3S0XA

The crystal structure of gxgd membrane protease flak
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
231
structure length
225
Chain Sequence
SGSMIEYIIGALGLIIASVQDEIEDYIWIFLAVFGVLFAIYSSITLLDYSILINSISGFVICFILGYMMFLSGIGGGDGKMLIGLGALVPKFQMPIYTSLGTLLNLNYVPTFPIMVFINGIFFMVFLPFVILFRNILNGARPKTGKEFILMFFGEKMKVNVAKEQKRLIMGQNDKINFFPADEDFSKYSNNEEIWVTPQIPLIIPITLSYLVTPIIGDRILDFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of GXGD membrane protease FlaK.
pubmed doi rcsb
source organism Methanococcus maripaludis
molecule tags Hydrolase
molecule keywords Peptidase A24B, FlaK domain protein
total genus 56
structure length 225
sequence length 231
chains with identical sequence B
ec nomenclature ec 3.4.23.52: Preflagellin peptidase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01478 Peptidase_A24 Type IV leader peptidase family
A PF06847 Arc_PepC_II Archaeal Peptidase A24 C-terminus Type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1220 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3s0xA01
3.30.1360.160 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3s0xA02
3S0XA
chains in the Genus database with same CATH superfamily
3I4NK 3GTOC 4JK1A 5A6BD 4M63A 1USMA 1O3UA 2R7ZK 1ZHWA 2NUTA 3SEOA 3OREA 4P9TA 4BEMJ 3ECSA 3E70C 2LD6A 2HZ8A 4KATA 5CHPA 1RJ9A 1LVKA 1HW2A 3TFJA 4BBSK 256BA 3T6GB 1G5ZA 4A3JK 3V4GA 4Q4ZA 2P5MA 2E87A 3T6JA 3ZTMA 1LI5A 3Q7LA 3CQZK 2XLWA 1OCZC 3VA7A 5DS6A 2XL8A 4A3GC 1WOOA 1M2VB 4LJZA 4DRIB 2OEVA 4AYBL 2R7RA 5EGHA 5EHHA 3IPMO 1VH2A 1BR1A 3SNHA 5TMFA 2XCRB 1D1BA 1EFWA 2QTVA 1OQCA 2QLAA 2DI3A 4QI2A 4G0VA 1RU0A 3H0GC 1C03A 1WCMK 4A4AA 3AG3C 3JSEO 2GAGC 4NC3A 1Q0FA 1E86A 2OEXA 4CS9A 1TWCK 1Y4CA 4C7OB 4G0UA 4BY7K 4RMFA 3A11A 4A3CK 4JJFA 3IHUA 1VRQC 3QVZA 3G4XA 2D5RB 1JMWA 5COFA 3ZSUA 1IL2A 3GTKA 3DXJF 1ZHYA 3UMIA 2R05A 4JE9A 4A3EK 4PJJA 3LUTB 2H7VC 5L0GA 4A93C 1MMGA 4C3IC 2E2HA 2OG2A 2Y39A 2VH3A 5FCLA 4G7ZA 1WORA 3S17K 3GTQA 4N6HA 3S1QC 2KQ9A 3ATPA 4AE4A 5K0IA 1XZPB 1I3QK 3M15A 1GGQA 2XCOA 4LACB 2JA5K 5BQHA 2ZXWC 1KTMA 3TOLA 4YFKA 3GTMC 4XSZA 4CDAA 2B63A 4CSAA 3GTQC 1Q0GA 4K0DA 3CSKA 1Y1VC 3FAJA 4H54A 2OOCA 4L6RA 1XZQB 3TOMA 1DOVA 4XPYA 4JC7A 1NLXA 2CFAB 3HKZL 5CJ9A 2R92K 1CPQA 2EILC 3EHNA 2W4BA 1W2WA 4G0WA 1O2FB 3ZQVA 3RZOC 1LKXA 1R4TA 2IYLD 3EFOB 3U9JA 3PO2C 1TKNA 3EH1A 2BL2A 2A69F 4U5DE 1HQMA 3LEOA 2PF4E 3JT1A 3GWNA 1XZQA 4Y7NC 4CS9C 3LPXA 4LDKA 4Q5SF 2J0XA 2YL7A 3RZDK 1X31C 2V6SA 3X2QC 5TJ5E 3EQLA 4YFNA 3ZDLA 4AX2A 2WB7A 2KSFA 4MNDA 2CNWD 4WGYA 2LFFA 3RYLA 4HE8D 1TWGA 4U5FE 3EH2A 4GTBA 1YLMA 1KQ4A 4O6YA 1ST6A 3GEHA 1T6IA 2IXPA 4XWJA 4JCHA 4MVQA 4C3JC 3A9CA 4AE4B 2H8AA 3PHF2 2R93K 1OW8A 2VCAA 1BGWA 3IQCA 4ZLDA 3ABKC 3S16C 3MYIA 5HV9A 1RKEB 3J06A 4KMAA 1WTYA 4CIHA 2X51A 2GSUA 2R7ZA 4LERA 2NVTK 3HOWC 3S90A 3I4NC 5JVOA 3N24A 1Z7Qc 3FOEA 3N0BA 1OW6A 3FKIA 1T5OA 2P6VA 1L3PA 3IQTA 2YQYA 4U5BE 2J9UA 1A7VA 1Z23A 3SZYA 2V3CC 2AU5A 3S0XA 3PO2K 4FZBA 3HOVC 1BBHA 2UUIA 2PFDA 1ORJA 4M1XA 1YDIA 2VUMK 2JA7K 4PFPA 3K33A 4ULWA 1TWAC 5L0CA 1I6HC 1BS2A 2YLDA 2YL3A 4LOWA 2P8TA 3US6A 1OR3A 4JW1A 3S1MK 1OCOC 5JFEA 4WJ4A 1E2XA 1L7CA 4G7HA 3G4ZA 5T1DB 3T6BA 4U5GA 2A6HA 1BDFA 5C44K 5L0IA 1HI9A 3GTOK 1I6HK 5IP9K 2DB4A 3KH2A 5CI9A 2L6HA 3U5SA 1R9TK 2VC9A 3N0TA 4W8PA 1SF8A 3HOZK 2Y3DA 2XS8A 4IWBA 1JR8A 3AG4C 4CDVA 4OIQA 1D0ZA 4C3DA 2NVQC 2RH6A 3GTGA 1WQHA 1L0WA 1RCPA 2KW3C 4A3JC 3W8HA 2KJGA 4PFOA 1FFHA 4BBRK 1ZVZA 4NY3A 1Q0KA 4GTEA 4JTCB 4CIPA 5FLMC 4RDAA 3S16K 3GTPK 1T6QA 1A41A 3I4MC 4JEAA 4QIWD 1YA7O 4MVSA 4OIOF 4MTOA 3HOXK 1I50K 4JZAA 4Y7NK 1TWCC 3S15K 1F1MA 2HJMA 1MQVA 3Q3QA 1ZW3A 3JSTA 5B1AC 2Y0SL 3CQZA 3ZC4A 3RQGA 2AWCA 4KMUA 1NFOA 3AQPA 3NRHA 2YL0A 1WQFA 4PAAA 4U9EA 1U6HA 2Z15A 3HTKC 1Z5ZA 2R92C 1Z3IX 3RF3A 2PBEA 5TJ3A 4MVMA 3LLIA 3HOXC 3GODA 4CS8C 3M4OC 1TQGA 2JA6A 2YU9C 4AK9A 4B6IA 1RKEA 1NZEA 5F5FA 4C3HC 2GFHA 5C4JK 3ITFA 4CJOA 1VOMA 4J30B 3GSIA 1IE0A 5IY5C 1F7VA 2EIKC 2LSEA 4YJWA 3AG1C 3DM5A 5EGEA 4MEYA 2HUJA 1UV7A 2YU9K 2XSEA 3IPJA 4GZYA 3K66A 4J7TA 1JPJA 2XXAA 4YFXA 1WOLA 2ZD9A 3JRMO 3RVYA 4G7HF 2BE5F 4KAWX 1QQ3A 3KKBA 4KARA 3TFIA 2VB6A 1H7IA 2FAPB 3S1NC 3AH5A 5CIVA 4DRJB 1I50C 2NSGA 1SYQA 2FQOA 3I4UA 2WZGA 3S1RK 2KWAA 1EH1A 4XEVA 5IOTA 4EUKB 4FWVA 3GTMK 2PNOA 1ZYRA 2LK4A 3B29A 3AD8C 3GTPC 2Q3TA 3GANA 3L8IA 4BJTA 1YAUO 3IQ5A 3NKDA 1DCPA 2B63C 4NTBA 4P5BA 4I1MA 1J6XA 1PJ6A 1YNJA 4KM9A 5M3MK 1TWFC 3ABMC 2D6FC 2WVOA 4YL1A 4YG2A 2EPMX 4RD9A 4XCHA 2YEVA 3GIRA 3G4AA 3LNRA 3RZDC 4O79A 2RGRA 3EJNA 3S84A 4G7ZF 5KYWB 2YU9A 4GFQA 3QTHA 2XL4A 4LK1A 5AGFA 1YYXA 3PO3K 2FGYA 3T01A 3HOYC 3VRCA 4KI2A 2CDQA 4IJJA 2Q9AA 1SMYF 3C8GA 1OW7A 1BR2A 3ERED 2WAQD 1SZIA 3F46A 3EZIA 3CQZC 1ORYA 2DGJA 3HOYK 1SFOC 1V74B 3VF0A 1AUEA 2A0BA 1XPPA 5L0FA 3ASNC 1OXBA 1ZU5A 3HNLA 3JYYA 3U8VA 5KYYA 1WQGA 1I4YA 3EGDA 5IYDK 3N2ZB 3RQFA 4YT8A 1F7UA 2CFAA 1NU9C 4DVZA 3HKZD 3VM6A 3M3YK 5BUOA 3UR3C 1LM3B 2YZSA 3WODA 1M56C 4KB2A 3HOUC 4GYTA 5IP7C 4PJMA 3LNMB 3DJUB 4NTFA 5IYCC 4I3MA 1ZHZA 3GM2A 1J98A 3B0PA 5IOQA 1M2VA 2WB1L 2JPUA 1T01A 1PV3A 2YWAA 2OJED 2W9YA 1DD5A 1O24A 1TWAK 1F9NA 2R7SA 3AQBA 4E7SA 3DJNB 2C03A 1QKRA 2Y3HA 3BUEA 2A6EF 3DM9B 4W8KA 3CEXA 5JVEA 1INNA 4DVYP 1RMVA 3W8IA 1LIHA 2OU6A 5M3FK 4BG0A 1A7DA 2XLVA 4O7GA 5BQGA 4BEJA 2PA8L 3GM1A 1MNEA 3NMJA 2HV7A 2PMZD 4LDQA 1WSRA 1VJEA 4KBLA 2D4UA 2Y0SD 4PABA 3HNJA 3GTLA 4A3KC 4N06A 1G8XA 4X0RA 3DD7A 1BJTA 3EGXA 3RIPA 3MBGA 1Y6DA 4N6CA 4LLGA 1RXQA 3MYFA 1XXBA 2J45A 2R93C 3PCVA 5FZTA 1ZHXA 2NVYC 1I6VA 3R2PA 3RH3A 5C3EC 3L4JA 2YVKA 3S28A 4JRZA 1IZMA 3QMKA 1WSVA 4N4WA 2E2HK 2CW0F 5KYWA 1SMYA 4U5CE 2Q9BA 3LJBA 4A3DK 4OINF 4XQ1A 5KYXA 3M4OK 3EPVA 1VLOA 4KMHA 2A69A 4MVZA 2R7QA 5JUAA 5FJ8K 3DXJA 5JLIA 1TR2A 1JAFA 3F47A 2GWWA 1TWAA 4OIQF 2LCHA 3SZZA 2WB1D 2V26A 5DLJA 2MHRA 3MX3A 2EPNA 1QZXA 3K1IA 3JYHA 5A6AA 5AC4A 3H3VD 3M79A 3B71A 4C45A 3EG9B 4C3HK 3GTGC 4AL0A 1EQRA 3C8ZA 2R7UA 3OA1A 2A68F 1MMDA 4HFKB 4YK5A 3S2DC 5B1BC 3M1CB 4CSAC 2IXMA 1Y1WK 4JJGA 5L3QA 4ONSA 1GQAA 3TFHA 1O2BA 3V7OA 3U0CA 1S7ZA 1PD0A 4WGZA 2OQMA 4MQ9F 5KYUB 3NKEA 2HFIA 4XEKA 4BY1C 4DDQA 4CDYA 5IYCK 1LPEA 4A3KK 4C3BA 1LS1A 2GA0A 3WAQA 1ZZPA 4KB4A 3HOUK 1HMDA 3L0IA 4X6AK 1Z6AA 5GPGB 1IS1A 4P5AA 2A0UA 2LIGA 2PHCB 3FHZA 3LAPA 3H2UA 3K7AK 4PK4A 2Y3PA 3TD7A 1FR0A 4XTKA 4MVRA 2KYHA 3LEVA 3IEEA 2JH3A 1B68A 2J46A 3A8KA 3FAPB 1YNNA 2M64A 4LQYA 3Q6MA 4IGGA 4A3MC 5M5YK 3I5PA 1T9KA 4EBKA 3H0GK 4G0HA 2JA5A 2CW0A 5M5WK 1N1CA 1G4WR 1TWHA 2OJQA 1YA9A 5IYBC 2HKVA 2R02A 3GTJK 1FFTC 4C3EA 3TQOA 1WCMA 3MMLB 3KYIA 2R9RB 3HNIA 3LS0A 3OWTA 3FHDA 2J9BA 4DXWA 4Q5SA 1SR2A 3E9VA 2BE5A 3BP8C 2JA6C 2EPLX 5IORA 2CNWA 3MLGA 4MW8A 3KPHA 4JKVA 4YT2A 3LS1A 3GTJC 3LAYA 1NG1A 3S29A 2R7WA 2B0HA 3K1HA 3M4CA 1H9TA 3S14K 1F93A 3B9QA 2R7TA 2YHSA 2W4MA 1K40A 2XRHA 4EBBA 4PR9A 5JT4A 1J6VA 5JS5A 3SP1A 1WASA 4KNVA 1USOA 2RD9A 2YLIA 2XS1A 2VASA 2HSBA 1Q0MA 3K6BA 1O87A 2J9WA 2PPBA 1O26A 4FM9A 2M4EA 4BXXC 2ZXRA 4NCQA 1HE1A 2H7BA 2MYSA 5T3WA 2NVTC 3EFOA 1HW1A 4GTCA 4EBJA 1TWHK 3HOZC 1O5HA 1IQ0A 3B0VC 3S1NK 3L34A 4CS8A 4WJ3M 2Q4FA 4JTAB 1GE9A 3T00A 4CBEA 2J0WA 1O27A 4J32B 1GM5A 2XLEA 1YZCA 3FDQA 1Y1VK 3O10A 3DKAA 4XPWA 3AOUA 3UGPA 2F22A 3S1MC 2JA8C 5KYXB 3IQ6A 2QUPA 4JTDB 2J7PA 1XWJA 2GDCA 3CAXA 2JA7C 3S27A 1LE2A 3NG1A 3HJCA 4IAOA 1HMOA 3W2WA 2VUMC 4GTLA 4YL3A 5JSLA 3K7AC 3ZQYA 2R03A 3U9MA 2R7VA 2EPOA 3NUHA 4KM8A 2JA5C 1VLSA 3ZIBA 1UFBA 3EGXB 1D0YA 2R25A 4J3NA 4YN0B 1Y1WA 3W4YA 4PJLA 4BJ6A 1V5VA 1JOEA 4XLPF 2Q00A 4LLCA 1SFOA 4A3MK 3RFYA 1HY5A 3FMSA 1Y1WC 2Q7RA 3QZCA 2LQGA 2C04A 3JTLO 4OD5A 4P9SA 4GQHA 3NYMA 4D4NA 4A3LK 2HSQA 3HLZA 3L8JA 3A8JA 2ZXOA 2NUPB 4AYBD 2PP4A 1EK8A 3GTGK 4ER9A 4DJ9A 4EWCA 3MFNA 3H2VA 1EI7A 1RJ9B 2XXAB 2RSEB 1UG7A 1IBAA 4YT4A 3ADAC 2A68A 1K83K 4JCZA 2EINC 3S15C 2XM4A 1B4BA 2KNHA 4A93K 4KNWA 3TTGA 5DQTA 1XZPA 1H9GA 1V55C 5L0HA 4BY1K 2W45A 3FKIK 4CX9A 2JA6K 3CZ6A 5A6JA 4C2MC 4KC9A 3R7CA 3NYLA 3ABLC 5D91A 1Z63A 4OIOA 2V6UA 2VCBA 1FMVA 4MTFA 1ISEA 3OPFA 1U89A 3V5XA 5E3AA 2HV6A 3ZG1A 3HKKA 2NVXC 2NUTB 3BRJA 3O6XA 4XSXA 4HEAJ 2YL1A 3TJ5A 2PX3A 2X0CA 4GTDA 4XLNF 1VB5A 1ZXOA 1LS4A 3AGTA 1G4US 2XLDA 3O55A 2IXOA 3M4BA 3JCUQ 1I50A 4C7OA 4OIPA 1NFNA 1QSPA 3NMIA 4O2DA 2NVXA 1Q0DA 4MTGA 2YKZA 4G78A 5IP9C 2CYDA 3HOVK 3FOPA 2XLHA 2PX0A 1TWGC 3SXZA 1E83A 3U2MA 4A3DC 2ZUEA 1EA8A 3WODF 4A3FC 3S2HK 2R93A 1MMAA 1J8MF 3ZTZA 4U5HA 1C0AA 5DQZA 3FOFA 3WG7C 1WGWA 4LLEA 2ZXPA 1R5ID 2WAQL 3GTJA 2O9XA 2EBBA 1DCHA 5KYUA 5D92A 4U9DA 1TWFK 1K05A 1T6UA 1MNDA 4P9FA 4EIYA 1TFKB 1I4ZA 1DOWA 4BY7C 4A3LC 1IW7A 5B3IA 4ILDA 4H4KC 3GDZA 3NMKA 1IW7F 4EKWA 4QJVB 5DS4A 1ZYRF 1DCOA 1XXAA 3QX3A 1ZU4A 1H6GA 2UUHA 4BKWA 3KL4A 3RZOK 3GWLA 2E2IK 3LLKA 2L9JA 3HOWK 2R7OA 3TJ6A 5AC5A 4MEXA 3H0GA 2W7VA 3K1IC 4KASA 1FAPB 3L1MA 1PJ7A 4GTAA 1ZW2A 1AB4A 3OEPA 3I5QA 4BBSC 1O25A 4MVOA 2NG1A 5HL8A 1CGOA 4Y52K 3Q7GA 3LESA 1A7EA 4QJVA 1YZAA 3S2DK 1LI7A 4DBRA 2DYSC 2BC5A 4LDRA 1JQWA 1I3QA 3M3YC 2QNLA 2EPKX 4A3FK 3S2HC 3GTQK 1XXCA 4O6MA 2DYRC 2KC3A 4BJ6C 1I5NA 2GSNA 4OINA 4E0HA 4ULVA 4FESA 3H65A 2GAQA 1K83C 5BQIA 5L3VA 3LAJA 2L81A 4E17A 1YX2A 1YJGA 4BJ5C 4JVSA 2Y69C 5M5XK 2B0JA 4MW3A 4Q7CA 4WJ0A 2AWYA 2FQTA 3BP3A 4WILA 4G7OF 4E18A 3TK0A 1R9TA 3G50A 5CI8A 2OKUA 3T9OA 2WVQA 1GS9A 2WZFA 2P61A 2NSFA 3CAGA 2J8WA 1WWPA 1OKKA 3JZ0A 2NVYK 4FX5A 3C62A 3S17C 4EHPA 4Z9HA 1ORSC 2R92A 1D0XA 3UNGC 5EK0A 3V5ZA 1G51A 3C7JA 1AEPA 4A3BK 2O5JA 3C18A 3EG9A 1EI6A 3SYNA 1D1AA 2WZLA 4PACA 3DAFA 3JSZA 2E2IC 5HSWA 4XEFA 4MQ9A 1RKCA 3AJMA 2XLMA 2CCYA 4A2NB 3POVA 4KDDA 3RW0A 4IARA 4LK0A 4RBNA 2GSOA 1JOGA 2P7VA 2G62A 2NUPA 1VYIA 3HXAA 4PJNA 1VGXA 3DI5A 5DVWA 4FAPB 4GTFA 4DOZA 2KGOA 4ZLCA 5IYDC 2O5IA 3EGDB 3S9OA 2ETSA 3AD9C 4HFFB 1WN0A 5L46A 2ZPAA 4I44A 4I1OB 4OIRF 3V5YA 2G3KA 4YL0A 1APCA 1WCMC 2OCCC 1CPRA 3S1RC 2R7XA 3DE9A 3GTLK 3U2LA 2P1AA 4NOIA 4A3CC 3QW0A 4Y52C 1B4AA 4BBRC 1VMAA 1QVXA 1VLTA 5IOSA 4OIPF 1VYKA 3O39A 2GAHC 4KN4A 4O6NA 4G7OA 1K83A 1M2OA 3DWWA 2ASRA 1AVOB 5KYYB 3DZAA 3GORA 3C63A 4A3GK 3EQLF 1MMNA 3EZHA 1YCLA 1TWCA 2E2HC 3AQCA 4JIOA 2A6HF 1TWHC 5C3EK 4AH6A 2YRFA 5A6BA 4IRUA 3C8GB 3ZVRA 1SFOK 4MVUA 3DAGA 4ZH4A 3GTKC 1CGNA 2J9VA 2PMZL 3AD7C 3RKOF 4C3JK 4KMDA 1BR4A 1JVIA 4A3IC 3SZRA 2P0NA 3W2VA 5IP7K 1FMWA 1PD1A 5E33A 1EQ1A 1NSGB 4UDVA 2V6TA 2L7AA 2NVQK 3T4RA 2E2JC 3GTOA 3S14C 1M57C 5F5HA 1M6TA 2JX0A 4J7YA 3FKIC 4E7ZA 3RQEA 1J8YF 4CS7A 4JEBA 3DE8A 4IB4A 2XM0A 2EIJC 2HS5A 1QPUA 5B3SC 2QY9A 4NTAA 4X6AC 3B0UX 1R9TC 4DRHB 1E84A 3Q6NA 2AVKA 2LP4A 2HMZA 4GEHA 4Q4ZF 5C44C 1OXKA 4P6IC 3GTLC 1CGME 5KYNA 4KC6A 2I15A 2JA7A 1ZHTA 1Y1VA 5E3CA 1VK5A 5L0JA 4BPMA 2Y3GA 3U3BA 4NQFA 4MS2A 3H3VL 3GTKK 3PDMP 1VTMP 5DS5A 2IBFA 1TWFA 2NPUA 5JRAA 5JP7A 3KMIA 3KYJA 1ZVUA 3G4CA 2L6GA 3GTPA 2NVYA 3AG2C 1YVIA 4A3BC 3S1QK 4XLPA 2TMVP 3ASOC 1ZQ1C 1FNTc 4KN7A 3JRTA 1FTSA 1OCRC 3K7DA 2XL6A 2ZUFA 2FFHA 2NVXK 5L0DA 2VCCA 3UMKA 1PCXA 2H7OA 3SXYA 1V54C 4ANJA 1E85A 1S05A 3FXHA 3SXKA 1BZ4A 1KNYA 1LE4A 3SXMA 1EKYA 1PJ5A 3DMDA 1OR2A 3HNKA 4QDLA 2R7ZC 3BEHA 1V4AA 2Q9CA 3NYJA 4YT5A 3N3YA 3I4MK 2KK1A 3AQOA 2IOQA 1WOPA 4R32A 3UMHA 2PA8D 1QLEC 2AP3A 1I3QC 2WVNA 1WIHA 2LFDA 2XLOA 4XPXA 2MWQA 4CJGA 5E2QA 4OIRA 1JPNA 3A8IA 1KU2A 3PMRA 3RVZA 4D4XA 2ICWG 1HE9A 3FOOA 2I8BA 2J7PD 5C4XK 4BXXK 2JD3A 2B63K 3AGUA 4DBQA 1ZBSA 4BJ5A 1NU7D 1WATA 1OKKD 1WOSA 4A3EC 2HMQA 1BDJB 1A0BA 5F28E 2ZFZA 2E2IA 1C17M 4F4BA 3QVYA 4AL1A 5FLMK 3UGOA 3L4KA 4K1OA 1O2AA 2XCQA 4BLBA 2A1DD 4E0IA 1NBBA 1O29A 2EIMC 3FVYA 4QIWL 2QE9A 3X1OA 4XLNA 3T02A 4GT9A 3PO3C 1JRAA 2G3VA 5EGYA 1YARO 1TWGK 4OD4A 2L6FA 3VAYA 5TMCA 3EHMA 3VYWA 4WABA 1OCCC 4IAQA 4Z9IA 1D1CA 4C3IK 3GTMA 5IYBK 1J6WA 3TULA 4QI0A 2WL8A 5C4JC 3U8PA 1K04A 5E68A 3ZWIA 2IXNA 1U0BB 3C8GD 4JURI 4A3IK 4K7BA 2JA8K 2CGEA 5C4XC 5A6KA 3NDBB 2HJ3A 4BLAA 4YWQA 3WHNA 2Y3BA 1C02A 1O28A 3U3FA 3GEEA 4U5EE 3GEIA 3GM3A 4LR2A 5D4DA 2VUMA 4C2MK 5COGA 3N0CA 3OEOA 1TFOB 4Z9JA 2E2JK 2IM8A 5T3TA 2YLGA 2A6EA 1YYJA 4BJ1A 5COMA 5A69A 3QW1A
chains in the Genus database with same CATH topology
5IORA 2CNWA 3MLGA 5IY5C 4FX5A 2EIKC 2LSEA 4YT2A 4YJWA 3LS1A 3AG1C 4M63A 3DM5A 3LAYA 1NG1A 1ZHWA 2NUTA 3SEOA 3OREA 3S29A 5EGEA 2R7WA 2R92A 1D0XA 3UNGC 2XSEA 3ECSA 3E70C 3K1HA 3B9QA 3EG9A 2YHSA 3SYNA 2W4MA 2R7TA 3K66A 1D1AA 2WZLA 2XRHA 3DAFA 3JSZA 4KATA 1JPJA 4EBBA 5HSWA 2XXAA 5CHPA 1RJ9A 1LVKA 4A2NB 4G7HF 3POVA 2BE5F 3SP1A 4KDDA 4KNVA 4KAWX 3KKBA 4KARA 4RBNA 2GSOA 3V4GA 2P5MA 2E87A 2P7VA 3T6JA 2G62A 2NUPA 2VB6A 1VYIA 3Q7LA 4PJNA 2VASA 3AH5A 5DVWA 1OCZC 3VA7A 5DS6A 4GTFA 4DOZA 3I4UA 2KGOA 2WZGA 3K6BA 2KWAA 1O87A 2J9WA 4ZLCA 1O26A 4FM9A 2M4EA 1M2VB 3EGDB 2ZXRA 2MYSA 2H7BA 1EH1A 4HFFB 5T3WA 3EFOA 4GTCA 5IOTA 2R7RA 2ZPAA 4I1OB 4FWVA 4I44A 4OIRF 5EGHA 5EHHA 1O5HA 2G3KA 2Q3TA 3GANA 4BJTA 1BR1A 3NKDA 3SNHA 3B0VC 2OCCC 3L34A 2XCRB 4CS8A 1D1BA 1GE9A 2R7XA 4CBEA 2J0WA 2QTVA 4P5BA 4QI2A 1O27A 4I1MA 4G0VA 4J32B 4KM9A 1B4AA 3ABMC 1VMAA 3AG3C 2WVOA 4RD9A 5IOSA 4OIPF 1VYKA 3O39A 3FDQA 4CS9A 2YEVA 3G4AA 4C7OB 4G0UA 3LNRA 4O6NA 1K83A 1M2OA 4JJFA 3UGPA 5KYYB 3DZAA 2D5RB 5KYXB 4O79A 2RGRA 2J7PA 3EJNA 4G7ZF 3ZSUA 3GTKA 3EQLF 3DXJF 1MMNA 3EZHA 5KYWB 1ZHYA 4GFQA 3UMIA 2YU9A 4PJJA 3S27A 1TWCA 2XL4A 3NG1A 3HJCA 4IAOA 3W2WA 3AQCA 4GTLA 2H7VC 2FGYA 2A6HF 1MMGA 4C3IC 4KI2A 2OG2A 2E2HA 2CDQA 4IJJA 2R7VA 2Y39A 2Q9AA 1SMYF 4IRUA 2VH3A 3ZVRA 3NUHA 4KM8A 3DAGA 3ZIBA 2J9VA 1BR2A 3EGXB 3ERED 3RKOF 1D0YA 1SZIA 3F46A 5FCLA 1BR4A 4KMDA 3EZIA 3GTQA 4J3NA 3SZRA 4YN0B 2DGJA 2KQ9A 1Y1WA 4PJLA 4AE4A 4BJ6A 3W2VA 1FMWA 1PD1A 5E33A 3ASNC 4XLPF 2XCOA 4LACB 1ZU5A 3T4RA 2ZXWC 4LLCA 1SFOA 5KYYA 3RFYA 1WQGA 3EGDA 3GTOA 3N2ZB 1M57C 5F5HA 3QZCA 4YT8A 2B63A 4CSAA 4E7ZA 1J8YF 2CFAA 4CS7A 1NU9C 2C04A 4DVZA 4K0DA 4OD5A 3NYMA 3CSKA 2EIJC 3HLZA 2ZXOA 2NUPB 2PP4A 3FAJA 1EK8A 5B3SC 2QY9A 3B0UX 5BUOA 3UR3C 3Q6NA 4EWCA 4GEHA 4Q4ZF 2CFAB 5CJ9A 1RJ9B 2YZSA 2XXAB 1M56C 4KB2A 2EILC 4P6IC 4GYTA 4PJMA 4YT4A 5KYNA 4KC6A 3EHNA 2W4BA 1W2WA 3DJUB 4G0WA 1LKXA 2JA7A 1ZHTA 2IYLD 4I3MA 1ZHZA 1Y1VA 3EFOB 5E3CA 1VK5A 3B0PA 2EINC 5IOQA 1TKNA 1B4BA 2KNHA 1M2VA 3EH1A 4KNWA 2A69F 5DQTA 4U5DE 1V55C 2Y3GA 2W45A 2PF4E 3JT1A 3CZ6A 2W9YA 1DD5A 4C2MC 4KC9A 4CS9C 1O24A 3LPXA 5DS5A 3NYLA 4Q5SF 1F9NA 2R7SA 3ABLC 2J0XA 3AQBA 4E7SA 1TWFA 3DJNB 2C03A 2Y3HA 5D91A 3BUEA 3X2QC 2A6EF 3DM9B 4W8KA 1Z63A 4AX2A 4DVYP 2WB7A 1FMVA 3KMIA 3W8IA 1ISEA 3OPFA 4MNDA 2CNWD 3RYLA 4HE8D 1TWGA 1ZVUA 4U5FE 4BG0A 3G4CA 3EH2A 3GTPA 5E3AA 2HV6A 4GTBA 3ZG1A 3AG2C 2NVYA 1KQ4A 2NUTB 4O6YA 3O6XA 1ST6A 4O7GA 4BEJA 1MNEA 4HEAJ 2HV7A 2IXPA 4XWJA 3ASOC 2PX3A 4GTDA 4JCHA 4XLNF 3JRTA 1FTSA 1OCRC 1ZXOA 4C3JC 4AE4B 4KBLA 3PHF2 2IXOA 3K7DA 3GTLA 3JCUQ 1BGWA 4N06A 1G8XA 4X0RA 3DD7A 2FFHA 4ZLDA 3ABKC 1BJTA 3EGXA 1I50A 3RIPA 4C7OA 3UMKA 1PCXA 2H7OA 4KMAA 4CIHA 2X51A 2GSUA 1V54C 1XXBA 2J45A 4ANJA 2R7ZA 4LERA 2NVXA 1ZHXA 5JVOA 3N24A 3FOEA 3N0BA 3RH3A 2PX0A 3FKIA 3L4JA 2P6VA 3S28A 3DMDA 4U5BE 3WODF 2J9UA 1IZMA 4QDLA 1MMAA 1J8MF 1Z23A 3QMKA 2R93A 4U5HA 2V3CC 2Q9CA 5DQZA 2CW0F 3NYJA 4YT5A 3S0XA 3WG7C 3FOFA 1WGWA 5KYWA 4LLEA 4FZBA 3N3YA 3AQOA 2ZXPA 4U5CE 2IOQA 2PFDA 2Q9BA 4M1XA 3LJBA 4OINF 3UMHA 3GTJA 5KYXA 2O9XA 3EPVA 4KMHA 1QLEC 4PFPA 3K33A 4ULWA 2WVNA 1WIHA 5KYUA 5D92A 2MWQA 5E2QA 1MNDA 4JW1A 2R7QA 1JPNA 1OCOC 5JFEA 1KU2A 3PMRA 1TR2A 3F47A 1TWAA 4OIQF 2V26A 4ILDA 5DLJA 4H4KC 2I8BA 2J7PD 5T1DB 3T6BA 4U5GA 1IW7F 3MX3A 1QZXA 2JD3A 3JYHA 5DS4A 1ZYRF 4DBQA 1ZBSA 4BJ5A 1NU7D 3EG9B 3KH2A 5CI9A 1XXAA 2R7UA 3OA1A 3N0TA 1OKKD 3QX3A 1ZU4A 2A68F 4HFKB 1MMDA 4BKWA 5B1BC 1SF8A 2ZFZA 3M1CB 4CSAC 3KL4A 2Y3DA 2E2IA 2IXMA 4F4BA 4IWBA 3AG4C 4JJGA 5L3QA 3LLKA 1D0ZA 4C3DA 2L9JA 2RH6A 1O2BA 2R7OA 3GTGA 3V7OA 3UGOA 1WQHA 3L4KA 1S7ZA 1PD0A 1O2AA 2XCQA 2KW3C 4BLBA 2A1DD 4MQ9F 3W8HA 3NKEA 2KJGA 5KYUB 3H0GA 3K1IC 4PFOA 1FFHA 1O29A 4DDQA 2EIMC 3FVYA 3X1OA 4NY3A 4C3BA 4KASA 4GTEA 4GT9A 1LS1A 4GTAA 4RDAA 1AB4A 3OEPA 4KB4A 3I5QA 3L0IA 2G3VA 5EGYA 1O25A 1Z6AA 2NG1A 4OD4A 3VAYA 3EHMA 3Q7GA 1IS1A 3LESA 3VYWA 4P5AA 1OCCC 4DBRA 2DYSC 2PHCB 1I3QA 3FHZA 1D1CA 3LAPA 3GTMA 4OIOF 4PK4A 2Y3PA 3TD7A 4XTKA 4JZAA 3LEVA 3IEEA 4QI0A 1XXCA 2JH3A 4O6MA 2WL8A 2J46A 2DYRC 4BJ6C 3Q3QA 4LQYA 5B1AC 3CQZA 3Q6MA 3ZC4A 2GSNA 3AQPA 2IXNA 3NRHA 4FESA 3H65A 3I5PA 1WQFA 4G0HA 4JURI 5L3VA 4K7BA 2JA5A 3LAJA 2CGEA 2Z15A 2L81A 3HTKC 1Z5ZA 3NDBB 1Z3IX 4BLAA 4YWQA 4BJ5C 2Y3BA 1O28A 4JVSA 1N1CA 1TWHA 4U5EE 2Y69C 5TJ3A 2B0JA 4Q7CA 4LR2A 3LLIA 4WJ0A 2VUMA 3GODA 4CS8C 3N0CA 1FFTC 3OEOA 4G7OF 1R9TA 5CI8A 2JA6A 4C3EA 4AK9A 4B6IA 1WCMA 2WVQA 5T3TA 1NZEA 2WZFA 5F5FA 3MMLB 2GFHA 4C3HC 3LS0A 3OWTA 3FHDA 3ITFA 3CAGA 1VOMA 4BJ1A 3E9VA 4J30B 1OKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0X A; 
#chains in the Genus database with same CATH topology
 3I4N K;  3GTO C;  4JK1 A;  5A6B D;  4M63 A;  1USM A;  1O3U A;  2R7Z K;  1ZHW A;  2NUT A;  3SEO A;  3ORE A;  4P9T A;  4BEM J;  3ECS A;  3E70 C;  2LD6 A;  2HZ8 A;  4KAT A;  5CHP A;  1RJ9 A;  1LVK A;  1HW2 A;  3TFJ A;  4BBS K;  256B A;  3T6G B;  1G5Z A;  4A3J K;  3V4G A;  4Q4Z A;  2P5M A;  2E87 A;  3T6J A;  3ZTM A;  1LI5 A;  3Q7L A;  3CQZ K;  2XLW A;  1OCZ C;  3VA7 A;  5DS6 A;  2XL8 A;  4A3G C;  1WOO A;  1M2V B;  4LJZ A;  4DRI B;  2OEV A;  4AYB L;  2R7R A;  5EGH A;  5EHH A;  3IPM O;  1VH2 A;  1BR1 A;  3SNH A;  5TMF A;  2XCR B;  1D1B A;  1EFW A;  2QTV A;  1OQC A;  2QLA A;  2DI3 A;  4QI2 A;  4G0V A;  1RU0 A;  3H0G C;  1C03 A;  1WCM K;  4A4A A;  3AG3 C;  3JSE O;  2GAG C;  4NC3 A;  1Q0F A;  1E86 A;  2OEX A;  4CS9 A;  1TWC K;  1Y4C A;  4C7O B;  4G0U A;  4BY7 K;  4RMF A;  3A11 A;  4A3C K;  4JJF A;  3IHU A;  1VRQ C;  3QVZ A;  3G4X A;  2D5R B;  1JMW A;  5COF A;  3ZSU A;  1IL2 A;  3GTK A;  3DXJ F;  1ZHY A;  3UMI A;  2R05 A;  4JE9 A;  4A3E K;  4PJJ A;  3LUT B;  2H7V C;  5L0G A;  4A93 C;  1MMG A;  4C3I C;  2E2H A;  2OG2 A;  2Y39 A;  2VH3 A;  5FCL A;  4G7Z A;  1WOR A;  3S17 K;  3GTQ A;  4N6H A;  3S1Q C;  2KQ9 A;  3ATP A;  4AE4 A;  5K0I A;  1XZP B;  1I3Q K;  3M15 A;  1GGQ A;  2XCO A;  4LAC B;  2JA5 K;  5BQH A;  2ZXW C;  1KTM A;  3TOL A;  4YFK A;  3GTM C;  4XSZ A;  4CDA A;  2B63 A;  4CSA A;  3GTQ C;  1Q0G A;  4K0D A;  3CSK A;  1Y1V C;  3FAJ A;  4H54 A;  2OOC A;  4L6R A;  1XZQ B;  3TOM A;  1DOV A;  4XPY A;  4JC7 A;  1NLX A;  2CFA B;  3HKZ L;  5CJ9 A;  2R92 K;  1CPQ A;  2EIL C;  3EHN A;  2W4B A;  1W2W A;  4G0W A;  1O2F B;  3ZQV A;  3RZO C;  1LKX A;  1R4T A;  2IYL D;  3EFO B;  3U9J A;  3PO2 C;  1TKN A;  3EH1 A;  2BL2 A;  2A69 F;  4U5D E;  1HQM A;  3LEO A;  2PF4 E;  3JT1 A;  3GWN A;  1XZQ A;  4Y7N C;  4CS9 C;  3LPX A;  4LDK A;  4Q5S F;  2J0X A;  2YL7 A;  3RZD K;  1X31 C;  2V6S A;  3X2Q C;  5TJ5 E;  3EQL A;  4YFN A;  3ZDL A;  4AX2 A;  2WB7 A;  2KSF A;  4MND A;  2CNW D;  4WGY A;  2LFF A;  3RYL A;  4HE8 D;  1TWG A;  4U5F E;  3EH2 A;  4GTB A;  1YLM A;  1KQ4 A;  4O6Y A;  1ST6 A;  3GEH A;  1T6I A;  2IXP A;  4XWJ A;  4JCH A;  4MVQ A;  4C3J C;  3A9C A;  4AE4 B;  2H8A A;  3PHF 2;  2R93 K;  1OW8 A;  2VCA A;  1BGW A;  3IQC A;  4ZLD A;  3ABK C;  3S16 C;  3MYI A;  5HV9 A;  1RKE B;  3J06 A;  4KMA A;  1WTY A;  4CIH A;  2X51 A;  2GSU A;  2R7Z A;  4LER A;  2NVT K;  3HOW C;  3S90 A;  3I4N C;  5JVO A;  3N24 A;  1Z7Q c;  3FOE A;  3N0B A;  1OW6 A;  3FKI A;  1T5O A;  2P6V A;  1L3P A;  3IQT A;  2YQY A;  4U5B E;  2J9U A;  1A7V A;  1Z23 A;  3SZY A;  2V3C C;  2AU5 A;  3S0X A;  3PO2 K;  4FZB A;  3HOV C;  1BBH A;  2UUI A;  2PFD A;  1ORJ A;  4M1X A;  1YDI A;  2VUM K;  2JA7 K;  4PFP A;  3K33 A;  4ULW A;  1TWA C;  5L0C A;  1I6H C;  1BS2 A;  2YLD A;  2YL3 A;  4LOW A;  2P8T A;  3US6 A;  1OR3 A;  4JW1 A;  3S1M K;  1OCO C;  5JFE A;  4WJ4 A;  1E2X A;  1L7C A;  4G7H A;  3G4Z A;  5T1D B;  3T6B A;  4U5G A;  2A6H A;  1BDF A;  5C44 K;  5L0I A;  1HI9 A;  3GTO K;  1I6H K;  5IP9 K;  2DB4 A;  3KH2 A;  5CI9 A;  2L6H A;  3U5S A;  1R9T K;  2VC9 A;  3N0T A;  4W8P A;  1SF8 A;  3HOZ K;  2Y3D A;  2XS8 A;  4IWB A;  1JR8 A;  3AG4 C;  4CDV A;  4OIQ A;  1D0Z A;  4C3D A;  2NVQ C;  2RH6 A;  3GTG A;  1WQH A;  1L0W A;  1RCP A;  2KW3 C;  4A3J C;  3W8H A;  2KJG A;  4PFO A;  1FFH A;  4BBR K;  1ZVZ A;  4NY3 A;  1Q0K A;  4GTE A;  4JTC B;  4CIP A;  5FLM C;  4RDA A;  3S16 K;  3GTP K;  1T6Q A;  1A41 A;  3I4M C;  4JEA A;  4QIW D;  1YA7 O;  4MVS A;  4OIO F;  4MTO A;  3HOX K;  1I50 K;  4JZA A;  4Y7N K;  1TWC C;  3S15 K;  1F1M A;  2HJM A;  1MQV A;  3Q3Q A;  1ZW3 A;  3JST A;  5B1A C;  2Y0S L;  3CQZ A;  3ZC4 A;  3RQG A;  2AWC A;  4KMU A;  1NFO A;  3AQP A;  3NRH A;  2YL0 A;  1WQF A;  4PAA A;  4U9E A;  1U6H A;  2Z15 A;  3HTK C;  1Z5Z A;  2R92 C;  1Z3I X;  3RF3 A;  2PBE A;  5TJ3 A;  4MVM A;  3LLI A;  3HOX C;  3GOD A;  4CS8 C;  3M4O C;  1TQG A;  2JA6 A;  2YU9 C;  4AK9 A;  4B6I A;  1RKE A;  1NZE A;  5F5F A;  4C3H C;  2GFH A;  5C4J K;  3ITF A;  4CJO A;  1VOM A;  4J30 B;  3GSI A;  1IE0 A;  5IY5 C;  1F7V A;  2EIK C;  2LSE A;  4YJW A;  3AG1 C;  3DM5 A;  5EGE A;  4MEY A;  2HUJ A;  1UV7 A;  2YU9 K;  2XSE A;  3IPJ A;  4GZY A;  3K66 A;  4J7T A;  1JPJ A;  2XXA A;  4YFX A;  1WOL A;  2ZD9 A;  3JRM O;  3RVY A;  4G7H F;  2BE5 F;  4KAW X;  1QQ3 A;  3KKB A;  4KAR A;  3TFI A;  2VB6 A;  1H7I A;  2FAP B;  3S1N C;  3AH5 A;  5CIV A;  4DRJ B;  1I50 C;  2NSG A;  1SYQ A;  2FQO A;  3I4U A;  2WZG A;  3S1R K;  2KWA A;  1EH1 A;  4XEV A;  5IOT A;  4EUK B;  4FWV A;  3GTM K;  2PNO A;  1ZYR A;  2LK4 A;  3B29 A;  3AD8 C;  3GTP C;  2Q3T A;  3GAN A;  3L8I A;  4BJT A;  1YAU O;  3IQ5 A;  3NKD A;  1DCP A;  2B63 C;  4NTB A;  4P5B A;  4I1M A;  1J6X A;  1PJ6 A;  1YNJ A;  4KM9 A;  5M3M K;  1TWF C;  3ABM C;  2D6F C;  2WVO A;  4YL1 A;  4YG2 A;  2EPM X;  4RD9 A;  4XCH A;  2YEV A;  3GIR A;  3G4A A;  3LNR A;  3RZD C;  4O79 A;  2RGR A;  3EJN A;  3S84 A;  4G7Z F;  5KYW B;  2YU9 A;  4GFQ A;  3QTH A;  2XL4 A;  4LK1 A;  5AGF A;  1YYX A;  3PO3 K;  2FGY A;  3T01 A;  3HOY C;  3VRC A;  4KI2 A;  2CDQ A;  4IJJ A;  2Q9A A;  1SMY F;  3C8G A;  1OW7 A;  1BR2 A;  3ERE D;  2WAQ D;  1SZI A;  3F46 A;  3EZI A;  3CQZ C;  1ORY A;  2DGJ A;  3HOY K;  1SFO C;  1V74 B;  3VF0 A;  1AUE A;  2A0B A;  1XPP A;  5L0F A;  3ASN C;  1OXB A;  1ZU5 A;  3HNL A;  3JYY A;  3U8V A;  5KYY A;  1WQG A;  1I4Y A;  3EGD A;  5IYD K;  3N2Z B;  3RQF A;  4YT8 A;  1F7U A;  2CFA A;  1NU9 C;  4DVZ A;  3HKZ D;  3VM6 A;  3M3Y K;  5BUO A;  3UR3 C;  1LM3 B;  2YZS A;  3WOD A;  1M56 C;  4KB2 A;  3HOU C;  4GYT A;  5IP7 C;  4PJM A;  3LNM B;  3DJU B;  4NTF A;  5IYC C;  4I3M A;  1ZHZ A;  3GM2 A;  1J98 A;  3B0P A;  5IOQ A;  1M2V A;  2WB1 L;  2JPU A;  1T01 A;  1PV3 A;  2YWA A;  2OJE D;  2W9Y A;  1DD5 A;  1O24 A;  1TWA K;  1F9N A;  2R7S A;  3AQB A;  4E7S A;  3DJN B;  2C03 A;  1QKR A;  2Y3H A;  3BUE A;  2A6E F;  3DM9 B;  4W8K A;  3CEX A;  5JVE A;  1INN A;  4DVY P;  1RMV A;  3W8I A;  1LIH A;  2OU6 A;  5M3F K;  4BG0 A;  1A7D A;  2XLV A;  4O7G A;  5BQG A;  4BEJ A;  2PA8 L;  3GM1 A;  1MNE A;  3NMJ A;  2HV7 A;  2PMZ D;  4LDQ A;  1WSR A;  1VJE A;  4KBL A;  2D4U A;  2Y0S D;  4PAB A;  3HNJ A;  3GTL A;  4A3K C;  4N06 A;  1G8X A;  4X0R A;  3DD7 A;  1BJT A;  3EGX A;  3RIP A;  3MBG A;  1Y6D A;  4N6C A;  4LLG A;  1RXQ A;  3MYF A;  1XXB A;  2J45 A;  2R93 C;  3PCV A;  5FZT A;  1ZHX A;  2NVY C;  1I6V A;  3R2P A;  3RH3 A;  5C3E C;  3L4J A;  2YVK A;  3S28 A;  4JRZ A;  1IZM A;  3QMK A;  1WSV A;  4N4W A;  2E2H K;  2CW0 F;  5KYW A;  1SMY A;  4U5C E;  2Q9B A;  3LJB A;  4A3D K;  4OIN F;  4XQ1 A;  5KYX A;  3M4O K;  3EPV A;  1VLO A;  4KMH A;  2A69 A;  4MVZ A;  2R7Q A;  5JUA A;  5FJ8 K;  3DXJ A;  5JLI A;  1TR2 A;  1JAF A;  3F47 A;  2GWW A;  1TWA A;  4OIQ F;  2LCH A;  3SZZ A;  2WB1 D;  2V26 A;  5DLJ A;  2MHR A;  3MX3 A;  2EPN A;  1QZX A;  3K1I A;  3JYH A;  5A6A A;  5AC4 A;  3H3V D;  3M79 A;  3B71 A;  4C45 A;  3EG9 B;  4C3H K;  3GTG C;  4AL0 A;  1EQR A;  3C8Z A;  2R7U A;  3OA1 A;  2A68 F;  1MMD A;  4HFK B;  4YK5 A;  3S2D C;  5B1B C;  3M1C B;  4CSA C;  2IXM A;  1Y1W K;  4JJG A;  5L3Q A;  4ONS A;  1GQA A;  3TFH A;  1O2B A;  3V7O A;  3U0C A;  1S7Z A;  1PD0 A;  4WGZ A;  2OQM A;  4MQ9 F;  5KYU B;  3NKE A;  2HFI A;  4XEK A;  4BY1 C;  4DDQ A;  4CDY A;  5IYC K;  1LPE A;  4A3K K;  4C3B A;  1LS1 A;  2GA0 A;  3WAQ A;  1ZZP A;  4KB4 A;  3HOU K;  1HMD A;  3L0I A;  4X6A K;  1Z6A A;  5GPG B;  1IS1 A;  4P5A A;  2A0U A;  2LIG A;  2PHC B;  3FHZ A;  3LAP A;  3H2U A;  3K7A K;  4PK4 A;  2Y3P A;  3TD7 A;  1FR0 A;  4XTK A;  4MVR A;  2KYH A;  3LEV A;  3IEE A;  2JH3 A;  1B68 A;  2J46 A;  3A8K A;  3FAP B;  1YNN A;  2M64 A;  4LQY A;  3Q6M A;  4IGG A;  4A3M C;  5M5Y K;  3I5P A;  1T9K A;  4EBK A;  3H0G K;  4G0H A;  2JA5 A;  2CW0 A;  5M5W K;  1N1C A;  1G4W R;  1TWH A;  2OJQ A;  1YA9 A;  5IYB C;  2HKV A;  2R02 A;  3GTJ K;  1FFT C;  4C3E A;  3TQO A;  1WCM A;  3MML B;  3KYI A;  2R9R B;  3HNI A;  3LS0 A;  3OWT A;  3FHD A;  2J9B A;  4DXW A;  4Q5S A;  1SR2 A;  3E9V A;  2BE5 A;  3BP8 C;  2JA6 C;  2EPL X;  5IOR A;  2CNW A;  3MLG A;  4MW8 A;  3KPH A;  4JKV A;  4YT2 A;  3LS1 A;  3GTJ C;  3LAY A;  1NG1 A;  3S29 A;  2R7W A;  2B0H A;  3K1H A;  3M4C A;  1H9T A;  3S14 K;  1F93 A;  3B9Q A;  2R7T A;  2YHS A;  2W4M A;  1K40 A;  2XRH A;  4EBB A;  4PR9 A;  5JT4 A;  1J6V A;  5JS5 A;  3SP1 A;  1WAS A;  4KNV A;  1USO A;  2RD9 A;  2YLI A;  2XS1 A;  2VAS A;  2HSB A;  1Q0M A;  3K6B A;  1O87 A;  2J9W A;  2PPB A;  1O26 A;  4FM9 A;  2M4E A;  4BXX C;  2ZXR A;  4NCQ A;  1HE1 A;  2H7B A;  2MYS A;  5T3W A;  2NVT C;  3EFO A;  1HW1 A;  4GTC A;  4EBJ A;  1TWH K;  3HOZ C;  1O5H A;  1IQ0 A;  3B0V C;  3S1N K;  3L34 A;  4CS8 A;  4WJ3 M;  2Q4F A;  4JTA B;  1GE9 A;  3T00 A;  4CBE A;  2J0W A;  1O27 A;  4J32 B;  1GM5 A;  2XLE A;  1YZC A;  3FDQ A;  1Y1V K;  3O10 A;  3DKA A;  4XPW A;  3AOU A;  3UGP A;  2F22 A;  3S1M C;  2JA8 C;  5KYX B;  3IQ6 A;  2QUP A;  4JTD B;  2J7P A;  1XWJ A;  2GDC A;  3CAX A;  2JA7 C;  3S27 A;  1LE2 A;  3NG1 A;  3HJC A;  4IAO A;  1HMO A;  3W2W A;  2VUM C;  4GTL A;  4YL3 A;  5JSL A;  3K7A C;  3ZQY A;  2R03 A;  3U9M A;  2R7V A;  2EPO A;  3NUH A;  4KM8 A;  2JA5 C;  1VLS A;  3ZIB A;  1UFB A;  3EGX B;  1D0Y A;  2R25 A;  4J3N A;  4YN0 B;  1Y1W A;  3W4Y A;  4PJL A;  4BJ6 A;  1V5V A;  1JOE A;  4XLP F;  2Q00 A;  4LLC A;  1SFO A;  4A3M K;  3RFY A;  1HY5 A;  3FMS A;  1Y1W C;  2Q7R A;  3QZC A;  2LQG A;  2C04 A;  3JTL O;  4OD5 A;  4P9S A;  4GQH A;  3NYM A;  4D4N A;  4A3L K;  2HSQ A;  3HLZ A;  3L8J A;  3A8J A;  2ZXO A;  2NUP B;  4AYB D;  2PP4 A;  1EK8 A;  3GTG K;  4ER9 A;  4DJ9 A;  4EWC A;  3MFN A;  3H2V A;  1EI7 A;  1RJ9 B;  2XXA B;  2RSE B;  1UG7 A;  1IBA A;  4YT4 A;  3ADA C;  2A68 A;  1K83 K;  4JCZ A;  2EIN C;  3S15 C;  2XM4 A;  1B4B A;  2KNH A;  4A93 K;  4KNW A;  3TTG A;  5DQT A;  1XZP A;  1H9G A;  1V55 C;  5L0H A;  4BY1 K;  2W45 A;  3FKI K;  4CX9 A;  2JA6 K;  3CZ6 A;  5A6J A;  4C2M C;  4KC9 A;  3R7C A;  3NYL A;  3ABL C;  5D91 A;  1Z63 A;  4OIO A;  2V6U A;  2VCB A;  1FMV A;  4MTF A;  1ISE A;  3OPF A;  1U89 A;  3V5X A;  5E3A A;  2HV6 A;  3ZG1 A;  3HKK A;  2NVX C;  2NUT B;  3BRJ A;  3O6X A;  4XSX A;  4HEA J;  2YL1 A;  3TJ5 A;  2PX3 A;  2X0C A;  4GTD A;  4XLN F;  1VB5 A;  1ZXO A;  1LS4 A;  3AGT A;  1G4U S;  2XLD A;  3O55 A;  2IXO A;  3M4B A;  3JCU Q;  1I50 A;  4C7O A;  4OIP A;  1NFN A;  1QSP A;  3NMI A;  4O2D A;  2NVX A;  1Q0D A;  4MTG A;  2YKZ A;  4G78 A;  5IP9 C;  2CYD A;  3HOV K;  3FOP A;  2XLH A;  2PX0 A;  1TWG C;  3SXZ A;  1E83 A;  3U2M A;  4A3D C;  2ZUE A;  1EA8 A;  3WOD F;  4A3F C;  3S2H K;  2R93 A;  1MMA A;  1J8M F;  3ZTZ A;  4U5H A;  1C0A A;  5DQZ A;  3FOF A;  3WG7 C;  1WGW A;  4LLE A;  2ZXP A;  1R5I D;  2WAQ L;  3GTJ A;  2O9X A;  2EBB A;  1DCH A;  5KYU A;  5D92 A;  4U9D A;  1TWF K;  1K05 A;  1T6U A;  1MND A;  4P9F A;  4EIY A;  1TFK B;  1I4Z A;  1DOW A;  4BY7 C;  4A3L C;  1IW7 A;  5B3I A;  4ILD A;  4H4K C;  3GDZ A;  3NMK A;  1IW7 F;  4EKW A;  4QJV B;  5DS4 A;  1ZYR F;  1DCO A;  1XXA A;  3QX3 A;  1ZU4 A;  1H6G A;  2UUH A;  4BKW A;  3KL4 A;  3RZO K;  3GWL A;  2E2I K;  3LLK A;  2L9J A;  3HOW K;  2R7O A;  3TJ6 A;  5AC5 A;  4MEX A;  3H0G A;  2W7V A;  3K1I C;  4KAS A;  1FAP B;  3L1M A;  1PJ7 A;  4GTA A;  1ZW2 A;  1AB4 A;  3OEP A;  3I5Q A;  4BBS C;  1O25 A;  4MVO A;  2NG1 A;  5HL8 A;  1CGO A;  4Y52 K;  3Q7G A;  3LES A;  1A7E A;  4QJV A;  1YZA A;  3S2D K;  1LI7 A;  4DBR A;  2DYS C;  2BC5 A;  4LDR A;  1JQW A;  1I3Q A;  3M3Y C;  2QNL A;  2EPK X;  4A3F K;  3S2H C;  3GTQ K;  1XXC A;  4O6M A;  2DYR C;  2KC3 A;  4BJ6 C;  1I5N A;  2GSN A;  4OIN A;  4E0H A;  4ULV A;  4FES A;  3H65 A;  2GAQ A;  1K83 C;  5BQI A;  5L3V A;  3LAJ A;  2L81 A;  4E17 A;  1YX2 A;  1YJG A;  4BJ5 C;  4JVS A;  2Y69 C;  5M5X K;  2B0J A;  4MW3 A;  4Q7C A;  4WJ0 A;  2AWY A;  2FQT A;  3BP3 A;  4WIL A;  4G7O F;  4E18 A;  3TK0 A;  1R9T A;  3G50 A;  5CI8 A;  2OKU A;  3T9O A;  2WVQ A;  1GS9 A;  2WZF A;  2P61 A;  2NSF A;  3CAG A;  2J8W A;  1WWP A;  1OKK A;  3JZ0 A;  2NVY K;  4FX5 A;  3C62 A;  3S17 C;  4EHP A;  4Z9H A;  1ORS C;  2R92 A;  1D0X A;  3UNG C;  5EK0 A;  3V5Z A;  1G51 A;  3C7J A;  1AEP A;  4A3B K;  2O5J A;  3C18 A;  3EG9 A;  1EI6 A;  3SYN A;  1D1A A;  2WZL A;  4PAC A;  3DAF A;  3JSZ A;  2E2I C;  5HSW A;  4XEF A;  4MQ9 A;  1RKC A;  3AJM A;  2XLM A;  2CCY A;  4A2N B;  3POV A;  4KDD A;  3RW0 A;  4IAR A;  4LK0 A;  4RBN A;  2GSO A;  1JOG A;  2P7V A;  2G62 A;  2NUP A;  1VYI A;  3HXA A;  4PJN A;  1VGX A;  3DI5 A;  5DVW A;  4FAP B;  4GTF A;  4DOZ A;  2KGO A;  4ZLC A;  5IYD C;  2O5I A;  3EGD B;  3S9O A;  2ETS A;  3AD9 C;  4HFF B;  1WN0 A;  5L46 A;  2ZPA A;  4I44 A;  4I1O B;  4OIR F;  3V5Y A;  2G3K A;  4YL0 A;  1APC A;  1WCM C;  2OCC C;  1CPR A;  3S1R C;  2R7X A;  3DE9 A;  3GTL K;  3U2L A;  2P1A A;  4NOI A;  4A3C C;  3QW0 A;  4Y52 C;  1B4A A;  4BBR C;  1VMA A;  1QVX A;  1VLT A;  5IOS A;  4OIP F;  1VYK A;  3O39 A;  2GAH C;  4KN4 A;  4O6N A;  4G7O A;  1K83 A;  1M2O A;  3DWW A;  2ASR A;  1AVO B;  5KYY B;  3DZA A;  3GOR A;  3C63 A;  4A3G K;  3EQL F;  1MMN A;  3EZH A;  1YCL A;  1TWC A;  2E2H C;  3AQC A;  4JIO A;  2A6H F;  1TWH C;  5C3E K;  4AH6 A;  2YRF A;  5A6B A;  4IRU A;  3C8G B;  3ZVR A;  1SFO K;  4MVU A;  3DAG A;  4ZH4 A;  3GTK C;  1CGN A;  2J9V A;  2PMZ L;  3AD7 C;  3RKO F;  4C3J K;  4KMD A;  1BR4 A;  1JVI A;  4A3I C;  3SZR A;  2P0N A;  3W2V A;  5IP7 K;  1FMW A;  1PD1 A;  5E33 A;  1EQ1 A;  1NSG B;  4UDV A;  2V6T A;  2L7A A;  2NVQ K;  3T4R A;  2E2J C;  3GTO A;  3S14 C;  1M57 C;  5F5H A;  1M6T A;  2JX0 A;  4J7Y A;  3FKI C;  4E7Z A;  3RQE A;  1J8Y F;  4CS7 A;  4JEB A;  3DE8 A;  4IB4 A;  2XM0 A;  2EIJ C;  2HS5 A;  1QPU A;  5B3S C;  2QY9 A;  4NTA A;  4X6A C;  3B0U X;  1R9T C;  4DRH B;  1E84 A;  3Q6N A;  2AVK A;  2LP4 A;  2HMZ A;  4GEH A;  4Q4Z F;  5C44 C;  1OXK A;  4P6I C;  3GTL C;  1CGM E;  5KYN A;  4KC6 A;  2I15 A;  2JA7 A;  1ZHT A;  1Y1V A;  5E3C A;  1VK5 A;  5L0J A;  4BPM A;  2Y3G A;  3U3B A;  4NQF A;  4MS2 A;  3H3V L;  3GTK K;  3PDM P;  1VTM P;  5DS5 A;  2IBF A;  1TWF A;  2NPU A;  5JRA A;  5JP7 A;  3KMI A;  3KYJ A;  1ZVU A;  3G4C A;  2L6G A;  3GTP A;  2NVY A;  3AG2 C;  1YVI A;  4A3B C;  3S1Q K;  4XLP A;  2TMV P;  3ASO C;  1ZQ1 C;  1FNT c;  4KN7 A;  3JRT A;  1FTS A;  1OCR C;  3K7D A;  2XL6 A;  2ZUF A;  2FFH A;  2NVX K;  5L0D A;  2VCC A;  3UMK A;  1PCX A;  2H7O A;  3SXY A;  1V54 C;  4ANJ A;  1E85 A;  1S05 A;  3FXH A;  3SXK A;  1BZ4 A;  1KNY A;  1LE4 A;  3SXM A;  1EKY A;  1PJ5 A;  3DMD A;  1OR2 A;  3HNK A;  4QDL A;  2R7Z C;  3BEH A;  1V4A A;  2Q9C A;  3NYJ A;  4YT5 A;  3N3Y A;  3I4M K;  2KK1 A;  3AQO A;  2IOQ A;  1WOP A;  4R32 A;  3UMH A;  2PA8 D;  1QLE C;  2AP3 A;  1I3Q C;  2WVN A;  1WIH A;  2LFD A;  2XLO A;  4XPX A;  2MWQ A;  4CJG A;  5E2Q A;  4OIR A;  1JPN A;  3A8I A;  1KU2 A;  3PMR A;  3RVZ A;  4D4X A;  2ICW G;  1HE9 A;  3FOO A;  2I8B A;  2J7P D;  5C4X K;  4BXX K;  2JD3 A;  2B63 K;  3AGU A;  4DBQ A;  1ZBS A;  4BJ5 A;  1NU7 D;  1WAT A;  1OKK D;  1WOS A;  4A3E C;  2HMQ A;  1BDJ B;  1A0B A;  5F28 E;  2ZFZ A;  2E2I A;  1C17 M;  4F4B A;  3QVY A;  4AL1 A;  5FLM K;  3UGO A;  3L4K A;  4K1O A;  1O2A A;  2XCQ A;  4BLB A;  2A1D D;  4E0I A;  1NBB A;  1O29 A;  2EIM C;  3FVY A;  4QIW L;  2QE9 A;  3X1O A;  4XLN A;  3T02 A;  4GT9 A;  3PO3 C;  1JRA A;  2G3V A;  5EGY A;  1YAR O;  1TWG K;  4OD4 A;  2L6F A;  3VAY A;  5TMC A;  3EHM A;  3VYW A;  4WAB A;  1OCC C;  4IAQ A;  4Z9I A;  1D1C A;  4C3I K;  3GTM A;  5IYB K;  1J6W A;  3TUL A;  4QI0 A;  2WL8 A;  5C4J C;  3U8P A;  1K04 A;  5E68 A;  3ZWI A;  2IXN A;  1U0B B;  3C8G D;  4JUR I;  4A3I K;  4K7B A;  2JA8 K;  2CGE A;  5C4X C;  5A6K A;  3NDB B;  2HJ3 A;  4BLA A;  4YWQ A;  3WHN A;  2Y3B A;  1C02 A;  1O28 A;  3U3F A;  3GEE A;  4U5E E;  3GEI A;  3GM3 A;  4LR2 A;  5D4D A;  2VUM A;  4C2M K;  5COG A;  3N0C A;  3OEO A;  1TFO B;  4Z9J A;  2E2J K;  2IM8 A;  5T3T A;  2YLG A;  2A6E A;  1YYJ A;  4BJ1 A;  5COM A;  5A69 A;  3QW1 A; 
#chains in the Genus database with same CATH homology
 5IOR A;  2CNW A;  3MLG A;  5IY5 C;  4FX5 A;  2EIK C;  2LSE A;  4YT2 A;  4YJW A;  3LS1 A;  3AG1 C;  4M63 A;  3DM5 A;  3LAY A;  1NG1 A;  1ZHW A;  2NUT A;  3SEO A;  3ORE A;  3S29 A;  5EGE A;  2R7W A;  2R92 A;  1D0X A;  3UNG C;  2XSE A;  3ECS A;  3E70 C;  3K1H A;  3B9Q A;  3EG9 A;  2YHS A;  3SYN A;  2W4M A;  2R7T A;  3K66 A;  1D1A A;  2WZL A;  2XRH A;  3DAF A;  3JSZ A;  4KAT A;  1JPJ A;  4EBB A;  5HSW A;  2XXA A;  5CHP A;  1RJ9 A;  1LVK A;  4A2N B;  4G7H F;  3POV A;  2BE5 F;  3SP1 A;  4KDD A;  4KNV A;  4KAW X;  3KKB A;  4KAR A;  4RBN A;  2GSO A;  3V4G A;  2P5M A;  2E87 A;  2P7V A;  3T6J A;  2G62 A;  2NUP A;  2VB6 A;  1VYI A;  3Q7L A;  4PJN A;  2VAS A;  3AH5 A;  5DVW A;  1OCZ C;  3VA7 A;  5DS6 A;  4GTF A;  4DOZ A;  3I4U A;  2KGO A;  2WZG A;  3K6B A;  2KWA A;  1O87 A;  2J9W A;  4ZLC A;  1O26 A;  4FM9 A;  2M4E A;  1M2V B;  3EGD B;  2ZXR A;  2MYS A;  2H7B A;  1EH1 A;  4HFF B;  5T3W A;  3EFO A;  4GTC A;  5IOT A;  2R7R A;  2ZPA A;  4I1O B;  4FWV A;  4I44 A;  4OIR F;  5EGH A;  5EHH A;  1O5H A;  2G3K A;  2Q3T A;  3GAN A;  4BJT A;  1BR1 A;  3NKD A;  3SNH A;  3B0V C;  2OCC C;  3L34 A;  2XCR B;  4CS8 A;  1D1B A;  1GE9 A;  2R7X A;  4CBE A;  2J0W A;  2QTV A;  4P5B A;  4QI2 A;  1O27 A;  4I1M A;  4G0V A;  4J32 B;  4KM9 A;  1B4A A;  3ABM C;  1VMA A;  3AG3 C;  2WVO A;  4RD9 A;  5IOS A;  4OIP F;  1VYK A;  3O39 A;  3FDQ A;  4CS9 A;  2YEV A;  3G4A A;  4C7O B;  4G0U A;  3LNR A;  4O6N A;  1K83 A;  1M2O A;  4JJF A;  3UGP A;  5KYY B;  3DZA A;  2D5R B;  5KYX B;  4O79 A;  2RGR A;  2J7P A;  3EJN A;  4G7Z F;  3ZSU A;  3GTK A;  3EQL F;  3DXJ F;  1MMN A;  3EZH A;  5KYW B;  1ZHY A;  4GFQ A;  3UMI A;  2YU9 A;  4PJJ A;  3S27 A;  1TWC A;  2XL4 A;  3NG1 A;  3HJC A;  4IAO A;  3W2W A;  3AQC A;  4GTL A;  2H7V C;  2FGY A;  2A6H F;  1MMG A;  4C3I C;  4KI2 A;  2OG2 A;  2E2H A;  2CDQ A;  4IJJ A;  2R7V A;  2Y39 A;  2Q9A A;  1SMY F;  4IRU A;  2VH3 A;  3ZVR A;  3NUH A;  4KM8 A;  3DAG A;  3ZIB A;  2J9V A;  1BR2 A;  3EGX B;  3ERE D;  3RKO F;  1D0Y A;  1SZI A;  3F46 A;  5FCL A;  1BR4 A;  4KMD A;  3EZI A;  3GTQ A;  4J3N A;  3SZR A;  4YN0 B;  2DGJ A;  2KQ9 A;  1Y1W A;  4PJL A;  4AE4 A;  4BJ6 A;  3W2V A;  1FMW A;  1PD1 A;  5E33 A;  3ASN C;  4XLP F;  2XCO A;  4LAC B;  1ZU5 A;  3T4R A;  2ZXW C;  4LLC A;  1SFO A;  5KYY A;  3RFY A;  1WQG A;  3EGD A;  3GTO A;  3N2Z B;  1M57 C;  5F5H A;  3QZC A;  4YT8 A;  2B63 A;  4CSA A;  4E7Z A;  1J8Y F;  2CFA A;  4CS7 A;  1NU9 C;  2C04 A;  4DVZ A;  4K0D A;  4OD5 A;  3NYM A;  3CSK A;  2EIJ C;  3HLZ A;  2ZXO A;  2NUP B;  2PP4 A;  3FAJ A;  1EK8 A;  5B3S C;  2QY9 A;  3B0U X;  5BUO A;  3UR3 C;  3Q6N A;  4EWC A;  4GEH A;  4Q4Z F;  2CFA B;  5CJ9 A;  1RJ9 B;  2YZS A;  2XXA B;  1M56 C;  4KB2 A;  2EIL C;  4P6I C;  4GYT A;  4PJM A;  4YT4 A;  5KYN A;  4KC6 A;  3EHN A;  2W4B A;  1W2W A;  3DJU B;  4G0W A;  1LKX A;  2JA7 A;  1ZHT A;  2IYL D;  4I3M A;  1ZHZ A;  1Y1V A;  3EFO B;  5E3C A;  1VK5 A;  3B0P A;  2EIN C;  5IOQ A;  1TKN A;  1B4B A;  2KNH A;  1M2V A;  3EH1 A;  4KNW A;  2A69 F;  5DQT A;  4U5D E;  1V55 C;  2Y3G A;  2W45 A;  2PF4 E;  3JT1 A;  3CZ6 A;  2W9Y A;  1DD5 A;  4C2M C;  4KC9 A;  4CS9 C;  1O24 A;  3LPX A;  5DS5 A;  3NYL A;  4Q5S F;  1F9N A;  2R7S A;  3ABL C;  2J0X A;  3AQB A;  4E7S A;  1TWF A;  3DJN B;  2C03 A;  2Y3H A;  5D91 A;  3BUE A;  3X2Q C;  2A6E F;  3DM9 B;  4W8K A;  1Z63 A;  4AX2 A;  4DVY P;  2WB7 A;  1FMV A;  3KMI A;  3W8I A;  1ISE A;  3OPF A;  4MND A;  2CNW D;  3RYL A;  4HE8 D;  1TWG A;  1ZVU A;  4U5F E;  4BG0 A;  3G4C A;  3EH2 A;  3GTP A;  5E3A A;  2HV6 A;  4GTB A;  3ZG1 A;  3AG2 C;  2NVY A;  1KQ4 A;  2NUT B;  4O6Y A;  3O6X A;  1ST6 A;  4O7G A;  4BEJ A;  1MNE A;  4HEA J;  2HV7 A;  2IXP A;  4XWJ A;  3ASO C;  2PX3 A;  4GTD A;  4JCH A;  4XLN F;  3JRT A;  1FTS A;  1OCR C;  1ZXO A;  4C3J C;  4AE4 B;  4KBL A;  3PHF 2;  2IXO A;  3K7D A;  3GTL A;  3JCU Q;  1BGW A;  4N06 A;  1G8X A;  4X0R A;  3DD7 A;  2FFH A;  4ZLD A;  3ABK C;  1BJT A;  3EGX A;  1I50 A;  3RIP A;  4C7O A;  3UMK A;  1PCX A;  2H7O A;  4KMA A;  4CIH A;  2X51 A;  2GSU A;  1V54 C;  1XXB A;  2J45 A;  4ANJ A;  2R7Z A;  4LER A;  2NVX A;  1ZHX A;  5JVO A;  3N24 A;  3FOE A;  3N0B A;  3RH3 A;  2PX0 A;  3FKI A;  3L4J A;  2P6V A;  3S28 A;  3DMD A;  4U5B E;  3WOD F;  2J9U A;  1IZM A;  4QDL A;  1MMA A;  1J8M F;  1Z23 A;  3QMK A;  2R93 A;  4U5H A;  2V3C C;  2Q9C A;  5DQZ A;  2CW0 F;  3NYJ A;  4YT5 A;  3S0X A;  3WG7 C;  3FOF A;  1WGW A;  5KYW A;  4LLE A;  4FZB A;  3N3Y A;  3AQO A;  2ZXP A;  4U5C E;  2IOQ A;  2PFD A;  2Q9B A;  4M1X A;  3LJB A;  4OIN F;  3UMH A;  3GTJ A;  5KYX A;  2O9X A;  3EPV A;  4KMH A;  1QLE C;  4PFP A;  3K33 A;  4ULW A;  2WVN A;  1WIH A;  5KYU A;  5D92 A;  2MWQ A;  5E2Q A;  1MND A;  4JW1 A;  2R7Q A;  1JPN A;  1OCO C;  5JFE A;  1KU2 A;  3PMR A;  1TR2 A;  3F47 A;  1TWA A;  4OIQ F;  2V26 A;  4ILD A;  5DLJ A;  4H4K C;  2I8B A;  2J7P D;  5T1D B;  3T6B A;  4U5G A;  1IW7 F;  3MX3 A;  1QZX A;  2JD3 A;  3JYH A;  5DS4 A;  1ZYR F;  4DBQ A;  1ZBS A;  4BJ5 A;  1NU7 D;  3EG9 B;  3KH2 A;  5CI9 A;  1XXA A;  2R7U A;  3OA1 A;  3N0T A;  1OKK D;  3QX3 A;  1ZU4 A;  2A68 F;  4HFK B;  1MMD A;  4BKW A;  5B1B C;  1SF8 A;  2ZFZ A;  3M1C B;  4CSA C;  3KL4 A;  2Y3D A;  2E2I A;  2IXM A;  4F4B A;  4IWB A;  3AG4 C;  4JJG A;  5L3Q A;  3LLK A;  1D0Z A;  4C3D A;  2L9J A;  2RH6 A;  1O2B A;  2R7O A;  3GTG A;  3V7O A;  3UGO A;  1WQH A;  3L4K A;  1S7Z A;  1PD0 A;  1O2A A;  2XCQ A;  2KW3 C;  4BLB A;  2A1D D;  4MQ9 F;  3W8H A;  3NKE A;  2KJG A;  5KYU B;  3H0G A;  3K1I C;  4PFO A;  1FFH A;  1O29 A;  4DDQ A;  2EIM C;  3FVY A;  3X1O A;  4NY3 A;  4C3B A;  4KAS A;  4GTE A;  4GT9 A;  1LS1 A;  4GTA A;  4RDA A;  1AB4 A;  3OEP A;  4KB4 A;  3I5Q A;  3L0I A;  2G3V A;  5EGY A;  1O25 A;  1Z6A A;  2NG1 A;  4OD4 A;  3VAY A;  3EHM A;  3Q7G A;  1IS1 A;  3LES A;  3VYW A;  4P5A A;  1OCC C;  4DBR A;  2DYS C;  2PHC B;  1I3Q A;  3FHZ A;  1D1C A;  3LAP A;  3GTM A;  4OIO F;  4PK4 A;  2Y3P A;  3TD7 A;  4XTK A;  4JZA A;  3LEV A;  3IEE A;  4QI0 A;  1XXC A;  2JH3 A;  4O6M A;  2WL8 A;  2J46 A;  2DYR C;  4BJ6 C;  3Q3Q A;  4LQY A;  5B1A C;  3CQZ A;  3Q6M A;  3ZC4 A;  2GSN A;  3AQP A;  2IXN A;  3NRH A;  4FES A;  3H65 A;  3I5P A;  1WQF A;  4G0H A;  4JUR I;  5L3V A;  4K7B A;  2JA5 A;  3LAJ A;  2CGE A;  2Z15 A;  2L81 A;  3HTK C;  1Z5Z A;  3NDB B;  1Z3I X;  4BLA A;  4YWQ A;  4BJ5 C;  2Y3B A;  1O28 A;  4JVS A;  1N1C A;  1TWH A;  4U5E E;  2Y69 C;  5TJ3 A;  2B0J A;  4Q7C A;  4LR2 A;  3LLI A;  4WJ0 A;  2VUM A;  3GOD A;  4CS8 C;  3N0C A;  1FFT C;  3OEO A;  4G7O F;  1R9T A;  5CI8 A;  2JA6 A;  4C3E A;  4AK9 A;  4B6I A;  1WCM A;  2WVQ A;  5T3T A;  1NZE A;  2WZF A;  5F5F A;  3MML B;  2GFH A;  4C3H C;  3LS0 A;  3OWT A;  3FHD A;  3ITF A;  3CAG A;  1VOM A;  4BJ1 A;  3E9V A;  4J30 B;  1OKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...