3HTKC 2WZGA 2IYLD 4C3HK 2CNWD 3LAPA 1WCMK 3R7CA 1Y1WK 1R5ID 4HFKB 3HOWC 1H7IA 3DE8A 2PMZD 3K1HA 3GEHA 4G0HA 5IOQA 4CDYA 5JT4A 2HSBA 1WOPA 1Y1VK 5D92A 2G3KA 2PPBA 5GPGB 1ZZPA 4Z9HA 3CQZK 4YG2A 2EPMX 2Z15A 1Y1WA 2NVXC 1AVOB 3M4BA 5JSLA 4YWQA 4MEYA 4NC3A 1D1CA 4XSZA 3WODF 2V6UA 4N4WA 2XLMA 5L0DA 3GTJA 2VB6A 5C4JK 1JAFA 2P6VA 2KGOA 1FTSA 4G0VA 3RH3A 3GTLK 4MQ9F 4WJ3M 2L6GA 2PBEA 3GEIA 1O29A 2R92A 1C03A 2NVTK 3K7DA 1IZMA 5COFA 4GTDA 3VAYA 1B4BA 4JK1A 3EGDB 5EGEA 5M5YK 2XXAA 1EQ1A 3A8JA 4BPMA 4GTFA 4BJTA 3GSIA 2P61A 2JA6C 3S1RK 4I3MA 1AB4A 2LIGA 2NVYA 3EG9B 5BUOA 2J46A 1E85A 1J8YF 2GA0A 3FXHA 3EZIA 2J8WA 2ASRA 3NKEA 2Q7RA 3QTHA 3Q6MA 1L3PA 3HOWK 4C3BA 2A0BA 2BE5F 2G3VA 4XLNF 2ZPAA 3M15A 3SXMA 3FAPB 2P1AA 1O2FB 2Y0SL 5F5FA 4ZLCA 2J9UA 2YU9A 3C8GA 3QMKA 4ULWA 1G4WR 2NVXK 1SYQA 4ANJA 3MMLB 4KAWX 5KYUB 4KB4A 2E2JC 2BE5A 5FJ8K 3S84A 4OD5A 1MMNA 3T02A 4XLNA 1J8MF 5HSWA 2RGRA 1CPQA 4J30B 2ZFZA 3NG1A 5K0IA 3RVYA 2X51A 4MTOA 5AC5A 4J7TA 3OEPA 4LOWA 1BR1A 3LEVA 4GZYA 5M3MK 4YFKA 1Z3IX 3I4NC 4G7OF 5COGA 4Y7NC 3N2ZB 2GWWA 3EGDA 2JA6K 4BY7C 3HOUC 4E18A 4CS8A 4N6CA 1JMWA 2HMQA 4A93K 3EZHA 3FMSA 1Q0FA 2J9VA 2LFDA 1EA8A 1HW1A 4O7GA 3GTKA 3NUHA 1U89A 1USOA 1VMAA 3MYFA 1WGWA 5TJ5E 2E2IA 4GT9A 3G50A 1Y6DA 5TMFA 1A7DA 1ORYA 4XWJA 3H3VL 2UUIA 1UG7A 4NQFA 1OR2A 3LLIA 1RXQA 3S9OA 4RMFA 3L0IA 2Y3HA 3K1IA 1R9TA 5JP7A 1XPPA 2E2JK 2HJMA 1I3QA 4FM9A 2XL6A 3C8ZA 4P5AA 2HV7A 4C7OB 4KB2A 3MBGA 4XLPF 1ISEA 3S17C 3GTQA 3WG7C 1BJTA 2Y0SD 1ZHXA 1I4YA 3U8PA 4MVUA 1BZ4A 2NUPB 4J7YA 1CGME 3M3YC 1I6VA 1KQ4A
chains in the Genus database with same CATH topology
1O2BA 5IOTA 2R7SA 2I8BA 2R7OA 2J0WA 2JD3A 3AQBA 2DYSC 4QDLA 3FOEA 1TR2A 5IY5C 1G8XA 1WIHA 2Q9BA 5T1DB 2GSUA 3KH2A 4X0RA 3SP1A 3OREA 1V55C 2P7VA 1K83A 1JPJA 1NG1A 1TWHA 3EFOA 4O79A 2L9JA 5D91A 1MNEA 4OIRF 5KYXB 1VYIA 1TKNA 3LJBA 4RD9A 4CSAC 2GSOA 1FMVA 3EPVA 1FMWA 2PF4E 3UMHA 4GFQA 1ZU4A 2WL8A 3X1OA 1TWFA 2E87A 3EJNA 3N0TA 2QY9A 3K33A 3MLGA 3UGOA 1VK5A 1N1CA 3AG2C 2R7TA 3Q3QA 1ZU5A 3RYLA 4U5CE 1OKKD 5CI8A 1OCOC 3LS0A 3E9VA 2EIKC 4EWCA 3O6XA 1XXAA 4CSAA 1TWCA 5FCLA 3ZVRA 1O24A 1ST6A 5B1AC 1MNDA 2XRHA 4QI2A 4KNVA 1M57C 3LAYA 4PFOA 4CS9C 2JA5A 4FWVA 4GTEA 3GTLA 2GSNA 2RH6A 3AQOA 1M56C 3Q7LA 1SF8A 3ABMC 3I5QA 1D1BA 4P6IC 3W2VA 2O9XA 2OCCC 4XTKA 2MWQA 2FGYA 3OA1A 5L3VA 2V3CC 1XXCA 2PHCB 3G4CA 3FKIA 2PX0A 3KMIA 3LESA 4JJGA 3W2WA 3LNRA 2R7VA 3DMDA 5DLJA 3JT1A 4LQYA 2PP4A 4GEHA 2Q9AA 4U5FE 3S0XA 3AH5A 5DQTA 4FX5A 2IXMA 4CS9A 4OD4A 4GTLA 3LS1A 1XXBA 2XCQA 3CSKA 5E3AA 3PMRA 5DS5A 4U5GA 2EINC 2XCOA 4J3NA 3B0PA 2Y3BA 3L4JA 1QZXA 2NUPA 1RJ9B 3CAGA 4YT8A 2B63A 1QLEC 3VA7A 3B0UX 1JPNA 1D0XA 4C3IC 4U5DE 3ECSA 3RKOF 1BR2A 2A6EF 2R7ZA 3UGPA 4PJMA 3L4KA 3GTOA 3EQLF 5DS6A 1NU7D 4KC6A 3SNHA 4U5HA 2GFHA 4IAOA 4KNWA 3ABKC 5KYXA 3I4UA 4PFPA 4NY3A 3HLZA 1NZEA 1VYKA 2WVQA 2V26A 4BEJA 2OG2A 2KW3C 2J7PA 4DOZA 4YT4A 4JJFA 4F4BA 2NUTB 3FVYA 4I1OB 3UMIA 1ZYRF 1PD1A 1Z63A 4KATA 4ZLDA 1BR4A 3Q6NA 1EK8A 4O6MA 4C3HC 4Q4ZF 4Q5SF 2PFDA 3NDBB 2H7BA 2W9YA 4PJNA 2XSEA 1PD0A 4BJ5C 3SZRA 4KARA 4GYTA 4YJWA 4DVZA 1WQFA 4C3EA 2R7UA 3DZAA 2MYSA 4HFFB 1W2WA 5KYNA 2IOQA 4C2MC 4O6NA 3FDQA 2J0XA 4LLEA 3AQCA 3DXJF 3H65A 4FESA 4OINF 5KYYB 3FHDA 3KKBA 5DS4A 5T3TA 1WCMA 3MX3A 2ZXRA 1Z6AA 4BJ5A 1MMDA 1FFHA 3EGXB 4B6IA 1NU9C 3JSZA 4BJ6C 2QTVA 2WZFA 1Y1VA 5IOSA 4W8KA 2YZSA 1ZHWA 3I5PA 3OEOA 3M1CB 5CHPA 4G0WA 4KDDA 1GE9A 3CQZA 2Y69C 3DJUB 4DBRA 3UMKA 4I44A 3B9QA 4KC9A 3AQPA 1O87A 4KMAA 3S27A 1RJ9A 3TD7A 4BJ6A 1LKXA 2P5MA 3E70C 1M2VB 5JFEA 2Y3GA 1WQHA 1OCZC 3QZCA 1M2OA 3GANA 1ZBSA 5EHHA 2XXAB 1PCXA 1OKKA 3GTGA 3OPFA 4HE8D 1D0YA 2LSEA 4JW1A 3S28A 1O25A 1O27A 3G4AA 2IXNA 1SZIA 4WJ0A 2R7QA 3GTPA 4GTBA 4JURI 5CI9A 2A6HF 4J32B 2IXPA 3N24A 3CZ6A 5E2QA 4AE4A 4GTAA 5L3QA 2Y3DA 5B1BC 4IRUA 3N0BA 3S29A 4PK4A 3HTKC 2WZGA 2IYLD 1TWGA 2CNWD 4MNDA 3LAPA 2KJGA 2NUTA 4KM8A 4LACB 4HFKB 3HJCA 3UR3C 3ZSUA 3K1HA 4G0HA 3SEOA 3T6BA 4OIPF 5IOQA 2W4MA 1KU2A 3X2QC 4E7SA 2EIJC 2IXOA 3LPXA 2CNWA 5KYWB 5D92A 1S7ZA 2H7OA 4YT5A 3K6BA 2YEVA 1F9NA 2G3KA 2KQ9A 4IWBA 2ZXPA 4K0DA 2VASA 2A1DD 5EGHA 3JRTA 2PX3A 2Z15A 4O6YA 1Y1WA 1IW7F 3DD7A 3DAGA 4YWQA 5KYYA 3N3YA 1D1CA 1BGWA 3WODF 3NRHA 4KM9A 3EG9A 2DGJA 1I50A 3GTMA 4AX2A 3EGXA 3GTJA 2VB6A 2FFHA 1SMYF 4AE4B 4FZBA 1V54C 2P6VA 2KGOA 2CFAB 1FTSA 2J9WA 4G0VA 4ILDA 1MMAA 3RH3A 4MQ9F 2W4BA 3LLKA 2NVXA 3PHF2 2A68F 4GTCA 2J45A 2L81A 3ERED 5T3WA 1O29A 3BUEA 3ASNC 2R92A 2EILC 1OCCC 2Q3TA 4E7ZA 3K7DA 1IZMA 4GTDA 3JCUQ 3OWTA 3VAYA 1B4BA 1M2VA 3POVA 3IEEA 3EGDB 3H0GA 4C3DA 1ZHTA 5EGEA 2R7RA 1D1AA 4M63A 2XXAA 4C3JC 5KYUA 3FAJA 2Q9CA 4GTFA 4BJTA 3ITFA 5JVOA 4KASA 2YHSA 3RIPA 2R93A 2CW0F 3FHZA 4I3MA 1AB4A 2CDQA 2NVYA 1ZVUA 2ZXOA 1Z23A 2D5RB 3EG9B 5BUOA 2VH3A 2J46A 3EH1A 4Q7CA 1J8YF 5CJ9A 3EZIA 4KBLA 3NKEA 2KWAA 4BJ1A 4LR2A 1FFTC 3Q6MA 4C3BA 4LERA 2BE5F 3ZIBA 4KI2A 2G3VA 2VUMA 2JA6A 4XLNF 4U5BE 2ZPAA 3DJNB 2CGEA 3N0CA 3EH2A 1O5HA 1O26A 2C03A 5KYWA 5F5FA 1MMGA 4ZLCA 2J9UA 2YU9A 3QMKA 4ULWA 1O2AA 5TJ3A 3T4RA 4ANJA 2B0JA 3MMLB 4KAWX 2ZXWC 5KYUB 3LAJA 2W45A 3Q7GA 3DM5A 4KB4A 5F5HA 3K66A 4AK9A 3F47A 4U5EE 3O39A 3T6JA 2E2HA 4OD5A 1MMNA 4CBEA 5IORA 1J8MF 2H7VC 3NKDA 5HSWA 2RGRA 3SYNA 4J30B 2ZFZA 3NG1A 4KMHA 1LS1A 3EHMA 2XCRB 2X51A 2NG1A 3AG1C 4DVYP 2CFAA 2Y3PA 4BG0A 1VOMA 3QX3A 4CS8C 3AG3C 1ZHYA 3OEPA 3B0VC 1BR1A 3LEVA 4CIHA 3DM9B 4YN0B 1Z3IX 1LVKA 4DDQA 4G7OF 5E33A 2G62A 3N2ZB 4PJLA 3EFOB 4P5BA 3VYWA 1WQGA 4I1MA 5DQZA 3EGDA 4PJJA 2Y39A 4G7HF 4CS8A 1OCRC 4CS7A 3ZC4A 3EZHA 3KL4A 2JA7A 4JVSA 3AG4C 4C7OA 2WB7A 5EGYA 4G7ZF 2J9VA 4OIOF 4IJJA 4G0UA 3GTKA 4O7GA 3NUHA 2WVNA 2XL4A 3NYMA 3UNGC 1B4AA 1VMAA 1IS1A 1ZHZA 3GODA 3ABLC 3K1IC 4YT2A 2DYRC 1WGWA 3V7OA 3RFYA 2E2IA 4JZAA 4A2NB 4GT9A 4N06A 3EHNA 1SFOA 4BKWA 4QI0A 3NYLA 3NYJA 3W8HA 4XWJA 1TWAA 3DAFA 2R7WA 3LLIA 4H4KC 2C04A 2J7PD 1ZXOA 3L0IA 1DD5A 2WVOA 2Y3HA 3L34A 4EBBA 4M1XA 3FOFA 3W8IA 1R9TA 3JYHA 4RDAA 4LLCA 4K7BA 1O28A 3ZG1A 1I3QA 3ASOC 4KMDA 5B3SC 4FM9A 4JCHA 4P5AA 4HEAJ 2HV7A 5E3CA 2KNHA 4BLAA 2M4EA 4C7OB 4OIQF 4BLBA 4KB2A 2A69F 2WZLA 4DBQA 1D0ZA 4XLPF 3V4GA 1ISEA 3F46A 3GTQA 2EIMC 3WG7C 1BJTA 1ZHXA 1EH1A 5DVWA 2JH3A 2R7XA 2NUPB 2HV6A 4RBNA 1KQ4A 1Z5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0X A; 
#chains in the Genus database with same CATH topology
 2ICW G;  2R7O A;  4MVM A;  2JD3 A;  2OJE D;  3AQB A;  3FOE A;  1YJG A;  3I4N K;  4PAA A;  4Y7N K;  3L1M A;  3GTJ K;  4X0R A;  1HMD A;  4BY7 K;  1TWH A;  3HOU K;  4Q5S A;  4XLP A;  4O79 A;  1MNE A;  1VYI A;  1TKN A;  2M64 A;  2XLE A;  2GSO A;  1ZU4 A;  3X1O A;  2QY9 A;  1R4T A;  1IBA A;  3AG2 C;  5IYC C;  4U5C E;  4JEA A;  5CI8 A;  4EWC A;  1YYX A;  4CSA A;  1TWC A;  1MND A;  2XRH A;  4QI2 A;  1V5V A;  4LK1 A;  4JEB A;  1M57 C;  3LAY A;  1VGX A;  4FWV A;  4DXW A;  2GSN A;  1M56 C;  4AH6 A;  1CGN A;  1SF8 A;  3I5Q A;  3W2V A;  4XTK A;  2PHC B;  3FKI A;  3OA1 A;  2PX0 A;  3DMD A;  5DLJ A;  2PP4 A;  1YYJ A;  2B63 C;  3A9C A;  5A6A A;  3S17 K;  3H3V D;  1XXB A;  3NMJ A;  3VRC A;  5DS5 A;  3M3Y K;  4U5G A;  2QLA A;  2Y3B A;  1QZX A;  2NUP A;  3CAG A;  4YT8 A;  2CCY A;  1JPN A;  4U5D E;  3ECS A;  3RKO F;  5TMC A;  2R7Z A;  1H6G A;  1DCO A;  1F1M A;  3GTO A;  2KC3 A;  1NU7 D;  5FLM K;  3HOV K;  2GFH A;  4BY1 C;  3CAX A;  4AL0 A;  1DCP A;  3I4U A;  4PFP A;  3HLZ A;  2WVQ A;  1BS2 A;  4BEJ A;  3T01 A;  2OG2 A;  2J7P A;  3S2D C;  4YT4 A;  2V6S A;  4F4B A;  5IYC K;  1PD1 A;  4GQH A;  3JZ0 A;  1EK8 A;  4O6M A;  3NDB B;  1I4Z A;  2R02 A;  2W9Y A;  2XSE A;  1LI7 A;  2IBF A;  3ATP A;  1WQF A;  4C3E A;  1WAS A;  2AP3 A;  3R2P A;  1ZW3 A;  1YCL A;  1GQA A;  4O6N A;  3KYJ A;  1DCH A;  4LLE A;  1WCM A;  5C3E C;  1FR0 A;  2B0H A;  2B63 K;  1KNY A;  1ORS C;  3GM1 A;  4BJ6 C;  1HI9 A;  3C18 A;  1Y1V A;  5IOS A;  1ZHW A;  3I5P A;  3OEO A;  2HJ3 A;  3CQZ A;  2OU6 A;  2Y69 C;  1U0B B;  3UMK A;  4IAR A;  4KC9 A;  3AQP A;  3RVZ A;  4KMA A;  5A69 A;  1OW8 A;  3ADA C;  3TD7 A;  1I3Q K;  1LKX A;  3E70 C;  5JFE A;  1OCZ C;  1ZBS A;  1YAR O;  4H54 A;  1QPU A;  1E83 A;  3TOM A;  4JW1 A;  3S28 A;  3TFH A;  4BY1 K;  2WB1 L;  3SXK A;  3CZ6 A;  4AE4 A;  4XPW A;  3JTL O;  2Y3D A;  3S29 A;  3H2U A;  4PK4 A;  1QSP A;  2LCH A;  1TWG A;  3RQG A;  2KJG A;  2YKZ A;  4O2D A;  3UR3 C;  3ZSU A;  3SEO A;  1OXB A;  3T6B A;  5COM A;  4OIP F;  1KU2 A;  2L6F A;  3X2Q C;  3RZO C;  5IP7 C;  4YFN A;  2CNW A;  1JOE A;  3K6B A;  1F9N A;  4PR9 A;  2KSF A;  3QVZ A;  2VAS A;  5C3E K;  3C62 A;  1Q0M A;  2EPK X;  2BC5 A;  3BP8 C;  3GEE A;  4KM9 A;  1TWC K;  3HNJ A;  4OIP A;  2FFH A;  1SMY F;  4A3L C;  1V54 C;  2X0C A;  1B68 A;  1PJ5 A;  3IHU A;  3LLK A;  2NVX A;  3PHF 2;  2A68 F;  1YLM A;  1AEP A;  3ASN C;  3PO2 C;  2Q3T A;  1OCC C;  3OWT A;  3ZWI A;  3IEE A;  3S14 K;  1SMY A;  4MS2 A;  2Q9C A;  3NMK A;  5JVO A;  1X31 C;  4KAS A;  2CW0 F;  4LK0 A;  2O5I A;  1IL2 A;  2CDQ A;  2A68 A;  4DRI B;  2VCC A;  2ZXO A;  4XEV A;  2D5R B;  5L0J A;  3K7A C;  4LR2 A;  1FFT C;  1RU0 A;  1V74 B;  2JA6 A;  3RZO K;  5IP7 K;  2RD9 A;  2CGE A;  2H8A A;  2WB1 D;  2CW0 A;  1NSG B;  3S1N C;  3T4R A;  2ZXW C;  3VF0 A;  3TK0 A;  3J06 A;  5F5H A;  3K66 A;  3F47 A;  4U5E E;  2H7V C;  3NKD A;  4JTA B;  3SYN A;  1T01 A;  4KMH A;  3EHM A;  3GDZ A;  2W7V A;  2NG1 A;  3AG1 C;  4BG0 A;  1VOM A;  3QX3 A;  2VCA A;  1I6H C;  3S15 C;  3PO2 K;  4QJV B;  3DM9 B;  2JA7 C;  1LVK A;  4DDQ A;  1HQM A;  4P5B A;  3VYW A;  1WQG A;  3C8G B;  1QKR A;  3RQE A;  4DJ9 A;  4G7H F;  1SFO C;  2LD6 A;  2F22 A;  1OCR C;  2R25 A;  3KL4 A;  3AG4 C;  2WB7 A;  1TWA C;  3SXY A;  3K7A K;  5IP9 C;  4WAB A;  3JRM O;  4OIO F;  4X6A C;  2WVN A;  1B4A A;  3NMI A;  4BBS C;  4YT2 A;  5BQH A;  1HE9 A;  4A2N B;  4N06 A;  1YDI A;  3BEH A;  4QI0 A;  3NYL A;  4R32 A;  3C63 A;  4G7H A;  3DAF A;  2HMZ A;  2R7W A;  4A3J C;  2AWC A;  1A0B A;  2FQT A;  4H4K C;  3S1N K;  2C04 A;  1LE2 A;  1BBH A;  4M1X A;  4C45 A;  4OIO A;  1YZC A;  1TWG K;  3C7J A;  4LLC A;  1WTY A;  4P9S A;  1OQC A;  1F7U A;  2EPL X;  4ZH4 A;  1K05 A;  4A3C C;  2M4E A;  5JRA A;  4DBQ A;  3GOR A;  2NPU A;  1K83 C;  3G4Z A;  5DVW A;  2V6T A;  5FZT A;  3S15 K;  4RBN A;  1Z5Z A;  5IOT A;  2JA7 K;  4QDL A;  1WIH A;  1G8X A;  3MYI A;  4QJV A;  3HOY C;  3JYY A;  1YVI A;  2P0N A;  1NG1 A;  1JQW A;  4OIR F;  2LK4 A;  1SFO K;  4FAP B;  3TFJ A;  4MW8 A;  4RD9 A;  3GWN A;  1Q0K A;  4LJZ A;  1FMV A;  1L0W A;  2PF4 E;  2WL8 A;  1APC A;  3N0T A;  4X6A K;  3MLG A;  2JA5 C;  4BBS K;  3RZD C;  3Q3Q A;  1OXK A;  3DXJ A;  1OCO C;  3LS0 A;  4MVS A;  1J98 A;  1XXA A;  1YA9 A;  1T6Q A;  4OIR A;  5FCL A;  3ZVR A;  1O24 A;  1ST6 A;  4E17 A;  4A3J K;  4EUK B;  1WAT A;  4PFO A;  2PNO A;  4CS9 C;  1WN0 A;  1Y4C A;  4JC7 A;  3ABM C;  1D1B A;  2OCC C;  2MWQ A;  4CX9 A;  4BBR C;  3W2W A;  2UUH A;  2R7V A;  4A3C K;  3JT1 A;  2HFI A;  1ORJ A;  4JTD B;  3AH5 A;  4KN7 A;  5F28 E;  1K83 K;  2YQY A;  3LNM B;  2XCO A;  4J3N A;  3B0P A;  5IYB C;  4N6H A;  2B63 A;  3VA7 A;  3B0U X;  2EPO A;  2YRF A;  1D0X A;  1BR2 A;  4E0H A;  3HOY K;  1MQV A;  3L4K A;  1GGQ A;  2OJQ A;  2NVQ C;  2VC9 A;  2NSF A;  3O55 A;  2NSG A;  2JA5 K;  4G78 A;  4MVR A;  2KW3 C;  4DOZ A;  1ZQ1 C;  4JJF A;  3FVY A;  1XZP B;  5L0H A;  2O5J A;  1BR4 A;  3Q6N A;  3A8K A;  3US6 A;  4Q5S F;  2PFD A;  1Q0D A;  2Q00 A;  4A3I C;  4AL1 A;  1WOR A;  1WSR A;  4DVZ A;  2R7U A;  4NCQ A;  3T6G B;  2MYS A;  5A6K A;  4HFF B;  1W2W A;  3FOO A;  5EK0 A;  3S2H C;  2XS8 A;  5DS4 A;  1KTM A;  1EI7 A;  3MX3 A;  1T6U A;  3JSE O;  1FFH A;  2YLG A;  4B6I A;  1XWJ A;  4PAB A;  1E2X A;  2WZF A;  2YZS A;  3U2L A;  5JLI A;  1YX2 A;  1E84 A;  3M1C B;  5CHP A;  2JX0 A;  5IYB K;  2JPU A;  2XM4 A;  3DJU B;  3GTP C;  3B9Q A;  1DOW A;  1Z7Q c;  4BJ6 A;  3WAQ A;  4QIW L;  5L0G A;  1PCX A;  1OKK A;  4HE8 D;  3GWL A;  2NVQ K;  1D0Y A;  2LSE A;  1H9T A;  2QNL A;  2IXN A;  1SZI A;  1BDF A;  4JUR I;  4JE9 A;  5CI9 A;  5HL8 A;  1OW7 A;  4W8P A;  3FOP A;  1USM A;  1LIH A;  1XZP A;  4KM8 A;  2LFF A;  4LAC B;  4A3I K;  1A7E A;  3U9M A;  2AWY A;  2QUP A;  2W4M A;  1XZQ B;  3RQF A;  3LPX A;  1I50 C;  3GTM C;  4DRH B;  2KQ9 A;  4IWB A;  3S2H K;  2ZXP A;  5EGH A;  3JRT A;  2PX3 A;  4CIP A;  5A6J A;  3HKZ D;  4O6Y A;  2XLD A;  3N3Y A;  1BGW A;  3NRH A;  4JKV A;  1YAU O;  2DGJ A;  3WHN A;  4AX2 A;  5JS5 A;  1HY5 A;  2YL0 A;  4AE4 B;  4EBK A;  3H0G C;  2XL8 A;  4ILD A;  1NFN A;  1MMA A;  1C17 M;  3GTP K;  3U8V A;  1EFW A;  4GTC A;  2R93 C;  3LEO A;  4WGY A;  2J45 A;  2L81 A;  5T3W A;  5BQG A;  1LM3 B;  3BUE A;  4U9D A;  4NTB A;  3AOU A;  3U9J A;  2EIL C;  4E7Z A;  4XEF A;  2VCB A;  3POV A;  1ZHT A;  4MEX A;  1D1A A;  1F93 A;  4M63 A;  4C3J C;  1NFO A;  2ZUF A;  1RKC A;  2VUM C;  3AGU A;  3ZDL A;  4A3D C;  5CIV A;  3FHZ A;  1ZVU A;  1Z23 A;  2VH3 A;  4Q7C A;  4LLG A;  5CJ9 A;  2AU5 A;  3T9O A;  4KBL A;  2KWA A;  1FNT c;  1FAP B;  4BJ1 A;  4QIW D;  5C4X C;  1G5Z A;  4LER A;  3ZIB A;  4KI2 A;  1IQ0 A;  2L7A A;  3M4C A;  5M3F K;  2E2H C;  3N0C A;  1XZQ A;  5IYD C;  4OIQ A;  1TFK B;  1IE0 A;  2A69 A;  4XPY A;  1EKY A;  1O2A A;  1BDJ B;  3LAJ A;  3Q7G A;  1RMV A;  4IB4 A;  3O39 A;  3T6J A;  4CBE A;  5IOR A;  4JTC B;  2KYH A;  1J6W A;  3H0G K;  3IQC A;  3S2D K;  2HS5 A;  1WOS A;  2R93 K;  5JUA A;  3TJ5 A;  2EPN A;  2YLI A;  3AG3 C;  2YVK A;  4P9T A;  3B71 A;  3B0V C;  3RF3 A;  2G62 A;  3EFO B;  4C3J K;  4Y52 C;  3HOZ C;  2ETS A;  3S16 C;  3IPJ A;  2VUM K;  3TJ6 A;  5L0C A;  1OW6 A;  2TMV P;  2Y39 A;  4A3D K;  3H2V A;  3I4M C;  3ZC4 A;  4WGZ A;  5BQI A;  2JA7 A;  3JST A;  1E86 A;  1HMO A;  3ZTM A;  4IJJ A;  3UNG C;  2XL4 A;  3T00 A;  1ZHZ A;  3GOD A;  3ABL C;  4UDV A;  1V4A A;  3EHN A;  1SFO A;  4BKW A;  2E2H K;  2JA8 C;  2HZ8 A;  3W8H A;  3M4O C;  1TWA A;  2OOC A;  2J7P D;  1JVI A;  2WVO A;  3FOF A;  1PJ6 A;  4IAQ A;  3JYH A;  4RDA A;  2HUJ A;  3ASO C;  5B3S C;  4JCH A;  4HEA J;  4BLB A;  1LI5 A;  4CJG A;  2FAP B;  2DI3 A;  3S1Q C;  3U3F A;  3GIR A;  3QW0 A;  1M6T A;  2HV6 A;  1Q0G A;  2I8B A;  1TR2 A;  5IY5 C;  1TWF C;  2Q9B A;  1GS9 A;  1AUE A;  4Y52 K;  2GSU A;  1C02 A;  3KH2 A;  3HOZ K;  3ORE A;  1K83 A;  1JPJ A;  3EFO A;  5KYX B;  3M79 A;  4CDA A;  3I4M K;  5C4J C;  3EPV A;  3UMH A;  3TQO A;  3S1M C;  3EJN A;  3UGO A;  1RCP A;  4MW3 A;  3GTL C;  4A3L K;  2I15 A;  3E9V A;  3DE9 A;  3O6X A;  2JA8 K;  2NVT C;  1EQR A;  5B1A C;  4PAC A;  1YA7 O;  1VB5 A;  2JA5 A;  1UV7 A;  1HE1 A;  2CYD A;  4Z9J A;  2RH6 A;  3AQO A;  1G4U S;  4P6I C;  2V3C C;  2J9B A;  4JJG A;  3LNR A;  2Q9A A;  3IPM O;  3KYI A;  5L46 A;  3SZZ A;  1WOO A;  5DQT A;  3DI5 A;  1T6I A;  4FX5 A;  2IXM A;  4CS9 A;  3S1Q K;  4GTL A;  3LS1 A;  1NLX A;  3CSK A;  5E3A A;  2EBB A;  3PO3 C;  3PMR A;  2OKU A;  2A6H A;  1RJ9 B;  1QLE C;  1TWF K;  2WAQ L;  2A6E F;  4D4N A;  3UGP A;  4PJM A;  4ONS A;  1TFO B;  2RSE B;  4NTF A;  4LDK A;  2A0U A;  4KNW A;  5KYX A;  4D4X A;  1K40 A;  4NY3 A;  1VYK A;  3S1M K;  1S05 A;  2V26 A;  1INN A;  4EHP A;  3DWW A;  3AD9 C;  2NUT B;  2A6E A;  4I1O B;  1ZYR F;  3U0C A;  4YL0 A;  3O10 A;  2GAH C;  2H7B A;  3WOD A;  4BJ5 C;  4KAR A;  4GYT A;  4YJW A;  3BRJ A;  1I6H K;  2ZUE A;  3GM3 A;  5KYN A;  1UFB A;  4C2M C;  1TQG A;  2J0X A;  2XLH A;  1QQ3 A;  4MQ9 A;  3AQC A;  3U3B A;  3DXJ F;  4FES A;  4OIN F;  1ZYR A;  5KYY B;  3FHD A;  3PCV A;  4A93 C;  5T3T A;  2PA8 L;  2ZXR A;  1Z6A A;  1MMD A;  3EGX B;  3JSZ A;  4AYB L;  4W8K A;  1TWA K;  3PO3 K;  3HNI A;  4KN4 A;  1J6X A;  4XCH A;  5IP9 K;  3IQ5 A;  3GTG C;  4G0W A;  3HOX C;  5L0F A;  4I44 A;  4OIN A;  2XLV A;  3S27 A;  3TTG A;  1RJ9 A;  4ER9 A;  2P5M A;  4XSX A;  1M2V B;  4EIY A;  3QZC A;  5A6B D;  3GAN A;  5C44 C;  3SZY A;  1O25 A;  2HSQ A;  1O27 A;  4WJ0 A;  3GTP A;  4MVQ A;  4J32 B;  2YWA A;  5JVE A;  2OEV A;  5E2Q A;  3ZQY A;  5L3Q A;  4XEK A;  4A3M C;  2WAQ D;  4JRZ A;  1J6V A;  4MND A;  2NUT A;  1Y1W C;  3HJC A;  1A7V A;  4E7S A;  2EIJ C;  2IXO A;  2BL2 A;  5KYW B;  1S7Z A;  2H7O A;  4YT5 A;  3GTJ C;  2YEV A;  4C2M K;  2XLO A;  1ZVZ A;  4K0D A;  2A1D D;  2GDC A;  1I5N A;  5AC4 A;  2P8T A;  1IW7 F;  3DD7 A;  3DAG A;  1NBB A;  5KYY A;  1PV3 A;  1WOL A;  3EG9 A;  1I50 A;  2R92 C;  3GTM A;  3EGX A;  4G7O A;  4FZB A;  3TUL A;  3GTG K;  4BXX C;  3TFI A;  2CFA B;  4EBJ A;  4YK5 A;  3HOX K;  2J9W A;  3RZD K;  2W4B A;  3HKZ L;  3ERE D;  1DOV A;  2PA8 D;  1IW7 A;  5AGF A;  2D4U A;  2NVY C;  3JCU Q;  1T5O A;  4BEM J;  3U5S A;  3HXA A;  1M2V A;  4AYB D;  3H0G A;  4C3D A;  5C44 K;  2R9R B;  2R7R A;  5KYU A;  3FAJ A;  1A41 A;  3IQ6 A;  3ITF A;  4A3K C;  2YHS A;  3RIP A;  2R93 A;  4ULV A;  4BBR K;  2DB4 A;  4YL3 A;  1F7V A;  3EH1 A;  4A3M K;  4LDR A;  1OR3 A;  2YU9 C;  5M5W K;  2KK1 A;  2VUM A;  4NTA A;  3L8J A;  1T9K A;  4U5B E;  1CGO A;  3DJN B;  1EI6 A;  4XPX A;  3C8G D;  4A3B C;  3EH2 A;  1WSV A;  1O5H A;  1O26 A;  2C03 A;  5KYW A;  5FLM C;  4WJ4 A;  1MMG A;  1VH2 A;  3HOV C;  1LPE A;  5TJ3 A;  2B0J A;  3LUT B;  2W45 A;  3DM5 A;  3AD8 C;  4AK9 A;  4CJO A;  2R92 K;  2E2H A;  4JIO A;  4BXX K;  1LS1 A;  2YLD A;  4A3G C;  2XCR B;  4DVY P;  2CFA A;  1LS4 A;  2Y3P A;  4CS8 C;  2NVY K;  1ZHY A;  4A3E C;  4CIH A;  3S90 A;  4YN0 B;  3ZTZ A;  5E33 A;  1VRQ C;  3B29 A;  3GTK C;  4PJL A;  3HNL A;  1JOG A;  4I1M A;  5DQZ A;  4A3K K;  4PJJ A;  2E2I C;  2XM0 A;  5E68 A;  3VM6 A;  2YL7 A;  4CS7 A;  5B3I A;  4MTF A;  4JVS A;  4C7O A;  5EGY A;  4G7Z F;  3RW0 A;  2YU9 K;  2OQM A;  4G0U A;  3IQT A;  1IS1 A;  3NYM A;  2YL3 A;  1VLO A;  2HKV A;  1H9G A;  1ZW2 A;  3K1I C;  2DYR C;  1R9T C;  3V7O A;  3RFY A;  4JZA A;  1I3Q C;  4A3B K;  3NYJ A;  4A3F C;  3V5Y A;  1HW2 A;  1ZXO A;  4G7Z A;  1PJ7 A;  1LE4 A;  3GTQ C;  1DD5 A;  2YL1 A;  3L34 A;  4EBB A;  3W8I A;  4K7B A;  1O28 A;  3ZG1 A;  4KMD A;  4JCZ A;  4DRJ B;  5E3C A;  2KNH A;  4BLA A;  4OIQ F;  4A3G K;  2A69 F;  2WZL A;  3AD7 C;  1D0Z A;  1O3U A;  3V4G A;  3F46 A;  2EIM C;  1EH1 A;  1TWH C;  2JH3 A;  2R7X A;  4A3E K;  4MTG A;  4E0I A;  1O2B A;  2R7S A;  1CPR A;  2J0W A;  3AJM A;  2DYS C;  3ZQV A;  1JRA A;  3GTK K;  1I50 K;  3GTM K;  5T1D B;  4IGG A;  3SP1 A;  1V55 C;  2P7V A;  3V5Z A;  2E2I K;  1U6H A;  2L9J A;  2R03 A;  5D91 A;  3SXZ A;  4KMU A;  3LJB A;  1JR8 A;  4K1O A;  4CSA C;  1TWC C;  2LP4 A;  1FMW A;  4GFQ A;  3HKK A;  1TWF A;  2ZD9 A;  2E87 A;  3K33 A;  1VK5 A;  3BP3 A;  1N1C A;  2R7T A;  1VLS A;  1ZU5 A;  1R9T K;  3RYL A;  1OKK D;  4CDV A;  3FKI C;  2EIK C;  2XS1 A;  4A3F K;  4KNV A;  3S14 C;  3V5X A;  4GTE A;  3GTQ K;  3GTL A;  3Q7L A;  4KDD A;  3CEX A;  5L3V A;  1XXC A;  2O9X A;  3G4C A;  2FGY A;  3QW1 A;  3KMI A;  3LES A;  1WWP A;  2MHR A;  4A4A A;  4LQY A;  4GEH A;  1YNN A;  4U5F E;  3S0X A;  2Q4F A;  2IM8 A;  4L6R A;  2R7Z C;  3AGT A;  4OD4 A;  4NOI A;  2XCQ A;  3GTO C;  1TWH K;  2EIN C;  5C4X K;  3L4J A;  1YNJ A;  1YZA A;  1RKE B;  4C3I C;  3PDM P;  1GM5 A;  3GM2 A;  5IYD K;  3QVY A;  3EQL F;  5DS6 A;  4KC6 A;  3SNH A;  2L6H A;  2PMZ L;  1VLT A;  4U5H A;  4IAO A;  3ABK C;  1SR2 A;  1VJE A;  1NZE A;  3DKA A;  1QVX A;  3KPH A;  4LDQ A;  2OEX A;  1G51 A;  4MVO A;  2FQO A;  2GAG C;  3UMI A;  1Z63 A;  4KAT A;  4ZLD A;  3FKI K;  4C3H C;  4Z9I A;  4Q4Z F;  3EQL A;  1WCM C;  3L8I A;  4PJN A;  1PD0 A;  2R05 A;  3SZR A;  3W4Y A;  3DZA A;  4EKW A;  1Y1V C;  2IOQ A;  3FDQ A;  4YFX A;  3H65 A;  3CQZ C;  5M5X K;  3KKB A;  5D4D A;  3S16 K;  3G4X A;  5HV9 A;  4BJ5 A;  4Q4Z A;  1NU9 C;  1K04 A;  2R7Z K;  2QTV A;  3GTO K;  2QE9 A;  3A8I A;  2AVK A;  4P9F A;  1GE9 A;  4WIL A;  4DBR A;  3HNK A;  1O87 A;  4YL1 A;  4C3I K;  2Y3G A;  1WQH A;  1RKE A;  3TOL A;  1M2O A;  3M4O K;  4U9E A;  5L0I A;  5EHH A;  2XXA B;  3GTG A;  1TWG C;  1L7C A;  3OPF A;  3MFN A;  1C0A A;  3G4A A;  1VTM P;  3U2M A;  2D6F C;  2R7Q A;  5A6B A;  4GTB A;  3S1R C;  2A6H F;  3A11 A;  2IXP A;  3N24 A;  4MVZ A;  2LQG A;  2XLW A;  4GTA A;  4XQ1 A;  256B A;  5B1B C;  4IRU A;  2GAQ A;  3N0B A;  3HTK C;  2WZG A;  2IYL D;  4C3H K;  2CNW D;  3LAP A;  1WCM K;  3R7C A;  1Y1W K;  1R5I D;  4HFK B;  3HOW C;  1H7I A;  3DE8 A;  2PMZ D;  3K1H A;  3GEH A;  4G0H A;  5IOQ A;  4CDY A;  5JT4 A;  2HSB A;  1WOP A;  1Y1V K;  5D92 A;  2G3K A;  2PPB A;  5GPG B;  1ZZP A;  4Z9H A;  3CQZ K;  4YG2 A;  2EPM X;  2Z15 A;  1Y1W A;  2NVX C;  1AVO B;  3M4B A;  5JSL A;  4YWQ A;  4MEY A;  4NC3 A;  1D1C A;  4XSZ A;  3WOD F;  2V6U A;  4N4W A;  2XLM A;  5L0D A;  3GTJ A;  2VB6 A;  5C4J K;  1JAF A;  2P6V A;  2KGO A;  1FTS A;  4G0V A;  3RH3 A;  3GTL K;  4MQ9 F;  4WJ3 M;  2L6G A;  2PBE A;  3GEI A;  1O29 A;  2R92 A;  1C03 A;  2NVT K;  3K7D A;  1IZM A;  5COF A;  4GTD A;  3VAY A;  1B4B A;  4JK1 A;  3EGD B;  5EGE A;  5M5Y K;  2XXA A;  1EQ1 A;  3A8J A;  4BPM A;  4GTF A;  4BJT A;  3GSI A;  2P61 A;  2JA6 C;  3S1R K;  4I3M A;  1AB4 A;  2LIG A;  2NVY A;  3EG9 B;  5BUO A;  2J46 A;  1E85 A;  1J8Y F;  2GA0 A;  3FXH A;  3EZI A;  2J8W A;  2ASR A;  3NKE A;  2Q7R A;  3QTH A;  3Q6M A;  1L3P A;  3HOW K;  4C3B A;  2A0B A;  2BE5 F;  2G3V A;  4XLN F;  2ZPA A;  3M15 A;  3SXM A;  3FAP B;  2P1A A;  1O2F B;  2Y0S L;  5F5F A;  4ZLC A;  2J9U A;  2YU9 A;  3C8G A;  3QMK A;  4ULW A;  1G4W R;  2NVX K;  1SYQ A;  4ANJ A;  3MML B;  4KAW X;  5KYU B;  4KB4 A;  2E2J C;  2BE5 A;  5FJ8 K;  3S84 A;  4OD5 A;  1MMN A;  3T02 A;  4XLN A;  1J8M F;  5HSW A;  2RGR A;  1CPQ A;  4J30 B;  2ZFZ A;  3NG1 A;  5K0I A;  3RVY A;  2X51 A;  4MTO A;  5AC5 A;  4J7T A;  3OEP A;  4LOW A;  1BR1 A;  3LEV A;  4GZY A;  5M3M K;  4YFK A;  1Z3I X;  3I4N C;  4G7O F;  5COG A;  4Y7N C;  3N2Z B;  2GWW A;  3EGD A;  2JA6 K;  4BY7 C;  3HOU C;  4E18 A;  4CS8 A;  4N6C A;  1JMW A;  2HMQ A;  4A93 K;  3EZH A;  3FMS A;  1Q0F A;  2J9V A;  2LFD A;  1EA8 A;  1HW1 A;  4O7G A;  3GTK A;  3NUH A;  1U89 A;  1USO A;  1VMA A;  3MYF A;  1WGW A;  5TJ5 E;  2E2I A;  4GT9 A;  3G50 A;  1Y6D A;  5TMF A;  1A7D A;  1ORY A;  4XWJ A;  3H3V L;  2UUI A;  1UG7 A;  4NQF A;  1OR2 A;  3LLI A;  1RXQ A;  3S9O A;  4RMF A;  3L0I A;  2Y3H A;  3K1I A;  1R9T A;  5JP7 A;  1XPP A;  2E2J K;  2HJM A;  1I3Q A;  4FM9 A;  2XL6 A;  3C8Z A;  4P5A A;  2HV7 A;  4C7O B;  4KB2 A;  3MBG A;  4XLP F;  1ISE A;  3S17 C;  3GTQ A;  3WG7 C;  1BJT A;  2Y0S D;  1ZHX A;  1I4Y A;  3U8P A;  4MVU A;  1BZ4 A;  2NUP B;  4J7Y A;  1CGM E;  3M3Y C;  1I6V A;  1KQ4 A; 
#chains in the Genus database with same CATH homology
 1O2B A;  5IOT A;  2R7S A;  2I8B A;  2R7O A;  2J0W A;  2JD3 A;  3AQB A;  2DYS C;  4QDL A;  3FOE A;  1TR2 A;  5IY5 C;  1G8X A;  1WIH A;  2Q9B A;  5T1D B;  2GSU A;  3KH2 A;  4X0R A;  3SP1 A;  3ORE A;  1V55 C;  2P7V A;  1K83 A;  1JPJ A;  1NG1 A;  1TWH A;  3EFO A;  4O79 A;  2L9J A;  5D91 A;  1MNE A;  4OIR F;  5KYX B;  1VYI A;  1TKN A;  3LJB A;  4RD9 A;  4CSA C;  2GSO A;  1FMV A;  3EPV A;  1FMW A;  2PF4 E;  3UMH A;  4GFQ A;  1ZU4 A;  2WL8 A;  3X1O A;  1TWF A;  2E87 A;  3EJN A;  3N0T A;  2QY9 A;  3K33 A;  3MLG A;  3UGO A;  1VK5 A;  1N1C A;  3AG2 C;  2R7T A;  3Q3Q A;  1ZU5 A;  3RYL A;  4U5C E;  1OKK D;  5CI8 A;  1OCO C;  3LS0 A;  3E9V A;  2EIK C;  4EWC A;  3O6X A;  1XXA A;  4CSA A;  1TWC A;  5FCL A;  3ZVR A;  1O24 A;  1ST6 A;  5B1A C;  1MND A;  2XRH A;  4QI2 A;  4KNV A;  1M57 C;  3LAY A;  4PFO A;  4CS9 C;  2JA5 A;  4FWV A;  4GTE A;  3GTL A;  2GSN A;  2RH6 A;  3AQO A;  1M56 C;  3Q7L A;  1SF8 A;  3ABM C;  3I5Q A;  1D1B A;  4P6I C;  3W2V A;  2O9X A;  2OCC C;  4XTK A;  2MWQ A;  2FGY A;  3OA1 A;  5L3V A;  2V3C C;  1XXC A;  2PHC B;  3G4C A;  3FKI A;  2PX0 A;  3KMI A;  3LES A;  4JJG A;  3W2W A;  3LNR A;  2R7V A;  3DMD A;  5DLJ A;  3JT1 A;  4LQY A;  2PP4 A;  4GEH A;  2Q9A A;  4U5F E;  3S0X A;  3AH5 A;  5DQT A;  4FX5 A;  2IXM A;  4CS9 A;  4OD4 A;  4GTL A;  3LS1 A;  1XXB A;  2XCQ A;  3CSK A;  5E3A A;  3PMR A;  5DS5 A;  4U5G A;  2EIN C;  2XCO A;  4J3N A;  3B0P A;  2Y3B A;  3L4J A;  1QZX A;  2NUP A;  1RJ9 B;  3CAG A;  4YT8 A;  2B63 A;  1QLE C;  3VA7 A;  3B0U X;  1JPN A;  1D0X A;  4C3I C;  4U5D E;  3ECS A;  3RKO F;  1BR2 A;  2A6E F;  2R7Z A;  3UGP A;  4PJM A;  3L4K A;  3GTO A;  3EQL F;  5DS6 A;  1NU7 D;  4KC6 A;  3SNH A;  4U5H A;  2GFH A;  4IAO A;  4KNW A;  3ABK C;  5KYX A;  3I4U A;  4PFP A;  4NY3 A;  3HLZ A;  1NZE A;  1VYK A;  2WVQ A;  2V26 A;  4BEJ A;  2OG2 A;  2KW3 C;  2J7P A;  4DOZ A;  4YT4 A;  4JJF A;  4F4B A;  2NUT B;  3FVY A;  4I1O B;  3UMI A;  1ZYR F;  1PD1 A;  1Z63 A;  4KAT A;  4ZLD A;  1BR4 A;  3Q6N A;  1EK8 A;  4O6M A;  4C3H C;  4Q4Z F;  4Q5S F;  2PFD A;  3NDB B;  2H7B A;  2W9Y A;  4PJN A;  2XSE A;  1PD0 A;  4BJ5 C;  3SZR A;  4KAR A;  4GYT A;  4YJW A;  4DVZ A;  1WQF A;  4C3E A;  2R7U A;  3DZA A;  2MYS A;  4HFF B;  1W2W A;  5KYN A;  2IOQ A;  4C2M C;  4O6N A;  3FDQ A;  2J0X A;  4LLE A;  3AQC A;  3DXJ F;  3H65 A;  4FES A;  4OIN F;  5KYY B;  3FHD A;  3KKB A;  5DS4 A;  5T3T A;  1WCM A;  3MX3 A;  2ZXR A;  1Z6A A;  4BJ5 A;  1MMD A;  1FFH A;  3EGX B;  4B6I A;  1NU9 C;  3JSZ A;  4BJ6 C;  2QTV A;  2WZF A;  1Y1V A;  5IOS A;  4W8K A;  2YZS A;  1ZHW A;  3I5P A;  3OEO A;  3M1C B;  5CHP A;  4G0W A;  4KDD A;  1GE9 A;  3CQZ A;  2Y69 C;  3DJU B;  4DBR A;  3UMK A;  4I44 A;  3B9Q A;  4KC9 A;  3AQP A;  1O87 A;  4KMA A;  3S27 A;  1RJ9 A;  3TD7 A;  4BJ6 A;  1LKX A;  2P5M A;  3E70 C;  1M2V B;  5JFE A;  2Y3G A;  1WQH A;  1OCZ C;  3QZC A;  1M2O A;  3GAN A;  1ZBS A;  5EHH A;  2XXA B;  1PCX A;  1OKK A;  3GTG A;  3OPF A;  4HE8 D;  1D0Y A;  2LSE A;  4JW1 A;  3S28 A;  1O25 A;  1O27 A;  3G4A A;  2IXN A;  1SZI A;  4WJ0 A;  2R7Q A;  3GTP A;  4GTB A;  4JUR I;  5CI9 A;  2A6H F;  4J32 B;  2IXP A;  3N24 A;  3CZ6 A;  5E2Q A;  4AE4 A;  4GTA A;  5L3Q A;  2Y3D A;  5B1B C;  4IRU A;  3N0B A;  3S29 A;  4PK4 A;  3HTK C;  2WZG A;  2IYL D;  1TWG A;  2CNW D;  4MND A;  3LAP A;  2KJG A;  2NUT A;  4KM8 A;  4LAC B;  4HFK B;  3HJC A;  3UR3 C;  3ZSU A;  3K1H A;  4G0H A;  3SEO A;  3T6B A;  4OIP F;  5IOQ A;  2W4M A;  1KU2 A;  3X2Q C;  4E7S A;  2EIJ C;  2IXO A;  3LPX A;  2CNW A;  5KYW B;  5D92 A;  1S7Z A;  2H7O A;  4YT5 A;  3K6B A;  2YEV A;  1F9N A;  2G3K A;  2KQ9 A;  4IWB A;  2ZXP A;  4K0D A;  2VAS A;  2A1D D;  5EGH A;  3JRT A;  2PX3 A;  2Z15 A;  4O6Y A;  1Y1W A;  1IW7 F;  3DD7 A;  3DAG A;  4YWQ A;  5KYY A;  3N3Y A;  1D1C A;  1BGW A;  3WOD F;  3NRH A;  4KM9 A;  3EG9 A;  2DGJ A;  1I50 A;  3GTM A;  4AX2 A;  3EGX A;  3GTJ A;  2VB6 A;  2FFH A;  1SMY F;  4AE4 B;  4FZB A;  1V54 C;  2P6V A;  2KGO A;  2CFA B;  1FTS A;  2J9W A;  4G0V A;  4ILD A;  1MMA A;  3RH3 A;  4MQ9 F;  2W4B A;  3LLK A;  2NVX A;  3PHF 2;  2A68 F;  4GTC A;  2J45 A;  2L81 A;  3ERE D;  5T3W A;  1O29 A;  3BUE A;  3ASN C;  2R92 A;  2EIL C;  1OCC C;  2Q3T A;  4E7Z A;  3K7D A;  1IZM A;  4GTD A;  3JCU Q;  3OWT A;  3VAY A;  1B4B A;  1M2V A;  3POV A;  3IEE A;  3EGD B;  3H0G A;  4C3D A;  1ZHT A;  5EGE A;  2R7R A;  1D1A A;  4M63 A;  2XXA A;  4C3J C;  5KYU A;  3FAJ A;  2Q9C A;  4GTF A;  4BJT A;  3ITF A;  5JVO A;  4KAS A;  2YHS A;  3RIP A;  2R93 A;  2CW0 F;  3FHZ A;  4I3M A;  1AB4 A;  2CDQ A;  2NVY A;  1ZVU A;  2ZXO A;  1Z23 A;  2D5R B;  3EG9 B;  5BUO A;  2VH3 A;  2J46 A;  3EH1 A;  4Q7C A;  1J8Y F;  5CJ9 A;  3EZI A;  4KBL A;  3NKE A;  2KWA A;  4BJ1 A;  4LR2 A;  1FFT C;  3Q6M A;  4C3B A;  4LER A;  2BE5 F;  3ZIB A;  4KI2 A;  2G3V A;  2VUM A;  2JA6 A;  4XLN F;  4U5B E;  2ZPA A;  3DJN B;  2CGE A;  3N0C A;  3EH2 A;  1O5H A;  1O26 A;  2C03 A;  5KYW A;  5F5F A;  1MMG A;  4ZLC A;  2J9U A;  2YU9 A;  3QMK A;  4ULW A;  1O2A A;  5TJ3 A;  3T4R A;  4ANJ A;  2B0J A;  3MML B;  4KAW X;  2ZXW C;  5KYU B;  3LAJ A;  2W45 A;  3Q7G A;  3DM5 A;  4KB4 A;  5F5H A;  3K66 A;  4AK9 A;  3F47 A;  4U5E E;  3O39 A;  3T6J A;  2E2H A;  4OD5 A;  1MMN A;  4CBE A;  5IOR A;  1J8M F;  2H7V C;  3NKD A;  5HSW A;  2RGR A;  3SYN A;  4J30 B;  2ZFZ A;  3NG1 A;  4KMH A;  1LS1 A;  3EHM A;  2XCR B;  2X51 A;  2NG1 A;  3AG1 C;  4DVY P;  2CFA A;  2Y3P A;  4BG0 A;  1VOM A;  3QX3 A;  4CS8 C;  3AG3 C;  1ZHY A;  3OEP A;  3B0V C;  1BR1 A;  3LEV A;  4CIH A;  3DM9 B;  4YN0 B;  1Z3I X;  1LVK A;  4DDQ A;  4G7O F;  5E33 A;  2G62 A;  3N2Z B;  4PJL A;  3EFO B;  4P5B A;  3VYW A;  1WQG A;  4I1M A;  5DQZ A;  3EGD A;  4PJJ A;  2Y39 A;  4G7H F;  4CS8 A;  1OCR C;  4CS7 A;  3ZC4 A;  3EZH A;  3KL4 A;  2JA7 A;  4JVS A;  3AG4 C;  4C7O A;  2WB7 A;  5EGY A;  4G7Z F;  2J9V A;  4OIO F;  4IJJ A;  4G0U A;  3GTK A;  4O7G A;  3NUH A;  2WVN A;  2XL4 A;  3NYM A;  3UNG C;  1B4A A;  1VMA A;  1IS1 A;  1ZHZ A;  3GOD A;  3ABL C;  3K1I C;  4YT2 A;  2DYR C;  1WGW A;  3V7O A;  3RFY A;  2E2I A;  4JZA A;  4A2N B;  4GT9 A;  4N06 A;  3EHN A;  1SFO A;  4BKW A;  4QI0 A;  3NYL A;  3NYJ A;  3W8H A;  4XWJ A;  1TWA A;  3DAF A;  2R7W A;  3LLI A;  4H4K C;  2C04 A;  2J7P D;  1ZXO A;  3L0I A;  1DD5 A;  2WVO A;  2Y3H A;  3L34 A;  4EBB A;  4M1X A;  3FOF A;  3W8I A;  1R9T A;  3JYH A;  4RDA A;  4LLC A;  4K7B A;  1O28 A;  3ZG1 A;  1I3Q A;  3ASO C;  4KMD A;  5B3S C;  4FM9 A;  4JCH A;  4P5A A;  4HEA J;  2HV7 A;  5E3C A;  2KNH A;  4BLA A;  2M4E A;  4C7O B;  4OIQ F;  4BLB A;  4KB2 A;  2A69 F;  2WZL A;  4DBQ A;  1D0Z A;  4XLP F;  3V4G A;  1ISE A;  3F46 A;  3GTQ A;  2EIM C;  3WG7 C;  1BJT A;  1ZHX A;  1EH1 A;  5DVW A;  2JH3 A;  2R7X A;  2NUP B;  2HV6 A;  4RBN A;  1KQ4 A;  1Z5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...