3S0XA

The crystal structure of gxgd membrane protease flak
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
231
structure length
225
Chain Sequence
SGSMIEYIIGALGLIIASVQDEIEDYIWIFLAVFGVLFAIYSSITLLDYSILINSISGFVICFILGYMMFLSGIGGGDGKMLIGLGALVPKFQMPIYTSLGTLLNLNYVPTFPIMVFINGIFFMVFLPFVILFRNILNGARPKTGKEFILMFFGEKMKVNVAKEQKRLIMGQNDKINFFPADEDFSKYSNNEEIWVTPQIPLIIPITLSYLVTPIIGDRILDFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of GXGD membrane protease FlaK.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Hydrolase
molecule keywords Peptidase A24B, FlaK domain protein
total genus 56
structure length 225
sequence length 231
chains with identical sequence B
ec nomenclature ec 3.4.23.52: Preflagellin peptidase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01478 Peptidase_A24 Type IV leader peptidase family
A PF06847 Arc_PepC_II Archaeal Peptidase A24 C-terminus Type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1220 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3s0xA01
3.30.1360.160 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3s0xA02
3S0XA
chains in the Genus database with same CATH superfamily
3GTKK 4BJ5A 2DB4A 2A6EF 3T00A 2B0JA 4H4KC 3JRTA 4JW1A 3HLZA 4MVZA 1G4WR 1WSVA 1C0AA 5KYWB 3W8IA 3EGXB 2NVYA 1TWCA 2W4BA 2AVKA 3TFJA 3W8HA 3GEEA 1Z7Qc 2QLAA 3SNHA 3G4AA 3HOVK 4C2MC 3TULA 4WJ0A 4QDLA 1INNA 3U8VA 1OW6A 4KASA 2QUPA 1PD0A 2PX3A 3S1QC 3RVZA 1WORA 3FOFA 2NVQK 1D0ZA 2V6TA 1RU0A 3JRMO 2WZLA 3DJUB 5E3CA 2Y3BA 5IYDC 1F7VA 1FMVA 2JA7C 4P9TA 1BDJB 3M15A 3G4CA 1FFTC 1B4BA 5A6BD 4E0HA 2R7ZA 4C3BA 3FHZA 4OIQF 4CIHA 1LS4A 1BR2A 2VC9A 4WGZA 3K7AK 3Q7LA 3A11A 2V26A 3GTMA 3HOVC 3EFOA 4MS2A 1JPJA 3K66A 3PCVA 1OXBA 5DVWA 4LERA 4Z9IA 4GTLA 2BE5A 3EQLA 3AJMA 1OQCA 1PJ7A 4BY7K 3TJ5A 3C8ZA 4BJTA 1T6IA 3FAJA 4I1OB 4XSZA 4KNVA 3GTKA 1WCMK 1NLXA 2P7VA 1YZCA 5JVOA 4FESA 1TWGA 5B3IA 1VJEA 4OD4A 3MYFA 1QPUA 2NG1A 1H7IA 4OIOA 1GM5A 4AH6A 4Q5SF 4I3MA 4U5FE 4ANJA 3EG9A 1D0YA 2FAPB 5A6AA 2RH6A 1ZW2A 2EINC 1XZQB 1HW1A 2DYSC 4OIPF 3GTOC 4CIPA 1XPPA 4XPWA 2W4MA 5C3EK 4OINF 2JA8C 5AGFA 1YX2A 2KNHA 1U0BB 2ZXOA 3EZIA 3EZHA 2XLMA 3A8KA 1U6HA 4J3NA 4BBRK 2E2HC 3FKIK 1J6XA 1O28A 1MMDA 1K40A 5DLJA 3NRHA 2RGRA 4XTKA 3S14C 3QMKA 3A9CA 4C3JC 4BJ6A 5M5WK 3E9VA 3JYHA 1M2VB 2ASRA 3TJ6A 5C4JK 2KC3A 3WG7C 2FQOA 1Y1VC 1J6WA 3AQOA 1ZXOA 2GA0A 1YARO 2YQYA 2HMQA 2XL8A 1W2WA 1WIHA 3GTJA 3EFOB 4HFKB 5HL8A 1UG7A 3M4BA 3TD7A 1WGWA 3UGPA 4G7ZF 4A3LC 2IBFA 1TWAA 3U0CA 3LAPA 3W2WA 3MFNA 5D92A 3CZ6A 2PMZD 1T9KA 3ABKC 4G7HF 3DM9B 5L0CA 3H0GA 2IXPA 3FDQA 3T4RA 4CS8A 1MMAA 3IPJA 1I3QA 4GFQA 2A0BA 5M5XK 3RZOK 2B63A 2I15A 1VH2A 2QE9A 1C17M 2PP4A 3ZDLA 2V6SA 4BJ6C 2JA5A 3PDMP 4JE9A 2Y69C 2G62A 2ZUEA 3CQZA 3ZVRA 2ZD9A 4BPMA 3K7AC 2R03A 1LS1A 4C3IK 1LE4A 4JRZA 3K1IC 3RZDC 2WB7A 5F5HA 5IY5C 3MLGA 2MWQA 3WHNA 2R25A 3GTOK 2JA6A 4XEKA 4DOZA 4IARA 4MVOA 3OA1A 3IQCA 4YK5A 1TWFA 3GTQK 1PCXA 3S1MC 3N2ZB 1FR0A 3PO3K 4QIWL 5FCLA 1O25A 1GE9A 1EI7A 2MHRA 3S2HK 2R7SA 1WQFA 2OG2A 2E2IK 3AQBA 3S27A 3LLIA 4A93C 4ILDA 2W7VA 5COFA 3SXKA 3EH2A 1FMWA 4FWVA 3DM5A 3LNRA 3L1MA 4NTFA 3AG4C 1YA9A 4GTDA 1R5ID 2KJGA 2AP3A 5T3WA 1A7VA 1C03A 1A41A 4QI0A 3VA7A 2W9YA 3RFYA 4G0UA 4MW8A 1XXAA 2LQGA 2LK4A 5E2QA 1Y4CA 3AD8C 2ZFZA 4JTCB 2LD6A 1ZQ1C 4CSAA 3ADAC 3NYJA 3R2PA 2WAQD 3OREA 2OEVA 2DGJA 2ZUFA 4YFKA 1BR1A 5L3QA 1QVXA 1ZZPA 2CW0F 4LK1A 2IM8A 3FVYA 2HSQA 4C45A 1IE0A 1J98A 4IB4A 3AGTA 3GTLK 1SFOC 1T01A 3HOXK 3S1RK 4MTGA 4E0IA 5C4JC 3GTOA 4IGGA 2EBBA 1TWFK 4DRHB 3QVZA 3V4GA 4MNDA 2R93A 4PJMA 3M4CA 3GSIA 4A93K 1K04A 3HOXC 3US6A 3S1RC 2R05A 4A3FC 1GGQA 3RZOC 4A2NB 5JVEA 1XWJA 2F22A 3H3VL 3W4YA 2E2IA 1BDFA 2NUTA 3I4NK 2OU6A 3F46A 2JA8K 2NVYC 2YL3A 4CJGA 1M2VA 4JTAB 5IP9K 3S15K 1CGNA 1K83K 1JPNA 1I50A 2WAQL 3Q3QA 1I6HC 1OR3A 2A69A 3FXHA 5A6BA 1TWAC 5IP9C 1RJ9B 4PFPA 2V6UA 3CAGA 1OCCC 2NVYK 3TOMA 3AG2C 3C63A 1VOMA 2H7BA 3LAYA 3O6XA 4BG0A 3GWLA 1BS2A 4DXWA 4CS7A 1UV7A 3SYNA 3ERED 4NTAA 3ATPA 3SZRA 3TFHA 4E7SA 2FFHA 1M57C 3QW1A 3SXYA 1Y1VK 4KMUA 3F47A 1U89A 4PAAA 3RVYA 5IOSA 3L4JA 3S9OA 4ONSA 1ZHTA 2E2HA 2H7OA 4OIQA 1LKXA 2XLWA 2GAGC 3B71A 2A68A 2E2JC 4CS9A 3RW0A 3CQZK 2WL8A 4OIRA 2PPBA 5E68A 1MQVA 1NSGB 3S1NC 1WOOA 4XLPA 3RF3A 4ZLCA 1SMYA 4LQYA 3HOZK 4EIYA 4MQ9A 2JPUA 2Z15A 4C7OB 4Q4ZF 5KYUA 4PJLA 4NCQA 3KYIA 2J9WA 2VCAA 5AC4A 3JSEO 4G7OF 3GTPK 4C3DA 2WVOA 5C44C 3GTQA 4YL3A 3G50A 3AG3C 3IQ5A 3K1HA 1KNYA 4G0HA 4NY3A 1QSPA 3DJNB 1DCHA 1O26A 2NSFA 1YYJA 1BBHA 2O5JA 4YT2A 5T1DB 2R7OA 5JSLA 1Y1WC 4GTCA 2Y39A 4XLNA 3U8PA 2WB1D 3ASOC 3AOUA 1H9GA 1LI5A 3DZAA 4DDQA 5IOQA 1TFKB 4U5CE 3M3YC 3TK0A 3U3BA 3ZG1A 5EGHA 3DMDA 2XM0A 3VYWA 2VCCA 5HV9A 3H65A 3EH1A 3X2QC 4J7YA 1G5ZA 3S29A 4BY1C 4I1MA 4LDQA 5DS4A 5JT4A 1WSRA 4KAWX 1O27A 4A3BC 2C04A 4LJZA 3S1QK 1XZPB 4ER9A 2EIMC 4PK4A 5KYYB 4E7ZA 4NTBA 1Q0GA 1R4TA 1NBBA 1F1MA 1EA8A 3SEOA 4G0WA 2PA8L 1ZVZA 3AH5A 4PABA 2JA5C 2LP4A 1TR2A 1Y1WK 1AUEA 3GTLA 1VGXA 4P5BA 2IXOA 4MVUA 2A68F 1EKYA 4MW3A 1SR2A 2ETSA 1V55C 1B68A 1EQ1A 2KWAA 1OKKA 3NYMA 5A69A 3BRJA 1WN0A 5KYYA 5CIVA 5JS5A 4AK9A 3TQOA 3IHUA 4WABA 1OCOC 1XXCA 1VYKA 3MX3A 2CCYA 2XS1A 2YL1A 3KL4A 1AVOB 5COGA 2A6HF 5D91A 4Y52K 1O2BA 5AC5A 4AE4A 4A3CK 1OCRC 1I50C 3ZSUA 3HNJA 5IYCK 1OCZC 2E87A 3QTHA 2P8TA 1G4US 1OW7A 1IS1A 2V3CC 1JVIA 3L8JA 4U5GA 2IOQA 2XM4A 3KH2A 2PA8D 1IZMA 1LPEA 4RBNA 3ITFA 4G7ZA 5TJ5E 2R93C 1TWFC 3JT1A 1FFHA 2HMZA 2Q4FA 4EBBA 1F93A 1SZIA 2HFIA 3M1CB 4E18A 1Z63A 1WATA 4MVMA 4KC9A 3ZIBA 4C3JK 4A3IK 2EPKX 4JK1A 5B3SC 1KU2A 2DI3A 4CSAC 4EHPA 4CS9C 3LS0A 5DQTA 1YZAA 5CI8A 1SFOK 3U9MA 4XPXA 1VLTA 2VUMC 3JTLO 4DRJB 3WAQA 1O2AA 1OR2A 4N6CA 2WVNA 3C7JA 2XRHA 5M5YK 3B9QA 4O79A 4IWBA 4EUKB 1YJGA 1RCPA 3JSZA 4C3IC 2CNWA 2XLEA 1ZU5A 1O2FB 4WJ3M 2E2JK 1JQWA 2R7ZK 5L0IA 2EIJC 2P61A 1NFOA 3U9JA 1WQHA 3UMHA 4XSXA 1SMYF 2OQMA 3IQTA 4JURI 3PHF2 4JKVA 4KI2A 1O87A 3U5SA 3I5QA 4LDRA 5CI9A 4QJVB 4CDYA 5K0IA 4A3MK 1L7CA 3GTPC 2HV6A 4H54A 3HTKC 4JCZA 1M56C 2PBEA 1F9NA 4XEVA 2LIGA 4BBRC 1ZW3A 1GS9A 4J32B 3A8JA 2CFAA 3LNMB 5L3VA 1IW7F 3IQ6A 1K05A 4IRUA 5A6JA 2J7PD 3HOYK 1IQ0A 2LFFA 3S1MK 1D1BA 1BJTA 5CJ9A 3HOZC 3VAYA 5EGEA 3NKEA 3A8IA 3I4MC 4GEHA 2JA7K 3AQPA 1KTMA 1M2OA 1SFOA 3DAGA 2MYSA 3UMIA 3VRCA 1O24A 3GM1A 1J8MF 1Z6AA 2EPMX 4NOIA 4AYBL 1VMAA 4RD9A 4AL0A 4ZH4A 5JUAA 2L81A 4QI2A 3GTMK 4O6MA 3T9OA 2B63K 4LR2A 3K1IA 5L0JA 4KB4A 4N6HA 5EGYA 4KMAA 3NMIA 2UUIA 1DD5A 3MBGA 3Q6NA 1HE1A 4M1XA 3GWNA 4KDDA 4MTFA 2H8AA 1FAPB 2BE5F 5C44K 4LOWA 4YFXA 4G7HA 2J9VA 4DVYP 4RDAA 1B4AA 4LLEA 1TWHK 5TJ3A 2HJMA 2EILC 3X1OA 3PO2K 2G3KA 1G8XA 1ZHWA 3EGDA 1CPQA 1Y1VA 2XLDA 2GDCA 3M3YK 2PNOA 3RIPA 3LS1A 3NG1A 4EBJA 4IAQA 5L0HA 4LLCA 1LI7A 5GPGB 2P5MA 4C2MK 4KBLA 3DWWA 3SP1A 3LESA 5IP7K 3G4ZA 3BP8C 1TKNA 3H0GK 4C7OA 2JX0A 3WODF 2R92C 3HOUC 1IW7A 2HUJA 1PD1A 4KARA 5KYNA 3ABMC 1EFWA 2QTVA 1TFOB 3NDBB 2P6VA 1YAUO 2YU9K 2Y3PA 3K33A 1ISEA 5E33A 2IXNA 2R7ZC 1YNNA 2I8BA 4ULVA 1QLEC 1MNEA 1H9TA 5T3TA 1TWCK 3GODA 4KM9A 2CDQA 4BKWA 1I6HK 5B1AC 3V5XA 2A1DD 4O6NA 3S90A 1D0XA 1G51A 3KKBA 4U5HA 5DS6A 1JOGA 4CDVA 4A3JC 4CS8C 3ZWIA 2EPNA 4BEMJ 2WZGA 3J06A 3ZTMA 3K6BA 1VK5A 2OCCC 1H6GA 4I44A 2PMZL 1VLSA 2Y0SD 1IBAA 2O9XA 2AU5A 2J9BA 1AB4A 4GYTA 3AGUA 3KPHA 4MTOA 5KYXB 2Y3HA 3T6GB 4LK0A 4XWJA 4U9EA 3BEHA 2NVXC 3QX3A 1PJ6A 4YJWA 1R9TA 1USOA 4XQ1A 1E86A 3GTLC 4ZLDA 2NSGA 4YWQA 3WODA 2QY9A 1Q0MA 4RMFA 5D4DA 1JMWA 1JAFA 2XXAA 4A3DC 1DCPA 3O55A 4GZYA 4L6RA 4MEYA 2A6EA 1WCMA 2YU9A 4ULWA 1I4ZA 3SXZA 4A3EC 3S2DC 1M6TA 3RQFA 1WASA 3UNGC 4PFOA 3ZQYA 1WWPA 4LDKA 1I5NA 2R7VA 5L0GA 4PACA 2YU9C 2Q3TA 4N06A 2AWCA 2UUHA 4JEAA 3LPXA 1JRAA 1RKCA 4OD5A 1USMA 2ZPAA 3GTGC 3W2VA 3ASNC 3LAJA 2E2HK 1I3QC 2O5IA 1V74B 1YVIA 4XCHA 1XXBA 2YL0A 4KMDA 3H2VA 1ZYRA 3N0TA 3EJNA 2NVXA 1R9TC 3AG1C 3GTKC 1HY5A 3ZTZA 4BEJA 4X0RA 4DBQA 1WTYA 5JLIA 5COMA 2NUPB 1EK8A 4KN4A 1TWHA 4BLBA 3NKDA 5EHHA 3NUHA 4O2DA 4A3KK 1R9TK 1A7DA 4W8PA 4A3DK 4JCHA 2R9RB 4K1OA 1WOLA 3I4NC 3RQEA 3KMIA 3S16K 2XSEA 3B0PA 5M3MK 2GAHC 3UR3C 1PJ5A 1S7ZA 4K7BA 4O7GA 1EI6A 4BBSC 4OIPA 4QJVA 4YT8A 3NMKA 2XL6A 4GTFA 3HOWK 2KGOA 4NQFA 1FNTc 2JA6C 4A3MC 3H3VD 4DJ9A 1YCLA 4O6YA 3OPFA 1OKKD 1Q0KA 3CEXA 2YLIA 4JEBA 2QNLA 2IXMA 4DVZA 2R93K 2R7TA 2NVTK 3RH3A 2Y0SL 2JA6K 3TOLA 1HI9A 5L46A 4Q4ZA 3NYLA 1V54C 1ZVUA 1JOEA 3GTGA 4A3JK 3T01A 3Q6MA 4GQHA 2YLDA 5FLMK 2YZSA 4X6AK 3DE9A 256BA 2ZXPA 1TWCC 1T5OA 5TMCA 4A3BK 3UGOA 2Y3DA 2GSNA 2VUMK 2L6HA 3S17K 2YWAA 1TWHC 2NUPA 4BJ5C 5JRAA 3GEHA 1APCA 3T6BA 2YHSA 2M64A 1ORSC 4A3IC 4HFFB 4A3FK 1J8YF 3ABLC 2PF4E 1ZYRF 2VASA 3GEIA 3HXAA 3RYLA 1LIHA 3IEEA 3BP3A 3S84A 2HS5A 4AE4B 4JC7A 3LUTB 1TWGK 1X31C 1HQMA 4IJJA 4AX2A 1QKRA 1ORJA 3FOOA 4LLGA 1MMGA 4EWCA 4NC3A 1A0BA 4DRIB 4B6IA 3S16C 1XZQA 4N4WA 2LSEA 2YEVA 3I4MK 3RZDK 4C3HC 2ICWG 5FLMC 3T6JA 2D5RB 1NU9C 1HW2A 2J9UA 3NMJA 3DXJF 3B29A 4XEFA 4JJGA 5DQZA 2CNWD 2YL7A 4OIOF 2J8WA 2P0NA 3FKIA 1UFBA 3L0IA 4XLPF 3MYIA 4U5BE 3DAFA 2NVTC 1RKEB 4MQ9F 2NUTB 1E84A 3GDZA 4LACB 2R92K 5KYXA 3HOUK 1NFNA 4CJOA 4E17A 1WCMC 1WOPA 2VUMA 2A0UA 1K83A 1Q0FA 2Y3GA 2KK1A 3HOWC 3V5ZA 3DD7A 3DKAA 2B63C 1WQGA 4U5DE 3HJCA 2CFAB 1DOVA 4AYBD 2EIKC 2XL4A 2R02A 3FOPA 2X51A 1RKEA 4BBSK 3LJBA 1C02A 3I4UA 3O10A 3QW0A 3KYJA 5C4XC 2XCQA 2YLGA 5IORA 4WILA 1ZHYA 3AD9C 3CAXA 3LLKA 3FAPB 1YDIA 3H2UA 2J0XA 4X6AC 2TMVP 3SZZA 3TTGA 3U2LA 4P9SA 1DOWA 4Y52C 4G78A 4YT5A 1MMNA 1ZBSA 2AWYA 2FQTA 1A7EA 2WB1L 2J0WA 5FZTA 3QVYA 3M79A 5KYUB 1I6VA 3LEVA 4YFNA 3ZC4A 4U5EE 2CGEA 5JP7A 3V5YA 4DBRA 4PJNA 2BL2A 3FHDA 2RD9A 2YVKA 1VB5A 2R7WA 3FKIC 1GQAA 3EHMA 4R32A 3N0CA 3ECSA 2J46A 2X0CA 3EGDB 2J45A 5EK0A 1YYXA 3HNKA 1E83A 3HKKA 2CW0A 1RMVA 3GTJK 2HJ3A 4C3HK 5C3EC 3ZQVA 5M3FK 4KB2A 1ORYA 1V5VA 1O5HA 2OKUA 4KATA 2PHCB 4FZBA 2KQ9A 4EBKA 3C8GB 2A6HA 4MVRA 3CSKA 3BUEA 1O3UA 2P1AA 3HNIA 1I4YA 1OXKA 4Y7NC 2FGYA 3M4OC 3V7OA 1TWGC 3JZ0A 2Q9AA 4JIOA 1YNJA 4Z9HA 4Q5SA 3POVA 1E85A 1Y6DA 4Y7NK 1E2XA 4BY7C 2HZ8A 4P5AA 3N24A 4Z9JA 2JA5K 2HKVA 3GTPA 1NZEA 4J7TA 1NU7D 1F7UA 4OINA 2GAQA 2NPUA 3E70C 4JTDB 5JFEA 1VYIA 4GTBA 4A3CC 4PR9A 2LFDA 2XXAB 5L0DA 1KQ4A 5F5FA 2LCHA 1K83C 1BGWA 4IAOA 3G4XA 5C4XK 1D1CA 3RKOF 4MVSA 3U2MA 5IYBK 3JYYA 5IYDK 4OIRF 2GWWA 4D4XA 2XLOA 4A4AA 4AL1A 3S1NK 1YLMA 1NG1A 3FMSA 5BQGA 1ZU4A 3T02A 1ST6A 1HMOA 1WOSA 4WJ4A 1FTSA 2BC5A 1EQRA 2NVXK 3B0UX 4JZAA 5TMFA 4BXXC 2YRFA 4FM9A 3SZYA 2R92A 2VCBA 2OJQA 3QZCA 5CHPA 2L6FA 3S28A 1LVKA 3HNLA 4CBEA 5E3AA 3S2HC 1JR8A 1Z5ZA 4KMHA 3B0VC 2KSFA 4A3EK 3S2DK 1Y1WA 4YT4A 3S17C 3N0BA 4G7OA 2WVQA 4A3GK 2RSEB 3L34A 3HKZL 1OW8A 3PO2C 1VLOA 3GTJC 1L0WA 2Q9CA 5FJ8K 4J30B 3OWTA 4A3GC 2JA7A 2B0HA 4KM8A 5HSWA 3EHNA 2IYLD 2D6FC 2GSOA 2YKZA 1HMDA 3DI5A 4BJ1A 3GTGK 2L9JA 4XLNF 3R7CA 1D1AA 3EGXA 1LM3B 3OEOA 1BR4A 2W45A 3I5PA 4M63A 1EH1A 3L8IA 1N1CA 5BQHA 3C62A 1YA7O 4FX5A 1HE9A 2KW3C 2JD3A 1AEPA 3S14K 2VB6A 3UMKA 2XLHA 4QIWD 1QZXA 3AD7C 5IYBC 1CGOA 4CDAA 2L6GA 5BUOA 3JCUQ 2L7AA 2CYDA 2H7VC 3EPVA 2XLVA 4CX9A 1CPRA 3HKZD 4MEXA 1I50K 4KC6A 1L3PA 4BY1K 3EQLF 4P6IC 1VRQC 4YG2A 2Q00A 4BLAA 1SYQA 3LEOA 1ZHZA 3RQGA 2D4UA 2XS8A 2EPLX 2WZFA 2OOCA 3U3FA 3TFIA 3VM6A 3SXMA 2J7PA 1SF8A 2R7QA 1RJ9A 3K7DA 1QQ3A 4MVQA 3GM2A 2G3VA 3H0GC 1J6VA 3O39A 4GTAA 3C8GD 4Q7CA 2PX0A 1DCOA 3GIRA 2XCOA 3GTMC 1TQGA 2E2IC 4WGYA 4JJFA 2HV7A 3M4OK 3GTQC 3L4KA 3C18A 2Q7RA 4UDVA 1O29A 3IPMO 2R7UA 4W8KA 1MNDA 5KYWA 2KYHA 5IYCC 4PJJA 1T6QA 3S0XA 2PFDA 4XPYA 1XZPA 1S05A 1RXQA 4G0VA 5DS5A 3S15C 4F4BA 5L0FA 4U9DA 3JSTA 5BQIA 2C03A 3N3YA 3GORA 2Q9BA 5F28E 4HEAJ 2ZXWC 3FOEA 2NVQC 1Q0DA 4JVSA 4YN0B 3CQZC 3MMLB 1PV3A 1T6UA 2HSBA 2M4EA 4YL1A 4C3EA 4YL0A 3DXJA 1Z23A 3PMRA 3VF0A 4GT9A 1Z3IX 4D4NA 4BXXK 4P9FA 2XCRB 3EG9B 1IL2A 3Q7GA 2A69F 5IP7C 4GTEA 2JH3A 4FAPB 2OJED 3PO3C 1VTMP 1TWAK 1V4AA 5IOTA 3AQCA 5B1BC 4K0DA 3GM3A 1LE2A 4HE8D 1BZ4A 2GSUA 4EKWA 2GFHA 3C8GA 4KN7A 3GANA 3OEPA 4A3KC 2ZXRA 4KNWA 1CGME 5A6KA 2R7XA 3HOYC 2DYRC 2VH3A 2EPOA 4A3LK 3DE8A 2OEXA 2R7RA 1I3QK 1ZHXA
chains in the Genus database with same CATH topology
3O6XA 4BJ5A 4LLCA 1MMNA 4BG0A 2A6EF 1ZBSA 2B0JA 4H4KC 2J0WA 4CS7A 3JRTA 4JW1A 3HLZA 3SYNA 2P5MA 3ERED 4KBLA 5KYUB 3SP1A 3LEVA 3LESA 3SZRA 4E7SA 1TKNA 2FFHA 4C7OA 1M57C 3ZC4A 4U5EE 5KYWB 2CGEA 3W8IA 3WODF 3EGXB 3F47A 2NVYA 1TWCA 2W4BA 5IOSA 3L4JA 4DBRA 4KARA 1PD1A 3W8HA 5KYNA 3ABMC 4PJNA 2QTVA 3SNHA 3FHDA 3NDBB 3G4AA 4C2MC 2P6VA 4WJ0A 1ZHTA 4QDLA 2E2HA 2Y3PA 2H7OA 2R7WA 3K33A 1LKXA 1ISEA 5E33A 4KASA 1PD0A 2IXNA 2PX3A 3EHMA 3N0CA 3ECSA 4CS9A 2J46A 2I8BA 2WL8A 3EGDB 2J45A 3FOFA 1QLEC 1D0ZA 2WZLA 3DJUB 5E3CA 2Y3BA 1MNEA 5T3TA 4ZLCA 4LQYA 3GODA 1FMVA 4KM9A 2CDQA 4BKWA 3G4CA 4KB2A 1FFTC 1B4BA 2R7ZA 5B1AC 1O5HA 4KATA 2Z15A 4C7OB 4C3BA 4Q4ZF 2KQ9A 2PHCB 5KYUA 4FZBA 2A1DD 3FHZA 4O6NA 4OIQF 4PJLA 1D0XA 2J9WA 3KKBA 4U5HA 4CIHA 1BR2A 5DS6A 4G7OF 4CS8C 3CSKA 3BUEA 3Q7LA 2WZGA 4C3DA 2WVOA 3K6BA 2V26A 1VK5A 2OCCC 4I44A 3GTQA 3GTMA 3EFOA 1JPJA 3K66A 3AG3C 2FGYA 5DVWA 3V7OA 2O9XA 4LERA 4GTLA 3K1HA 2Q9AA 4NY3A 4G0HA 1AB4A 4GYTA 3DJNB 1O26A 3POVA 4BJTA 2Y3HA 5KYXB 4XWJA 3FAJA 4I1OB 4YT2A 5T1DB 2R7OA 4KNVA 3GTKA 4GTCA 2Y39A 2P7VA 4P5AA 3N24A 5JVOA 3QX3A 4FESA 1TWGA 4YJWA 3GTPA 1NZEA 3ASOC 1R9TA 4OD4A 2NG1A 1NU7D 4ZLDA 3DZAA 4DDQA 4YWQA 5IOQA 2QY9A 4U5CE 4Q5SF 4I3MA 3E70C 4U5FE 3EG9A 3ZG1A 4ANJA 1D0YA 2XXAA 5EGHA 3DMDA 3VYWA 5JFEA 1VYIA 4GTBA 2RH6A 3H65A 3EH1A 3X2QC 2XXAB 1KQ4A 2EINC 4OIPF 2DYSC 3S29A 5F5FA 4I1MA 1WCMA 5DS4A 1BGWA 4KAWX 4IAOA 1O27A 2YU9A 2W4MA 2C04A 1D1CA 4ULWA 3RKOF 2EIMC 4PK4A 4OIRF 4OINF 5KYYB 3UNGC 4PFOA 1NG1A 4E7ZA 2KNHA 2ZXOA 3EZIA 3EZHA 1ZU4A 4J3NA 2R7VA 3SEOA 4G0WA 1ST6A 1FTSA 3AH5A 1O28A 1MMDA 3B0UX 2Q3TA 4N06A 1TR2A 3NRHA 5DLJA 4JZAA 2RGRA 4XTKA 3GTLA 3QMKA 4P5BA 3LPXA 4C3JC 4FM9A 2IXOA 4BJ6A 2A68F 2R92A 4OD5A 3E9VA 3JYHA 1M2VB 2ZPAA 1V55C 2KWAA 3WG7C 1OKKA 3NYMA 3W2VA 3ASNC 3QZCA 5CHPA 3AQOA 1ZXOA 5KYYA 3LAJA 3S28A 4AK9A 1XXBA 1LVKA 4KMDA 4CBEA 5E3AA 1Z5ZA 4KMHA 3N0TA 3EJNA 1OCOC 1XXCA 1VYKA 3MX3A 3B0VC 2NVXA 3KL4A 1W2WA 1WIHA 3GTJA 3AG1C 1Y1WA 2A6HF 4YT4A 3EFOB 5D91A 4HFKB 3TD7A 4BEJA 4X0RA 3N0BA 2WVQA 4DBQA 1WGWA 1O2BA 3UGPA 3L34A 4G7ZF 4AE4A 2NUPB 1EK8A 1TWAA 1OCRC 3ZSUA 1TWHA 4BLBA 3NKDA 3LAPA 5EHHA 3NUHA 3W2WA 1OCZC 4JCHA 5D92A 3CZ6A 2E87A 3ABKC 3KMIA 2Q9CA 4G7HF 2XSEA 1IS1A 2V3CC 3B0PA 4J30B 3OWTA 2JA7A 4U5GA 2IOQA 4KM8A 3UR3C 3KH2A 1S7ZA 1IZMA 5HSWA 3EHNA 4K7BA 2IYLD 4O7GA 3DM9B 4RBNA 3H0GA 2GSOA 3ITFA 2IXPA 4YT8A 3FDQA 4BJ1A 2L9JA 4XLNF 3T4RA 4CS8A 4GTFA 2KGOA 1MMAA 1I3QA 1D1AA 3EGXA 3OEOA 4GFQA 4O6YA 1BR4A 3OPFA 3JT1A 1OKKD 2W45A 2B63A 1FFHA 3I5PA 4M63A 4EBBA 1EH1A 2PP4A 1N1CA 4BJ6C 1SZIA 3M1CB 2JA5A 2IXMA 4FX5A 1Z63A 4DVZA 4KC9A 3ZIBA 2R7TA 3RH3A 2Y69C 2KW3C 2JD3A 2G62A 5B3SC 2VB6A 1KU2A 3UMKA 3CQZA 3ZVRA 4CSAC 3NYLA 1QZXA 4CS9C 3LS0A 1V54C 1ZVUA 5DQTA 3GTGA 5CI8A 1LS1A 3Q6MA 5BUOA 3JCUQ 3K1IC 1O2AA 2YZSA 2H7VC 3EPVA 2WB7A 5F5HA 2WVNA 5IY5C 2XRHA 3MLGA 2MWQA 2ZXPA 3B9QA 4KC6A 4O79A 4IWBA 3UGOA 2JA6A 3EQLF 4DOZA 2Y3DA 3JSZA 2GSNA 3OA1A 1TWFA 4C3IC 2CNWA 4P6IC 1ZU5A 1PCXA 4BLAA 2NUPA 4BJ5C 3N2ZB 1ZHZA 5FCLA 2WZFA 2EIJC 3T6BA 1O25A 2YHSA 1GE9A 2R7SA 1WQHA 3UMHA 1SMYF 4JURI 4HFFB 3PHF2 1WQFA 1J8YF 4KI2A 2OG2A 2J7PA 3ABLC 1O87A 2PF4E 3AQBA 3LLIA 1ZYRF 2VASA 3S27A 3I5QA 1SF8A 2R7QA 3RYLA 3IEEA 1RJ9A 4ILDA 3K7DA 4AE4B 5CI9A 3EH2A 2G3VA 4IJJA 1FMWA 4FWVA 3DM5A 4AX2A 3LNRA 3O39A 4GTAA 3AG4C 2HV6A 2PX0A 4Q7CA 1MMGA 2XCOA 4GTDA 2KJGA 4EWCA 3HTKC 1M56C 5T3WA 1F9NA 4JJFA 2HV7A 3L4KA 4J32B 4QI0A 4B6IA 3VA7A 2CFAA 2W9YA 5L3VA 3RFYA 1O29A 1IW7F 4G0UA 2R7UA 4IRUA 1XXAA 2J7PD 4W8KA 1MNDA 5E2QA 5KYWA 1D1BA 1BJTA 2LSEA 2ZFZA 5CJ9A 2YEVA 3VAYA 4C3HC 4CSAA 5EGEA 3NKEA 3NYJA 3T6JA 2D5RB 4PJJA 1NU9C 3S0XA 3OREA 2J9UA 2PFDA 2DGJA 3DXJF 4GEHA 3AQPA 4JJGA 4G0VA 5DS5A 1M2OA 1BR1A 5DQZA 5L3QA 2CNWD 1SFOA 3DAGA 4F4BA 4OIOF 2MYSA 2C03A 2CW0F 3UMIA 3FKIA 2Q9BA 3N3YA 1O24A 4HEAJ 2ZXWC 3FOEA 3L0IA 4JVSA 4XLPF 1J8MF 1Z6AA 4U5BE 3DAFA 4YN0B 3FVYA 3MMLB 1VMAA 4RD9A 4MQ9F 2NUTB 2L81A 4QI2A 2M4EA 4LACB 4O6MA 5KYXA 4C3EA 4LR2A 3GTOA 1Z23A 4KB4A 3PMRA 5EGYA 2VUMA 4KMAA 1K83A 4GT9A 3V4GA 2Y3GA 4MNDA 1DD5A 1Z3IX 3Q6NA 2R93A 4PJMA 4M1XA 3EG9B 2XCRB 3DD7A 3Q7GA 1WQGA 4U5DE 3HJCA 4KDDA 2A69F 2CFAB 4GTEA 2JH3A 2EIKC 4A2NB 2BE5F 2XL4A 2E2IA 2NUTA 2J9VA 2X51A 4DVYP 3F46A 3LJBA 1M2VA 4RDAA 1B4AA 3I4UA 5IOTA 4LLEA 3AQCA 5B1BC 5TJ3A 4K0DA 2XCQA 2EILC 4HE8D 1JPNA 1I50A 5IORA 3Q3QA 3X1OA 1ZHYA 2GSUA 2G3KA 2GFHA 1G8XA 1ZHWA 3EGDA 3GANA 3LLKA 1RJ9B 2ZXRA 4KNWA 4PFPA 1Y1VA 3OEPA 3CAGA 1OCCC 2R7XA 2J0XA 2DYRC 2VH3A 3AG2C 1VOMA 3RIPA 3LS1A 2H7BA 3LAYA 3NG1A 2R7RA 1ZHXA 4YT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0X A; 
#chains in the Genus database with same CATH topology
 3GTK K;  4BJ5 A;  2DB4 A;  2A6E F;  3T00 A;  2B0J A;  4H4K C;  3JRT A;  4JW1 A;  3HLZ A;  4MVZ A;  1G4W R;  1WSV A;  1C0A A;  5KYW B;  3W8I A;  3EGX B;  2NVY A;  1TWC A;  2W4B A;  2AVK A;  3TFJ A;  3W8H A;  3GEE A;  1Z7Q c;  2QLA A;  3SNH A;  3G4A A;  3HOV K;  4C2M C;  3TUL A;  4WJ0 A;  4QDL A;  1INN A;  3U8V A;  1OW6 A;  4KAS A;  2QUP A;  1PD0 A;  2PX3 A;  3S1Q C;  3RVZ A;  1WOR A;  3FOF A;  2NVQ K;  1D0Z A;  2V6T A;  1RU0 A;  3JRM O;  2WZL A;  3DJU B;  5E3C A;  2Y3B A;  5IYD C;  1F7V A;  1FMV A;  2JA7 C;  4P9T A;  1BDJ B;  3M15 A;  3G4C A;  1FFT C;  1B4B A;  5A6B D;  4E0H A;  2R7Z A;  4C3B A;  3FHZ A;  4OIQ F;  4CIH A;  1LS4 A;  1BR2 A;  2VC9 A;  4WGZ A;  3K7A K;  3Q7L A;  3A11 A;  2V26 A;  3GTM A;  3HOV C;  3EFO A;  4MS2 A;  1JPJ A;  3K66 A;  3PCV A;  1OXB A;  5DVW A;  4LER A;  4Z9I A;  4GTL A;  2BE5 A;  3EQL A;  3AJM A;  1OQC A;  1PJ7 A;  4BY7 K;  3TJ5 A;  3C8Z A;  4BJT A;  1T6I A;  3FAJ A;  4I1O B;  4XSZ A;  4KNV A;  3GTK A;  1WCM K;  1NLX A;  2P7V A;  1YZC A;  5JVO A;  4FES A;  1TWG A;  5B3I A;  1VJE A;  4OD4 A;  3MYF A;  1QPU A;  2NG1 A;  1H7I A;  4OIO A;  1GM5 A;  4AH6 A;  4Q5S F;  4I3M A;  4U5F E;  4ANJ A;  3EG9 A;  1D0Y A;  2FAP B;  5A6A A;  2RH6 A;  1ZW2 A;  2EIN C;  1XZQ B;  1HW1 A;  2DYS C;  4OIP F;  3GTO C;  4CIP A;  1XPP A;  4XPW A;  2W4M A;  5C3E K;  4OIN F;  2JA8 C;  5AGF A;  1YX2 A;  2KNH A;  1U0B B;  2ZXO A;  3EZI A;  3EZH A;  2XLM A;  3A8K A;  1U6H A;  4J3N A;  4BBR K;  2E2H C;  3FKI K;  1J6X A;  1O28 A;  1MMD A;  1K40 A;  5DLJ A;  3NRH A;  2RGR A;  4XTK A;  3S14 C;  3QMK A;  3A9C A;  4C3J C;  4BJ6 A;  5M5W K;  3E9V A;  3JYH A;  1M2V B;  2ASR A;  3TJ6 A;  5C4J K;  2KC3 A;  3WG7 C;  2FQO A;  1Y1V C;  1J6W A;  3AQO A;  1ZXO A;  2GA0 A;  1YAR O;  2YQY A;  2HMQ A;  2XL8 A;  1W2W A;  1WIH A;  3GTJ A;  3EFO B;  4HFK B;  5HL8 A;  1UG7 A;  3M4B A;  3TD7 A;  1WGW A;  3UGP A;  4G7Z F;  4A3L C;  2IBF A;  1TWA A;  3U0C A;  3LAP A;  3W2W A;  3MFN A;  5D92 A;  3CZ6 A;  2PMZ D;  1T9K A;  3ABK C;  4G7H F;  3DM9 B;  5L0C A;  3H0G A;  2IXP A;  3FDQ A;  3T4R A;  4CS8 A;  1MMA A;  3IPJ A;  1I3Q A;  4GFQ A;  2A0B A;  5M5X K;  3RZO K;  2B63 A;  2I15 A;  1VH2 A;  2QE9 A;  1C17 M;  2PP4 A;  3ZDL A;  2V6S A;  4BJ6 C;  2JA5 A;  3PDM P;  4JE9 A;  2Y69 C;  2G62 A;  2ZUE A;  3CQZ A;  3ZVR A;  2ZD9 A;  4BPM A;  3K7A C;  2R03 A;  1LS1 A;  4C3I K;  1LE4 A;  4JRZ A;  3K1I C;  3RZD C;  2WB7 A;  5F5H A;  5IY5 C;  3MLG A;  2MWQ A;  3WHN A;  2R25 A;  3GTO K;  2JA6 A;  4XEK A;  4DOZ A;  4IAR A;  4MVO A;  3OA1 A;  3IQC A;  4YK5 A;  1TWF A;  3GTQ K;  1PCX A;  3S1M C;  3N2Z B;  1FR0 A;  3PO3 K;  4QIW L;  5FCL A;  1O25 A;  1GE9 A;  1EI7 A;  2MHR A;  3S2H K;  2R7S A;  1WQF A;  2OG2 A;  2E2I K;  3AQB A;  3S27 A;  3LLI A;  4A93 C;  4ILD A;  2W7V A;  5COF A;  3SXK A;  3EH2 A;  1FMW A;  4FWV A;  3DM5 A;  3LNR A;  3L1M A;  4NTF A;  3AG4 C;  1YA9 A;  4GTD A;  1R5I D;  2KJG A;  2AP3 A;  5T3W A;  1A7V A;  1C03 A;  1A41 A;  4QI0 A;  3VA7 A;  2W9Y A;  3RFY A;  4G0U A;  4MW8 A;  1XXA A;  2LQG A;  2LK4 A;  5E2Q A;  1Y4C A;  3AD8 C;  2ZFZ A;  4JTC B;  2LD6 A;  1ZQ1 C;  4CSA A;  3ADA C;  3NYJ A;  3R2P A;  2WAQ D;  3ORE A;  2OEV A;  2DGJ A;  2ZUF A;  4YFK A;  1BR1 A;  5L3Q A;  1QVX A;  1ZZP A;  2CW0 F;  4LK1 A;  2IM8 A;  3FVY A;  2HSQ A;  4C45 A;  1IE0 A;  1J98 A;  4IB4 A;  3AGT A;  3GTL K;  1SFO C;  1T01 A;  3HOX K;  3S1R K;  4MTG A;  4E0I A;  5C4J C;  3GTO A;  4IGG A;  2EBB A;  1TWF K;  4DRH B;  3QVZ A;  3V4G A;  4MND A;  2R93 A;  4PJM A;  3M4C A;  3GSI A;  4A93 K;  1K04 A;  3HOX C;  3US6 A;  3S1R C;  2R05 A;  4A3F C;  1GGQ A;  3RZO C;  4A2N B;  5JVE A;  1XWJ A;  2F22 A;  3H3V L;  3W4Y A;  2E2I A;  1BDF A;  2NUT A;  3I4N K;  2OU6 A;  3F46 A;  2JA8 K;  2NVY C;  2YL3 A;  4CJG A;  1M2V A;  4JTA B;  5IP9 K;  3S15 K;  1CGN A;  1K83 K;  1JPN A;  1I50 A;  2WAQ L;  3Q3Q A;  1I6H C;  1OR3 A;  2A69 A;  3FXH A;  5A6B A;  1TWA C;  5IP9 C;  1RJ9 B;  4PFP A;  2V6U A;  3CAG A;  1OCC C;  2NVY K;  3TOM A;  3AG2 C;  3C63 A;  1VOM A;  2H7B A;  3LAY A;  3O6X A;  4BG0 A;  3GWL A;  1BS2 A;  4DXW A;  4CS7 A;  1UV7 A;  3SYN A;  3ERE D;  4NTA A;  3ATP A;  3SZR A;  3TFH A;  4E7S A;  2FFH A;  1M57 C;  3QW1 A;  3SXY A;  1Y1V K;  4KMU A;  3F47 A;  1U89 A;  4PAA A;  3RVY A;  5IOS A;  3L4J A;  3S9O A;  4ONS A;  1ZHT A;  2E2H A;  2H7O A;  4OIQ A;  1LKX A;  2XLW A;  2GAG C;  3B71 A;  2A68 A;  2E2J C;  4CS9 A;  3RW0 A;  3CQZ K;  2WL8 A;  4OIR A;  2PPB A;  5E68 A;  1MQV A;  1NSG B;  3S1N C;  1WOO A;  4XLP A;  3RF3 A;  4ZLC A;  1SMY A;  4LQY A;  3HOZ K;  4EIY A;  4MQ9 A;  2JPU A;  2Z15 A;  4C7O B;  4Q4Z F;  5KYU A;  4PJL A;  4NCQ A;  3KYI A;  2J9W A;  2VCA A;  5AC4 A;  3JSE O;  4G7O F;  3GTP K;  4C3D A;  2WVO A;  5C44 C;  3GTQ A;  4YL3 A;  3G50 A;  3AG3 C;  3IQ5 A;  3K1H A;  1KNY A;  4G0H A;  4NY3 A;  1QSP A;  3DJN B;  1DCH A;  1O26 A;  2NSF A;  1YYJ A;  1BBH A;  2O5J A;  4YT2 A;  5T1D B;  2R7O A;  5JSL A;  1Y1W C;  4GTC A;  2Y39 A;  4XLN A;  3U8P A;  2WB1 D;  3ASO C;  3AOU A;  1H9G A;  1LI5 A;  3DZA A;  4DDQ A;  5IOQ A;  1TFK B;  4U5C E;  3M3Y C;  3TK0 A;  3U3B A;  3ZG1 A;  5EGH A;  3DMD A;  2XM0 A;  3VYW A;  2VCC A;  5HV9 A;  3H65 A;  3EH1 A;  3X2Q C;  4J7Y A;  1G5Z A;  3S29 A;  4BY1 C;  4I1M A;  4LDQ A;  5DS4 A;  5JT4 A;  1WSR A;  4KAW X;  1O27 A;  4A3B C;  2C04 A;  4LJZ A;  3S1Q K;  1XZP B;  4ER9 A;  2EIM C;  4PK4 A;  5KYY B;  4E7Z A;  4NTB A;  1Q0G A;  1R4T A;  1NBB A;  1F1M A;  1EA8 A;  3SEO A;  4G0W A;  2PA8 L;  1ZVZ A;  3AH5 A;  4PAB A;  2JA5 C;  2LP4 A;  1TR2 A;  1Y1W K;  1AUE A;  3GTL A;  1VGX A;  4P5B A;  2IXO A;  4MVU A;  2A68 F;  1EKY A;  4MW3 A;  1SR2 A;  2ETS A;  1V55 C;  1B68 A;  1EQ1 A;  2KWA A;  1OKK A;  3NYM A;  5A69 A;  3BRJ A;  1WN0 A;  5KYY A;  5CIV A;  5JS5 A;  4AK9 A;  3TQO A;  3IHU A;  4WAB A;  1OCO C;  1XXC A;  1VYK A;  3MX3 A;  2CCY A;  2XS1 A;  2YL1 A;  3KL4 A;  1AVO B;  5COG A;  2A6H F;  5D91 A;  4Y52 K;  1O2B A;  5AC5 A;  4AE4 A;  4A3C K;  1OCR C;  1I50 C;  3ZSU A;  3HNJ A;  5IYC K;  1OCZ C;  2E87 A;  3QTH A;  2P8T A;  1G4U S;  1OW7 A;  1IS1 A;  2V3C C;  1JVI A;  3L8J A;  4U5G A;  2IOQ A;  2XM4 A;  3KH2 A;  2PA8 D;  1IZM A;  1LPE A;  4RBN A;  3ITF A;  4G7Z A;  5TJ5 E;  2R93 C;  1TWF C;  3JT1 A;  1FFH A;  2HMZ A;  2Q4F A;  4EBB A;  1F93 A;  1SZI A;  2HFI A;  3M1C B;  4E18 A;  1Z63 A;  1WAT A;  4MVM A;  4KC9 A;  3ZIB A;  4C3J K;  4A3I K;  2EPK X;  4JK1 A;  5B3S C;  1KU2 A;  2DI3 A;  4CSA C;  4EHP A;  4CS9 C;  3LS0 A;  5DQT A;  1YZA A;  5CI8 A;  1SFO K;  3U9M A;  4XPX A;  1VLT A;  2VUM C;  3JTL O;  4DRJ B;  3WAQ A;  1O2A A;  1OR2 A;  4N6C A;  2WVN A;  3C7J A;  2XRH A;  5M5Y K;  3B9Q A;  4O79 A;  4IWB A;  4EUK B;  1YJG A;  1RCP A;  3JSZ A;  4C3I C;  2CNW A;  2XLE A;  1ZU5 A;  1O2F B;  4WJ3 M;  2E2J K;  1JQW A;  2R7Z K;  5L0I A;  2EIJ C;  2P61 A;  1NFO A;  3U9J A;  1WQH A;  3UMH A;  4XSX A;  1SMY F;  2OQM A;  3IQT A;  4JUR I;  3PHF 2;  4JKV A;  4KI2 A;  1O87 A;  3U5S A;  3I5Q A;  4LDR A;  5CI9 A;  4QJV B;  4CDY A;  5K0I A;  4A3M K;  1L7C A;  3GTP C;  2HV6 A;  4H54 A;  3HTK C;  4JCZ A;  1M56 C;  2PBE A;  1F9N A;  4XEV A;  2LIG A;  4BBR C;  1ZW3 A;  1GS9 A;  4J32 B;  3A8J A;  2CFA A;  3LNM B;  5L3V A;  1IW7 F;  3IQ6 A;  1K05 A;  4IRU A;  5A6J A;  2J7P D;  3HOY K;  1IQ0 A;  2LFF A;  3S1M K;  1D1B A;  1BJT A;  5CJ9 A;  3HOZ C;  3VAY A;  5EGE A;  3NKE A;  3A8I A;  3I4M C;  4GEH A;  2JA7 K;  3AQP A;  1KTM A;  1M2O A;  1SFO A;  3DAG A;  2MYS A;  3UMI A;  3VRC A;  1O24 A;  3GM1 A;  1J8M F;  1Z6A A;  2EPM X;  4NOI A;  4AYB L;  1VMA A;  4RD9 A;  4AL0 A;  4ZH4 A;  5JUA A;  2L81 A;  4QI2 A;  3GTM K;  4O6M A;  3T9O A;  2B63 K;  4LR2 A;  3K1I A;  5L0J A;  4KB4 A;  4N6H A;  5EGY A;  4KMA A;  3NMI A;  2UUI A;  1DD5 A;  3MBG A;  3Q6N A;  1HE1 A;  4M1X A;  3GWN A;  4KDD A;  4MTF A;  2H8A A;  1FAP B;  2BE5 F;  5C44 K;  4LOW A;  4YFX A;  4G7H A;  2J9V A;  4DVY P;  4RDA A;  1B4A A;  4LLE A;  1TWH K;  5TJ3 A;  2HJM A;  2EIL C;  3X1O A;  3PO2 K;  2G3K A;  1G8X A;  1ZHW A;  3EGD A;  1CPQ A;  1Y1V A;  2XLD A;  2GDC A;  3M3Y K;  2PNO A;  3RIP A;  3LS1 A;  3NG1 A;  4EBJ A;  4IAQ A;  5L0H A;  4LLC A;  1LI7 A;  5GPG B;  2P5M A;  4C2M K;  4KBL A;  3DWW A;  3SP1 A;  3LES A;  5IP7 K;  3G4Z A;  3BP8 C;  1TKN A;  3H0G K;  4C7O A;  2JX0 A;  3WOD F;  2R92 C;  3HOU C;  1IW7 A;  2HUJ A;  1PD1 A;  4KAR A;  5KYN A;  3ABM C;  1EFW A;  2QTV A;  1TFO B;  3NDB B;  2P6V A;  1YAU O;  2YU9 K;  2Y3P A;  3K33 A;  1ISE A;  5E33 A;  2IXN A;  2R7Z C;  1YNN A;  2I8B A;  4ULV A;  1QLE C;  1MNE A;  1H9T A;  5T3T A;  1TWC K;  3GOD A;  4KM9 A;  2CDQ A;  4BKW A;  1I6H K;  5B1A C;  3V5X A;  2A1D D;  4O6N A;  3S90 A;  1D0X A;  1G51 A;  3KKB A;  4U5H A;  5DS6 A;  1JOG A;  4CDV A;  4A3J C;  4CS8 C;  3ZWI A;  2EPN A;  4BEM J;  2WZG A;  3J06 A;  3ZTM A;  3K6B A;  1VK5 A;  2OCC C;  1H6G A;  4I44 A;  2PMZ L;  1VLS A;  2Y0S D;  1IBA A;  2O9X A;  2AU5 A;  2J9B A;  1AB4 A;  4GYT A;  3AGU A;  3KPH A;  4MTO A;  5KYX B;  2Y3H A;  3T6G B;  4LK0 A;  4XWJ A;  4U9E A;  3BEH A;  2NVX C;  3QX3 A;  1PJ6 A;  4YJW A;  1R9T A;  1USO A;  4XQ1 A;  1E86 A;  3GTL C;  4ZLD A;  2NSG A;  4YWQ A;  3WOD A;  2QY9 A;  1Q0M A;  4RMF A;  5D4D A;  1JMW A;  1JAF A;  2XXA A;  4A3D C;  1DCP A;  3O55 A;  4GZY A;  4L6R A;  4MEY A;  2A6E A;  1WCM A;  2YU9 A;  4ULW A;  1I4Z A;  3SXZ A;  4A3E C;  3S2D C;  1M6T A;  3RQF A;  1WAS A;  3UNG C;  4PFO A;  3ZQY A;  1WWP A;  4LDK A;  1I5N A;  2R7V A;  5L0G A;  4PAC A;  2YU9 C;  2Q3T A;  4N06 A;  2AWC A;  2UUH A;  4JEA A;  3LPX A;  1JRA A;  1RKC A;  4OD5 A;  1USM A;  2ZPA A;  3GTG C;  3W2V A;  3ASN C;  3LAJ A;  2E2H K;  1I3Q C;  2O5I A;  1V74 B;  1YVI A;  4XCH A;  1XXB A;  2YL0 A;  4KMD A;  3H2V A;  1ZYR A;  3N0T A;  3EJN A;  2NVX A;  1R9T C;  3AG1 C;  3GTK C;  1HY5 A;  3ZTZ A;  4BEJ A;  4X0R A;  4DBQ A;  1WTY A;  5JLI A;  5COM A;  2NUP B;  1EK8 A;  4KN4 A;  1TWH A;  4BLB A;  3NKD A;  5EHH A;  3NUH A;  4O2D A;  4A3K K;  1R9T K;  1A7D A;  4W8P A;  4A3D K;  4JCH A;  2R9R B;  4K1O A;  1WOL A;  3I4N C;  3RQE A;  3KMI A;  3S16 K;  2XSE A;  3B0P A;  5M3M K;  2GAH C;  3UR3 C;  1PJ5 A;  1S7Z A;  4K7B A;  4O7G A;  1EI6 A;  4BBS C;  4OIP A;  4QJV A;  4YT8 A;  3NMK A;  2XL6 A;  4GTF A;  3HOW K;  2KGO A;  4NQF A;  1FNT c;  2JA6 C;  4A3M C;  3H3V D;  4DJ9 A;  1YCL A;  4O6Y A;  3OPF A;  1OKK D;  1Q0K A;  3CEX A;  2YLI A;  4JEB A;  2QNL A;  2IXM A;  4DVZ A;  2R93 K;  2R7T A;  2NVT K;  3RH3 A;  2Y0S L;  2JA6 K;  3TOL A;  1HI9 A;  5L46 A;  4Q4Z A;  3NYL A;  1V54 C;  1ZVU A;  1JOE A;  3GTG A;  4A3J K;  3T01 A;  3Q6M A;  4GQH A;  2YLD A;  5FLM K;  2YZS A;  4X6A K;  3DE9 A;  256B A;  2ZXP A;  1TWC C;  1T5O A;  5TMC A;  4A3B K;  3UGO A;  2Y3D A;  2GSN A;  2VUM K;  2L6H A;  3S17 K;  2YWA A;  1TWH C;  2NUP A;  4BJ5 C;  5JRA A;  3GEH A;  1APC A;  3T6B A;  2YHS A;  2M64 A;  1ORS C;  4A3I C;  4HFF B;  4A3F K;  1J8Y F;  3ABL C;  2PF4 E;  1ZYR F;  2VAS A;  3GEI A;  3HXA A;  3RYL A;  1LIH A;  3IEE A;  3BP3 A;  3S84 A;  2HS5 A;  4AE4 B;  4JC7 A;  3LUT B;  1TWG K;  1X31 C;  1HQM A;  4IJJ A;  4AX2 A;  1QKR A;  1ORJ A;  3FOO A;  4LLG A;  1MMG A;  4EWC A;  4NC3 A;  1A0B A;  4DRI B;  4B6I A;  3S16 C;  1XZQ A;  4N4W A;  2LSE A;  2YEV A;  3I4M K;  3RZD K;  4C3H C;  2ICW G;  5FLM C;  3T6J A;  2D5R B;  1NU9 C;  1HW2 A;  2J9U A;  3NMJ A;  3DXJ F;  3B29 A;  4XEF A;  4JJG A;  5DQZ A;  2CNW D;  2YL7 A;  4OIO F;  2J8W A;  2P0N A;  3FKI A;  1UFB A;  3L0I A;  4XLP F;  3MYI A;  4U5B E;  3DAF A;  2NVT C;  1RKE B;  4MQ9 F;  2NUT B;  1E84 A;  3GDZ A;  4LAC B;  2R92 K;  5KYX A;  3HOU K;  1NFN A;  4CJO A;  4E17 A;  1WCM C;  1WOP A;  2VUM A;  2A0U A;  1K83 A;  1Q0F A;  2Y3G A;  2KK1 A;  3HOW C;  3V5Z A;  3DD7 A;  3DKA A;  2B63 C;  1WQG A;  4U5D E;  3HJC A;  2CFA B;  1DOV A;  4AYB D;  2EIK C;  2XL4 A;  2R02 A;  3FOP A;  2X51 A;  1RKE A;  4BBS K;  3LJB A;  1C02 A;  3I4U A;  3O10 A;  3QW0 A;  3KYJ A;  5C4X C;  2XCQ A;  2YLG A;  5IOR A;  4WIL A;  1ZHY A;  3AD9 C;  3CAX A;  3LLK A;  3FAP B;  1YDI A;  3H2U A;  2J0X A;  4X6A C;  2TMV P;  3SZZ A;  3TTG A;  3U2L A;  4P9S A;  1DOW A;  4Y52 C;  4G78 A;  4YT5 A;  1MMN A;  1ZBS A;  2AWY A;  2FQT A;  1A7E A;  2WB1 L;  2J0W A;  5FZT A;  3QVY A;  3M79 A;  5KYU B;  1I6V A;  3LEV A;  4YFN A;  3ZC4 A;  4U5E E;  2CGE A;  5JP7 A;  3V5Y A;  4DBR A;  4PJN A;  2BL2 A;  3FHD A;  2RD9 A;  2YVK A;  1VB5 A;  2R7W A;  3FKI C;  1GQA A;  3EHM A;  4R32 A;  3N0C A;  3ECS A;  2J46 A;  2X0C A;  3EGD B;  2J45 A;  5EK0 A;  1YYX A;  3HNK A;  1E83 A;  3HKK A;  2CW0 A;  1RMV A;  3GTJ K;  2HJ3 A;  4C3H K;  5C3E C;  3ZQV A;  5M3F K;  4KB2 A;  1ORY A;  1V5V A;  1O5H A;  2OKU A;  4KAT A;  2PHC B;  4FZB A;  2KQ9 A;  4EBK A;  3C8G B;  2A6H A;  4MVR A;  3CSK A;  3BUE A;  1O3U A;  2P1A A;  3HNI A;  1I4Y A;  1OXK A;  4Y7N C;  2FGY A;  3M4O C;  3V7O A;  1TWG C;  3JZ0 A;  2Q9A A;  4JIO A;  1YNJ A;  4Z9H A;  4Q5S A;  3POV A;  1E85 A;  1Y6D A;  4Y7N K;  1E2X A;  4BY7 C;  2HZ8 A;  4P5A A;  3N24 A;  4Z9J A;  2JA5 K;  2HKV A;  3GTP A;  1NZE A;  4J7T A;  1NU7 D;  1F7U A;  4OIN A;  2GAQ A;  2NPU A;  3E70 C;  4JTD B;  5JFE A;  1VYI A;  4GTB A;  4A3C C;  4PR9 A;  2LFD A;  2XXA B;  5L0D A;  1KQ4 A;  5F5F A;  2LCH A;  1K83 C;  1BGW A;  4IAO A;  3G4X A;  5C4X K;  1D1C A;  3RKO F;  4MVS A;  3U2M A;  5IYB K;  3JYY A;  5IYD K;  4OIR F;  2GWW A;  4D4X A;  2XLO A;  4A4A A;  4AL1 A;  3S1N K;  1YLM A;  1NG1 A;  3FMS A;  5BQG A;  1ZU4 A;  3T02 A;  1ST6 A;  1HMO A;  1WOS A;  4WJ4 A;  1FTS A;  2BC5 A;  1EQR A;  2NVX K;  3B0U X;  4JZA A;  5TMF A;  4BXX C;  2YRF A;  4FM9 A;  3SZY A;  2R92 A;  2VCB A;  2OJQ A;  3QZC A;  5CHP A;  2L6F A;  3S28 A;  1LVK A;  3HNL A;  4CBE A;  5E3A A;  3S2H C;  1JR8 A;  1Z5Z A;  4KMH A;  3B0V C;  2KSF A;  4A3E K;  3S2D K;  1Y1W A;  4YT4 A;  3S17 C;  3N0B A;  4G7O A;  2WVQ A;  4A3G K;  2RSE B;  3L34 A;  3HKZ L;  1OW8 A;  3PO2 C;  1VLO A;  3GTJ C;  1L0W A;  2Q9C A;  5FJ8 K;  4J30 B;  3OWT A;  4A3G C;  2JA7 A;  2B0H A;  4KM8 A;  5HSW A;  3EHN A;  2IYL D;  2D6F C;  2GSO A;  2YKZ A;  1HMD A;  3DI5 A;  4BJ1 A;  3GTG K;  2L9J A;  4XLN F;  3R7C A;  1D1A A;  3EGX A;  1LM3 B;  3OEO A;  1BR4 A;  2W45 A;  3I5P A;  4M63 A;  1EH1 A;  3L8I A;  1N1C A;  5BQH A;  3C62 A;  1YA7 O;  4FX5 A;  1HE9 A;  2KW3 C;  2JD3 A;  1AEP A;  3S14 K;  2VB6 A;  3UMK A;  2XLH A;  4QIW D;  1QZX A;  3AD7 C;  5IYB C;  1CGO A;  4CDA A;  2L6G A;  5BUO A;  3JCU Q;  2L7A A;  2CYD A;  2H7V C;  3EPV A;  2XLV A;  4CX9 A;  1CPR A;  3HKZ D;  4MEX A;  1I50 K;  4KC6 A;  1L3P A;  4BY1 K;  3EQL F;  4P6I C;  1VRQ C;  4YG2 A;  2Q00 A;  4BLA A;  1SYQ A;  3LEO A;  1ZHZ A;  3RQG A;  2D4U A;  2XS8 A;  2EPL X;  2WZF A;  2OOC A;  3U3F A;  3TFI A;  3VM6 A;  3SXM A;  2J7P A;  1SF8 A;  2R7Q A;  1RJ9 A;  3K7D A;  1QQ3 A;  4MVQ A;  3GM2 A;  2G3V A;  3H0G C;  1J6V A;  3O39 A;  4GTA A;  3C8G D;  4Q7C A;  2PX0 A;  1DCO A;  3GIR A;  2XCO A;  3GTM C;  1TQG A;  2E2I C;  4WGY A;  4JJF A;  2HV7 A;  3M4O K;  3GTQ C;  3L4K A;  3C18 A;  2Q7R A;  4UDV A;  1O29 A;  3IPM O;  2R7U A;  4W8K A;  1MND A;  5KYW A;  2KYH A;  5IYC C;  4PJJ A;  1T6Q A;  3S0X A;  2PFD A;  4XPY A;  1XZP A;  1S05 A;  1RXQ A;  4G0V A;  5DS5 A;  3S15 C;  4F4B A;  5L0F A;  4U9D A;  3JST A;  5BQI A;  2C03 A;  3N3Y A;  3GOR A;  2Q9B A;  5F28 E;  4HEA J;  2ZXW C;  3FOE A;  2NVQ C;  1Q0D A;  4JVS A;  4YN0 B;  3CQZ C;  3MML B;  1PV3 A;  1T6U A;  2HSB A;  2M4E A;  4YL1 A;  4C3E A;  4YL0 A;  3DXJ A;  1Z23 A;  3PMR A;  3VF0 A;  4GT9 A;  1Z3I X;  4D4N A;  4BXX K;  4P9F A;  2XCR B;  3EG9 B;  1IL2 A;  3Q7G A;  2A69 F;  5IP7 C;  4GTE A;  2JH3 A;  4FAP B;  2OJE D;  3PO3 C;  1VTM P;  1TWA K;  1V4A A;  5IOT A;  3AQC A;  5B1B C;  4K0D A;  3GM3 A;  1LE2 A;  4HE8 D;  1BZ4 A;  2GSU A;  4EKW A;  2GFH A;  3C8G A;  4KN7 A;  3GAN A;  3OEP A;  4A3K C;  2ZXR A;  4KNW A;  1CGM E;  5A6K A;  2R7X A;  3HOY C;  2DYR C;  2VH3 A;  2EPO A;  4A3L K;  3DE8 A;  2OEX A;  2R7R A;  1I3Q K;  1ZHX A; 
#chains in the Genus database with same CATH homology
 3O6X A;  4BJ5 A;  4LLC A;  1MMN A;  4BG0 A;  2A6E F;  1ZBS A;  2B0J A;  4H4K C;  2J0W A;  4CS7 A;  3JRT A;  4JW1 A;  3HLZ A;  3SYN A;  2P5M A;  3ERE D;  4KBL A;  5KYU B;  3SP1 A;  3LEV A;  3LES A;  3SZR A;  4E7S A;  1TKN A;  2FFH A;  4C7O A;  1M57 C;  3ZC4 A;  4U5E E;  5KYW B;  2CGE A;  3W8I A;  3WOD F;  3EGX B;  3F47 A;  2NVY A;  1TWC A;  2W4B A;  5IOS A;  3L4J A;  4DBR A;  4KAR A;  1PD1 A;  3W8H A;  5KYN A;  3ABM C;  4PJN A;  2QTV A;  3SNH A;  3FHD A;  3NDB B;  3G4A A;  4C2M C;  2P6V A;  4WJ0 A;  1ZHT A;  4QDL A;  2E2H A;  2Y3P A;  2H7O A;  2R7W A;  3K33 A;  1LKX A;  1ISE A;  5E33 A;  4KAS A;  1PD0 A;  2IXN A;  2PX3 A;  3EHM A;  3N0C A;  3ECS A;  4CS9 A;  2J46 A;  2I8B A;  2WL8 A;  3EGD B;  2J45 A;  3FOF A;  1QLE C;  1D0Z A;  2WZL A;  3DJU B;  5E3C A;  2Y3B A;  1MNE A;  5T3T A;  4ZLC A;  4LQY A;  3GOD A;  1FMV A;  4KM9 A;  2CDQ A;  4BKW A;  3G4C A;  4KB2 A;  1FFT C;  1B4B A;  2R7Z A;  5B1A C;  1O5H A;  4KAT A;  2Z15 A;  4C7O B;  4C3B A;  4Q4Z F;  2KQ9 A;  2PHC B;  5KYU A;  4FZB A;  2A1D D;  3FHZ A;  4O6N A;  4OIQ F;  4PJL A;  1D0X A;  2J9W A;  3KKB A;  4U5H A;  4CIH A;  1BR2 A;  5DS6 A;  4G7O F;  4CS8 C;  3CSK A;  3BUE A;  3Q7L A;  2WZG A;  4C3D A;  2WVO A;  3K6B A;  2V26 A;  1VK5 A;  2OCC C;  4I44 A;  3GTQ A;  3GTM A;  3EFO A;  1JPJ A;  3K66 A;  3AG3 C;  2FGY A;  5DVW A;  3V7O A;  2O9X A;  4LER A;  4GTL A;  3K1H A;  2Q9A A;  4NY3 A;  4G0H A;  1AB4 A;  4GYT A;  3DJN B;  1O26 A;  3POV A;  4BJT A;  2Y3H A;  5KYX B;  4XWJ A;  3FAJ A;  4I1O B;  4YT2 A;  5T1D B;  2R7O A;  4KNV A;  3GTK A;  4GTC A;  2Y39 A;  2P7V A;  4P5A A;  3N24 A;  5JVO A;  3QX3 A;  4FES A;  1TWG A;  4YJW A;  3GTP A;  1NZE A;  3ASO C;  1R9T A;  4OD4 A;  2NG1 A;  1NU7 D;  4ZLD A;  3DZA A;  4DDQ A;  4YWQ A;  5IOQ A;  2QY9 A;  4U5C E;  4Q5S F;  4I3M A;  3E70 C;  4U5F E;  3EG9 A;  3ZG1 A;  4ANJ A;  1D0Y A;  2XXA A;  5EGH A;  3DMD A;  3VYW A;  5JFE A;  1VYI A;  4GTB A;  2RH6 A;  3H65 A;  3EH1 A;  3X2Q C;  2XXA B;  1KQ4 A;  2EIN C;  4OIP F;  2DYS C;  3S29 A;  5F5F A;  4I1M A;  1WCM A;  5DS4 A;  1BGW A;  4KAW X;  4IAO A;  1O27 A;  2YU9 A;  2W4M A;  2C04 A;  1D1C A;  4ULW A;  3RKO F;  2EIM C;  4PK4 A;  4OIR F;  4OIN F;  5KYY B;  3UNG C;  4PFO A;  1NG1 A;  4E7Z A;  2KNH A;  2ZXO A;  3EZI A;  3EZH A;  1ZU4 A;  4J3N A;  2R7V A;  3SEO A;  4G0W A;  1ST6 A;  1FTS A;  3AH5 A;  1O28 A;  1MMD A;  3B0U X;  2Q3T A;  4N06 A;  1TR2 A;  3NRH A;  5DLJ A;  4JZA A;  2RGR A;  4XTK A;  3GTL A;  3QMK A;  4P5B A;  3LPX A;  4C3J C;  4FM9 A;  2IXO A;  4BJ6 A;  2A68 F;  2R92 A;  4OD5 A;  3E9V A;  3JYH A;  1M2V B;  2ZPA A;  1V55 C;  2KWA A;  3WG7 C;  1OKK A;  3NYM A;  3W2V A;  3ASN C;  3QZC A;  5CHP A;  3AQO A;  1ZXO A;  5KYY A;  3LAJ A;  3S28 A;  4AK9 A;  1XXB A;  1LVK A;  4KMD A;  4CBE A;  5E3A A;  1Z5Z A;  4KMH A;  3N0T A;  3EJN A;  1OCO C;  1XXC A;  1VYK A;  3MX3 A;  3B0V C;  2NVX A;  3KL4 A;  1W2W A;  1WIH A;  3GTJ A;  3AG1 C;  1Y1W A;  2A6H F;  4YT4 A;  3EFO B;  5D91 A;  4HFK B;  3TD7 A;  4BEJ A;  4X0R A;  3N0B A;  2WVQ A;  4DBQ A;  1WGW A;  1O2B A;  3UGP A;  3L34 A;  4G7Z F;  4AE4 A;  2NUP B;  1EK8 A;  1TWA A;  1OCR C;  3ZSU A;  1TWH A;  4BLB A;  3NKD A;  3LAP A;  5EHH A;  3NUH A;  3W2W A;  1OCZ C;  4JCH A;  5D92 A;  3CZ6 A;  2E87 A;  3ABK C;  3KMI A;  2Q9C A;  4G7H F;  2XSE A;  1IS1 A;  2V3C C;  3B0P A;  4J30 B;  3OWT A;  2JA7 A;  4U5G A;  2IOQ A;  4KM8 A;  3UR3 C;  3KH2 A;  1S7Z A;  1IZM A;  5HSW A;  3EHN A;  4K7B A;  2IYL D;  4O7G A;  3DM9 B;  4RBN A;  3H0G A;  2GSO A;  3ITF A;  2IXP A;  4YT8 A;  3FDQ A;  4BJ1 A;  2L9J A;  4XLN F;  3T4R A;  4CS8 A;  4GTF A;  2KGO A;  1MMA A;  1I3Q A;  1D1A A;  3EGX A;  3OEO A;  4GFQ A;  4O6Y A;  1BR4 A;  3OPF A;  3JT1 A;  1OKK D;  2W45 A;  2B63 A;  1FFH A;  3I5P A;  4M63 A;  4EBB A;  1EH1 A;  2PP4 A;  1N1C A;  4BJ6 C;  1SZI A;  3M1C B;  2JA5 A;  2IXM A;  4FX5 A;  1Z63 A;  4DVZ A;  4KC9 A;  3ZIB A;  2R7T A;  3RH3 A;  2Y69 C;  2KW3 C;  2JD3 A;  2G62 A;  5B3S C;  2VB6 A;  1KU2 A;  3UMK A;  3CQZ A;  3ZVR A;  4CSA C;  3NYL A;  1QZX A;  4CS9 C;  3LS0 A;  1V54 C;  1ZVU A;  5DQT A;  3GTG A;  5CI8 A;  1LS1 A;  3Q6M A;  5BUO A;  3JCU Q;  3K1I C;  1O2A A;  2YZS A;  2H7V C;  3EPV A;  2WB7 A;  5F5H A;  2WVN A;  5IY5 C;  2XRH A;  3MLG A;  2MWQ A;  2ZXP A;  3B9Q A;  4KC6 A;  4O79 A;  4IWB A;  3UGO A;  2JA6 A;  3EQL F;  4DOZ A;  2Y3D A;  3JSZ A;  2GSN A;  3OA1 A;  1TWF A;  4C3I C;  2CNW A;  4P6I C;  1ZU5 A;  1PCX A;  4BLA A;  2NUP A;  4BJ5 C;  3N2Z B;  1ZHZ A;  5FCL A;  2WZF A;  2EIJ C;  3T6B A;  1O25 A;  2YHS A;  1GE9 A;  2R7S A;  1WQH A;  3UMH A;  1SMY F;  4JUR I;  4HFF B;  3PHF 2;  1WQF A;  1J8Y F;  4KI2 A;  2OG2 A;  2J7P A;  3ABL C;  1O87 A;  2PF4 E;  3AQB A;  3LLI A;  1ZYR F;  2VAS A;  3S27 A;  3I5Q A;  1SF8 A;  2R7Q A;  3RYL A;  3IEE A;  1RJ9 A;  4ILD A;  3K7D A;  4AE4 B;  5CI9 A;  3EH2 A;  2G3V A;  4IJJ A;  1FMW A;  4FWV A;  3DM5 A;  4AX2 A;  3LNR A;  3O39 A;  4GTA A;  3AG4 C;  2HV6 A;  2PX0 A;  4Q7C A;  1MMG A;  2XCO A;  4GTD A;  2KJG A;  4EWC A;  3HTK C;  1M56 C;  5T3W A;  1F9N A;  4JJF A;  2HV7 A;  3L4K A;  4J32 B;  4QI0 A;  4B6I A;  3VA7 A;  2CFA A;  2W9Y A;  5L3V A;  3RFY A;  1O29 A;  1IW7 F;  4G0U A;  2R7U A;  4IRU A;  1XXA A;  2J7P D;  4W8K A;  1MND A;  5E2Q A;  5KYW A;  1D1B A;  1BJT A;  2LSE A;  2ZFZ A;  5CJ9 A;  2YEV A;  3VAY A;  4C3H C;  4CSA A;  5EGE A;  3NKE A;  3NYJ A;  3T6J A;  2D5R B;  4PJJ A;  1NU9 C;  3S0X A;  3ORE A;  2J9U A;  2PFD A;  2DGJ A;  3DXJ F;  4GEH A;  3AQP A;  4JJG A;  4G0V A;  5DS5 A;  1M2O A;  1BR1 A;  5DQZ A;  5L3Q A;  2CNW D;  1SFO A;  3DAG A;  4F4B A;  4OIO F;  2MYS A;  2C03 A;  2CW0 F;  3UMI A;  3FKI A;  2Q9B A;  3N3Y A;  1O24 A;  4HEA J;  2ZXW C;  3FOE A;  3L0I A;  4JVS A;  4XLP F;  1J8M F;  1Z6A A;  4U5B E;  3DAF A;  4YN0 B;  3FVY A;  3MML B;  1VMA A;  4RD9 A;  4MQ9 F;  2NUT B;  2L81 A;  4QI2 A;  2M4E A;  4LAC B;  4O6M A;  5KYX A;  4C3E A;  4LR2 A;  3GTO A;  1Z23 A;  4KB4 A;  3PMR A;  5EGY A;  2VUM A;  4KMA A;  1K83 A;  4GT9 A;  3V4G A;  2Y3G A;  4MND A;  1DD5 A;  1Z3I X;  3Q6N A;  2R93 A;  4PJM A;  4M1X A;  3EG9 B;  2XCR B;  3DD7 A;  3Q7G A;  1WQG A;  4U5D E;  3HJC A;  4KDD A;  2A69 F;  2CFA B;  4GTE A;  2JH3 A;  2EIK C;  4A2N B;  2BE5 F;  2XL4 A;  2E2I A;  2NUT A;  2J9V A;  2X51 A;  4DVY P;  3F46 A;  3LJB A;  1M2V A;  4RDA A;  1B4A A;  3I4U A;  5IOT A;  4LLE A;  3AQC A;  5B1B C;  5TJ3 A;  4K0D A;  2XCQ A;  2EIL C;  4HE8 D;  1JPN A;  1I50 A;  5IOR A;  3Q3Q A;  3X1O A;  1ZHY A;  2GSU A;  2G3K A;  2GFH A;  1G8X A;  1ZHW A;  3EGD A;  3GAN A;  3LLK A;  1RJ9 B;  2ZXR A;  4KNW A;  4PFP A;  1Y1V A;  3OEP A;  3CAG A;  1OCC C;  2R7X A;  2J0X A;  2DYR C;  2VH3 A;  3AG2 C;  1VOM A;  3RIP A;  3LS1 A;  2H7B A;  3LAY A;  3NG1 A;  2R7R A;  1ZHX A;  4YT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...