3S0XA

The crystal structure of gxgd membrane protease flak
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
231
structure length
225
Chain Sequence
b'SGSMIEYIIGALGLIIASVQDEIEDYIWIFLAVFGVLFAIYSSITLLDYSILINSISGFVICFILGYMMFLSGIGGGDGKMLIGLGALVPKFQMPIYTSLGTLLNLNYVPTFPIMVFINGIFFMVFLPFVILFRNILNGARPKTGKEFILMFFGEKMKVNVAKEQKRLIMGQNDKINFFPADEDFSKYSNNEEIWVTPQIPLIIPITLSYLVTPIIGDRILDFLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidase A24B, FlaK domain protein
molecule tags Hydrolase
source organism Methanococcus maripaludis
publication title The crystal structure of GXGD membrane protease FlaK.
pubmed doi rcsb
total genus 56
structure length 225
sequence length 231
chains with identical sequence B
ec nomenclature ec 3.4.23.52: Preflagellin peptidase.
pdb deposition date 2011-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01478 Peptidase_A24 Type IV leader peptidase family
A PF06847 Arc_PepC_II Archaeal Peptidase A24 C-terminus Type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1220 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3s0xA01
3.30.1360.160 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3s0xA02
3S0XA
chains in the Genus database with same CATH superfamily
3GDZA 1PV3A 3GANA 3HOVC 2WAQD 3CQZC 4U9DA 2W9YA 4PABA 4MTGA 3SXYA 4XLNA 1LPEA 4DBQA 5IOQA 5C44C 2Q9AA 1IQ0A 1VB5A 3NMIA 3A8IA 3F46A 4X0RA 4PJLA 3UGOA 3EJNA 4K1OA 2L6GA 3GM2A 5CI8A 4O2DA 5KYYA 3GTMK 3TK0A 3W2WA 2B63A 4KDDA 5BQIA 1JPJA 1VJEA 1OCRC 4QDLA 3M79A 4JZAA 1SMYA 4G7ZF 3B71A 4YJWA 2R7UA 2OEVA 5EHHA 4BKWA 2A6EA 4LK1A 1GGQA 2CCYA 3FHDA 1T5OA 2CNWA 5JVOA 3EH2A 3FAPB 3S17K 3N0CA 3S29A 2NSFA 5JSLA 2XCRB 2G62A 3A8KA 3PO3K 4KMDA 2A69F 5L0FA 3K1HA 4MVOA 2VASA 3BRJA 5E33A 3GEEA 1K83K 2LQGA 3O6XA 4A3KC 2WVNA 2BC5A 1L0WA 1C0AA 3GTGA 3ZIBA 5BQHA 4DVYP 3ERED 1AUEA 5JFEA 1HI9A 1D1CA 2YLDA 1TR2A 2J0XA 2PP4A 3NKDA 2OJQA 3RKOF 2YQYA 3PHF2 4YWQA 2JPUA 4NTBA 3FKIK 1G4WR 1OW7A 1USMA 1FNTc 1XWJA 4JCZA 2JA5K 2JA8C 4JRZA 1Z5ZA 1U6HA 3S1QC 1APCA 4G0UA 5L0CA 3K7AC 2DYRC 1E86A 3UGPA 1F93A 3FKIC 4GEHA 2A6HF 3U8VA 1ZYRA 4BEJA 1HE1A 2JA5C 2JA8K 3H3VL 2R7QA 4A3MK 1RKEB 1RXQA 1W2WA 3LNMB 1I3QK 1PD0A 1BS2A 3S1RC 4HE8D 4EWCA 1OXKA 3GTOC 3GODA 4MVMA 3M4BA 3T6JA 1K83A 2JD3A 4A3MC 3AQBA 4U9EA 2XSEA 2EPOA 3GTOK 3X2QC 2YZSA 3EHMA 1O2FB 3S84A 2P8TA 4GTEA 3CAGA 5IP9K 4CDAA 3IEEA 3WHNA 4Q5SF 3HOWC 5FLMK 1PJ6A 3JYHA 3N24A 3TD7A 3T9OA 3KYIA 3QVYA 1WCMC 1LM3B 1FAPB 3EFOA 3SXMA 2IBFA 3GM3A 4AX2A 4KC6A 2R92A 4BJ5A 4A3DK 1H6GA 4Z9HA 1C03A 1AVOB 1L3PA 5L0IA 1NFOA 3TFIA 1JOGA 5IYBK 4PAAA 4H4KC 4XEKA 3EGDB 4CSAA 1QSPA 4E17A 3FMSA 2XLHA 4D4XA 1ISEA 2X0CA 1QQ3A 3MBGA 2J7PA 3RZOC 1XPPA 3UR3C 3GSIA 3SYNA 1EQ1A 3U0CA 3BEHA 2R92K 3U3FA 1SYQA 4G7HA 3EGXA 1V4AA 3SXZA 4BEMJ 2NG1A 4C2MC 3H2VA 3K1IA 4BBRC 4P5BA 1EI6A 2OQMA 4QJVA 2E2IA 1S05A 1O3UA 3GTKC 3EG9B 5TMFA 1HMDA 4AYBL 4NC3A 4C3EA 5M5YK 4A3EK 5DS4A 1ST6A 5COGA 4BBRK 1MMGA 3K7DA 1YLMA 2PNOA 5A6AA 1OW6A 3F47A 2CDQA 4EUKB 3ASNC 5CIVA 1O25A 1Y1WK 1IBAA 3JZ0A 3S1NC 3B9QA 3EQLA 1M57C 1VRQC 1YZCA 4Y52K 2R93A 1C17M 2XLEA 2BE5A 3R7CA 3FOFA 4JVSA 1TWFK 3LPXA 4LLCA 1Y1WC 1PCXA 3FOEA 2RSEB 4CSAC 3S1NK 2AWCA 1SR2A 4YK5A 4KNWA 4C3HK 1H7IA 2QLAA 2QY9A 4C3BA 1J6XA 5A6JA 2AWYA 2DB4A 4RD9A 2E2IK 4JTDB 2PBEA 2W45A 1FMWA 2NVTC 3TQOA 4XPWA 2J9WA 2PHCB 2C04A 1OCZC 4OIQF 1F7VA 4H54A 2WB7A 3C18A 3W8HA 2QUPA 4JJGA 3W8IA 4NCQA 4UDVA 1TWHC 1MMDA 2NVTK 1GS9A 3JSEO 3N2ZB 1HW2A 1JVIA 1IW7F 1H9GA 2KSFA 2L7AA 4GT9A 3VA7A 4KBLA 1Z7Qc 1ZHXA 1RCPA 5AGFA 4NQFA 4J30B 4YT4A 5F5FA 5M5XK 3HXAA 1C02A 2HKVA 4P6IC 4G0WA 2OOCA 2P6VA 5DVWA 3MYIA 1ZVZA 3L4JA 3LEOA 1RJ9A 2VCCA 1TQGA 3JSTA 3Q7GA 3SEOA 5JUAA 3AG3C 3HKZD 3S27A 3ZQYA 3S2HK 3PO2C 2XM4A 2Z15A 1XXCA 1EA8A 3EG9A 1E84A 1DD5A 4BJ6A 3CZ6A 4AYBD 3QX3A 3PO2K 2R7SA 3FAJA 4A3GC 3A11A 4BG0A 2CYDA 1LE2A 5IYDK 2EPLX 4P5AA 1XXBA 5B3IA 3HOVK 4EHPA 5C4JC 1T6QA 4IWBA 4XCHA 3MLGA 2E2HK 4A93K 1YDIA 4GQHA 3QMKA 3OA1A 4GYTA 2V3CC 1Z6AA 4OIPF 3I4NK 3S90A 4KM8A 3TOLA 2JA6A 3DZAA 3EGDA 1Y4CA 4XTKA 4ZLCA 3M1CB 4KMHA 3I4NC 3LUTB 2HZ8A 1OQCA 4D4NA 1WASA 3GEHA 1J6VA 3GTQA 2ZXRA 4ONSA 3HOYC 2P0NA 3QW0A 1XZQB 2EINC 2R05A 1ZW3A 1F7UA 1YVIA 4G78A 3U3BA 2L6FA 4K7BA 2ZXWC 1R5ID 1WSVA 2W4MA 3ZC4A 3T4RA 4I3MA 4OIOF 4A3KK 3S1QK 3HOYK 3FDQA 2NUPA 1OCCC 1VLSA 3MYFA 1ORJA 3AOUA 4LJZA 2X51A 3VAYA 1YNNA 5B1BC 1GM5A 3I4MK 5D92A 3S0XA 2R7RA 1IZMA 3GTPA 3EGXB 2R03A 1H9TA 4AH6A 3WODA 1RKCA 3PDMP 3ADAC 3TJ5A 2Q00A 1BDFA 2J9VA 1VK5A 5COMA 1Y1VK 4ZLDA 4QI2A 2Q9CA 4JTCB 4O6YA 4WGYA 4OIRA 4NY3A 4DXWA 2HSBA 3HOXK 1VYIA 4YG2A 3IPMO 4JK1A 4U5GA 3GTLC 3HKZL 1LS4A 3AGUA 4DOZA 1I3QC 1SMYF 5FLMC 3V4GA 1M6TA 2XLOA 4Y7NC 3C7JA 2A6EF 3AQPA 5IOTA 4E0IA 2XL8A 1Y1VA 4BJ1A 5L0GA 1BBHA 5KYXA 1CGNA 1I6HK 3GTLK 1O87A 1YARO 2C03A 1NZEA 2Y3DA 3ABLC 2G3KA 2HS5A 2WL8A 2L6HA 2NVXA 1JOEA 1DOWA 4HEAJ 1WOSA 3DE9A 2A69A 3KH2A 2A68F 4FWVA 4Q7CA 3C8GD 1WORA 2UUHA 4LQYA 3EZHA 1EQRA 4I1OB 3AD7C 5L3QA 3T00A 3RZOK 3EH1A 2W7VA 3LAYA 4E0HA 1WCMK 4OIOA 4CX9A 4WGZA 2VUMK 4OINF 3M3YC 2Y3HA 4W8KA 1PD1A 4XLPF 1WN0A 3ABMC 2KWAA 4GTLA 1A7DA 1BDJB 3IQCA 3GTMA 3ZSUA 5IORA 2WB1L 2LFDA 5E2QA 3H0GC 3O39A 2YRFA 1AB4A 2GSUA 2R93C 4KMUA 3NMJA 1OXBA 3CSKA 1I50A 1CPRA 2KQ9A 4KI2A 1I6VA 2XCOA 5F5HA 4GFQA 3BP8C 3S2DK 4A3EC 2XLVA 2NUTA 4BBSK 3OREA 4N6CA 5L0JA 4X6AC 4CS7A 3HKKA 3GIRA 2J9BA 2XLWA 3G4ZA 4XSZA 1UFBA 3RQGA 3FOPA 1LI7A 1T6IA 2EILC 4MTOA 4GZYA 4LK0A 1ZBSA 1B68A 1MMAA 2J7PD 3S15C 1QZXA 5L0DA 4E7SA 3LEVA 3WAQA 5DS6A 4YN0B 4PJJA 4G7OF 2PMZL 2B0JA 3ZDLA 3TULA 1BJTA 5IYCK 4FAPB 5KYWB 2M64A 4OD4A 4N4WA 1J8MF 2KK1A 4A3LC 3DAGA 1ZHZA 5HV9A 1VTMP 2P7VA 5AC5A 5JS5A 3GTOA 2E2JC 2MHRA 3Q6MA 3AG1C 4Y52C 1O2BA 3DJUB 2NPUA 3JT1A 4G7ZA 4JC7A 2QTVA 1IL2A 3N0TA 3MX3A 1TWHK 2BL2A 4QIWL 4C3HC 3G4AA 3I5PA 4A3FC 3E70C 1TWGC 3QTHA 2F22A 4IRUA 4JTAB 3QVZA 4EIYA 3B0PA 1DCPA 4DJ9A 2NVXC 2AU5A 1VOMA 5K0IA 1V74B 4KN7A 2HUJA 3U2LA 1QLEC 3CAXA 3AG2C 4E7ZA 1INNA 1CGME 3CEXA 2NUPB 3B0VC 4G7HF 3RQEA 4JURI 3UMHA 4C3JC 3AJMA 4BXXK 4KB2A 2PX3A 3S2HC 5KYXB 2NSGA 2FAPB 2E87A 1BR4A 1TFOB 1NFNA 4PACA 1TWCA 1O24A 4C3JK 2XXAA 2R7ZA 2XXAB 2WVOA 4CJGA 3RF3A 2P5MA 5JP7A 3U2MA 2YL3A 5T3WA 3HTKC 2LP4A 3WODF 4YFKA 3I5QA 3GTJC 4CS8C 3K33A 3OEOA 1Y1WA 4KMAA 3K66A 3HOZK 1OKKD 1SFOK 1O28A 2OU6A 4BJ6C 3LJBA 4P9TA 4JJFA 1DCHA 3S16K 4N06A 1M2OA 1EI7A 3CQZK 2EIJC 1D1BA 2IYLD 3RZDC 1FR0A 2H7OA 1D0YA 3SP1A 5C44K 1KQ4A 3AQOA 3HOZC 3V5YA 5HSWA 2OJED 4A3GK 2RH6A 4MVUA 3S14C 2A0UA 1T01A 2CW0A 5C4JK 2D6FC 2NVYC 3U8PA 2E2HC 4A93C 1V55C 2YKZA 4A4AA 1VLTA 5FCLA 4G0HA 3SZYA 2KNHA 3FVYA 1ZU4A 2QNLA 3C8ZA 3L1MA 4QI0A 4O6MA 2IM8A 1MNDA 3LS0A 2E2HA 2YLGA 2Q9BA 2WVQA 2LK4A 3BUEA 1HY5A 1K83C 4WJ0A 1Z23A 1YCLA 2NVQC 5EK0A 2ASRA 4U5FE 2FQOA 2J46A 2CFAA 3GTJA 4JEBA 4A3IC 3TOMA 1GQAA 5L0HA 1USOA 2VB6A 2XS8A 1WQGA 3GEIA 2MWQA 2GSNA 1T9KA 3O55A 4EBBA 1ZYRF 2Y3PA 1J98A 1Q0DA 3FHZA 4GTFA 1MNEA 3HJCA 1Q0FA 1WQFA 3ECSA 3OEPA 4MVZA 4ANJA 1IS1A 4QIWD 3DXJA 4GTAA 2WB1D 5FZTA 3GWLA 1G5ZA 2Y0SL 1JAFA 4BY1C 5KYUA 1TKNA 2WAQL 2GA0A 1SZIA 1U89A 2R7TA 1QPUA 4LR2A 2UUIA 2Y3GA 1WQHA 1BGWA 3N0BA 2XL4A 2ZUEA 3NUHA 3AG4C 3BP3A 2HV7A 2NUTB 4YL1A 4YT2A 1WATA 1TWHA 4AL1A 3HLZA 2PPBA 3GTLA 2AP3A 3H0GA 2JA7A 2ICWG 3GTMC 2OCCC 3K1IC 2V6UA 3EHNA 2CNWD 3SZRA 2HMQA 3NYLA 2YL0A 4Y7NK 1RMVA 4G0VA 1KTMA 5T3TA 3R2PA 2PA8L 3HNLA 4A3BC 4R32A 3S17C 4JE9A 3FKIA 3HOWK 3GTQK 3X1OA 2JA7C 2JX0A 2L81A 2IXPA 3NYJA 2KJGA 3H0GK 2ZPAA 4MQ9F 1LVKA 3ZWIA 1PJ7A 2IXNA 2FFHA 3GTGK 3ZTMA 4KARA 3GTQC 3ZQVA 1QKRA 2WZGA 1LIHA 1TWCC 5IP7C 1ZW2A 2R7WA 4O6NA 2VUMC 4X6AK 2YL1A 1MQVA 4JKVA 5KYYB 1IW7A 2O9XA 4IJJA 5E3CA 1LS1A 3A9CA 1R9TA 1ZQ1C 2RD9A 4KAWX 2H7BA 1R9TC 3RVZA 3K7AK 1VYKA 4IAOA 2R25A 4A3JK 2O5IA 2XLMA 3U9JA 2O5JA 3S2DC 1HMOA 4QJVB 5CJ9A 4DRHB 4RBNA 2G3VA 1K40A 4PJNA 1R9TK 1KU2A 1O5HA 1NU7D 5TMCA 3HNIA 3U9MA 1IE0A 1YZAA 3VRCA 4YT8A 2DI3A 1VH2A 3HNJA 3NYMA 5E68A 2V26A 3M4OK 4AK9A 4DRJB 1YYXA 2Y39A 3OWTA 3B29A 3S15K 3V5XA 3KPHA 4F4BA 1ZHWA 5IP9C 5JRAA 4CBEA 4M63A 3M4OC 3S1MK 3PMRA 2NVYA 3UMKA 1UV7A 3VM6A 4DVZA 4A3LK 1NBBA 4HFKB 3VYWA 4XPXA 4LOWA 2CW0F 4N6HA 2PMZD 4EKWA 4MQ9A 1PJ5A 2E2JK 4Q4ZF 2R02A 4A3CC 4XLPA 3GTKA 3L4KA 3DKAA 1A41A 2E2IC 2A68A 3TFHA 3H2UA 1L7CA 3KKBA 2VCAA 4IARA 4WJ3M 2OEXA 3JYYA 5IYBC 1ZHTA 2MYSA 1ORYA 4EBKA 4A3CK 3NRHA 1JRAA 1TWAA 4C45A 1JPNA 5KYNA 4XEFA 2YVKA 2NVXK 1Q0MA 3ZTZA 1J6WA 5KYUB 5IY5C 4W8PA 4ER9A 2R7ZK 4RDAA 4O7GA 1CGOA 3LAPA 1SFOC 2ZXOA 2EIMC 3MFNA 5F28E 3S16C 2VCBA 1FTSA 2R7ZC 3GTKK 4MW8A 1JMWA 2EPNA 2PA8D 4RMFA 1KNYA 5L3VA 2HMZA 4MS2A 5EGYA 4PR9A 1O27A 4YFXA 4J32B 3G4CA 1M2VB 1LKXA 3S14K 1DCOA 3EPVA 3GTPC 2NVYK 3GTJK 3ZG1A 3ZVRA 2QE9A 2ZFZA 2P1AA 2W4BA 2PX0A 4EBJA 4JIOA 2YU9C 5DS5A 3PCVA 2HJMA 2OG2A 2V6SA 3RW0A 2JA6K 2CFAB 3M15A 3SZZA 3GTPK 3RZDK 3EQLF 1XZQA 3HOUK 1BR1A 2YU9K 1WOOA 3L0IA 1OR3A 4IB4A 3GORA 3ATPA 3LNRA 3ASOC 3DM5A 2YHSA 3Q3QA 2YEVA 2J45A 3IQ6A 2A0BA 5A6BD 3LLKA 1Q0GA 2LIGA 2R9RB 5TJ5E 1WIHA 2ZUFA 4Z9JA 2PF4E 1TFKB 4YL3A 3J06A 3T6BA 2LSEA 3LESA 2DGJA 4XQ1A 5IOSA 4ULVA 5TJ3A 2Q3TA 2JH3A 1I5NA 1WCMA 2FQTA 4IGGA 3CQZA 5EGEA 1G8XA 1TWAC 2NVQK 5KYWA 5C3EC 2LFFA 5GPGB 3RH3A 4DBRA 5EGHA 4BY1K 1FFTC 1K04A 1UG7A 3L8JA 4LACB 2XS1A 4LDKA 2GDCA 4CDYA 4C3IK 3IQTA 4AL0A 3I4MC 1YYJA 1WOLA 1NU9C 2YWAA 1I3QA 3KMIA 2IXMA 2LD6A 4MTFA 2EBBA 5C4XK 1FFHA 1VLOA 1RJ9B 3DAFA 3Q7LA 3JRTA 1J8YF 1ZVUA 2HJ3A 1SF8A 1M56C 1O29A 1Y1VC 3A8JA 2PFDA 3M4CA 3SXKA 4OD5A 2GFHA 1LI5A 3IHUA 4K0DA 3HNKA 3JSZA 3KL4A 3AQCA 2HSQA 2GAGC 2TMVP 5IYDC 3HOXC 2IXOA 3KYJA 3W2VA 4PK4A 3DWWA 5CI9A 4A3BK 1T6UA 4LERA 5COFA 1VMAA 2J8WA 3O10A 3UMIA 2JA7K 4PFOA 5B3SC 2LCHA 1TWFA 3EZIA 1A0BA 4GTBA 4MNDA 5A6KA 3UNGC 3NMKA 1I6HC 3T6GB 4BPMA 4DDQA 1HW1A 2GAHC 3T01A 4U5DE 3MMLB 1XXAA 2D5RB 4BLAA 3IQ5A 4JEAA 2ETSA 1TWCK 2CGEA 3G4XA 2Y69C 2RGRA 1YNJA 1Q0KA 4U5CE 5E3AA 4BY7K 3VF0A 1E2XA 2I8BA 1LE4A 4MEXA 3S9OA 3QW1A 4HFFB 1V54C 4KN4A 2YL7A 4CIPA 1ZU5A 4KATA 3M3YK 1Z3IX 4LLEA 3QZCA 2B63K 3GTGC 1F9NA 4A3JC 4ULWA 4BY7C 3PO3C 5JLIA 1XZPB 1U0BB 3DM9B 2XM0A 5M3MK 4BJTA 1EH1A 1CPQA 5IP7K 2R93K 4CDVA 3LLIA 4PFPA 2B63C 2EIKC 3L8IA 4M1XA 2H7VC 3T02A 1Y6DA 2P61A 3C8GB 4BLBA 4PJMA 3AGTA 4DRIB 1EK8A 1F1MA 4BBSC 1XZPA 4I1MA 4CS8A 3S1RK 3RVYA 3I4UA 2A6HA 3DXJF 1X31C 5AC4A 3DMDA 4XEVA 2D4UA 3NG1A 5HL8A 3SNHA 4FZBA 2J0WA 4LDRA 3S1MC 5JT4A 2EPKX 256BA 5B1AC 1WSRA 2A1DD 2GAQA 1WWPA 3U5SA 3JRMO 4WJ4A 4GTDA 2XL6A 4MEYA 3JTLO 4OIRF 1R4TA 4C3DA 4LLGA 4U5HA 4BJ5C 3G50A 1NSGB 4OIPA 1YA7O 1ZXOA 4FX5A 5L46A 4KM9A 4FESA 1D1AA 4B6IA 3FOOA 1OW8A 3AH5A 5DQTA 2Y3BA 3AD9C 3TFJA 4WILA 3IPJA 1AEPA 1I4ZA 3TJ6A 1WGWA 2YU9A 4CJOA 4A3DC 3C63A 3L34A 4JW1A 2VC9A 1ORSC 4Q5SA 3V5ZA 3NDBB 4U5BE 1YAUO 2R7OA 3FXHA 4KC9A 5D4DA 1TWGA 4KASA 1N1CA 4NTAA 4XPYA 4XWJA 4C7OB 2KC3A 5M5WK 1MMNA 4KNVA 5BUOA 1YX2A 1OKKA 3H65A 1DOVA 1Z63A 4XSXA 4OINA 3DJNB 2Q4FA 1BR2A 2L9JA 5A69A 2VUMA 4KB4A 5D91A 2JA5A 3C62A 3JCUQ 4IAQA 3TTGA 1K05A 3ABKC 2I15A 1D0ZA 1NLXA 5T1DB 4BXXC 1RU0A 1OR2A 1SFOA 5A6BA 2FGYA 3RIPA 5DQZA 4CS9C 2J9UA 1B4AA 3POVA 1OCOC 4YL0A 1EKYA 3ITFA 3RQFA 4I44A 4ZH4A 2R7XA 4JCHA 1WTYA 1NG1A 1VGXA 1G4US 1A7VA 2R92C 4P9FA 3N3YA 5DLJA 1M2VA 1E85A 1JR8A 4J7YA 2KW3C 4ILDA 4C2MK 4E18A 2YLIA 2GSOA 1HE9A 2KYHA 4YFNA 4FM9A 5IYCC 2VH3A 3WG7C 2XCQA 4G7OA 4Z9IA 2WZFA 1WOPA 4XLNF 3DE8A 1O26A 4MW3A 4J3NA 4L6RA 2JA6C 3K6BA 4U5EE 4CIHA 3LS1A 2BE5F 3RYLA 2B0HA 3HOUC 4A2NB 4CS9A 1YA9A 2EPMX 2WZLA 4A3FK 4GTCA 1TWGK 1V5VA 1S7ZA 3NKEA 3W4YA 1RKEA 1TWAK 1TWFC 2R7VA 2XRHA 4MVRA 3US6A 4C7OA 2HV6A 1G51A 3AD8C 2KGOA 2ZD9A 1HQMA 3S28A 2DYSC 2OKUA 4Q4ZA 3B0UX 1YJGA 4O79A 4MVQA 3H3VD 1EFWA 2Q7RA 2H8AA 4OIQA 1E83A 1ZZPA 1I4YA 1FMVA 1I50K 4P9SA 2Y0SD 2IOQA 2M4EA 3GWNA 3E9VA 1A7EA 1ZHYA 1D0XA 3RFYA 4LDQA 1B4BA 2ZXPA 3Q6NA 4A3IK 2HFIA 5C3EK 4MVSA 1I50C 5JVEA 1GE9A 3DD7A 3C8GA 4NTFA 1O2AA 2GWWA 3V7OA 4NOIA 1QVXA 1JQWA 4AE4A 2V6TA 4AE4B 4C3IC 4WABA 5CHPA 3LAJA 5FJ8K 3DI5A 3EFOB 5M3FK 4J7TA 4YT5A 3GM1A 5BQGA 3OPFA 5C4XC 1BZ4A 2XLDA 2AVKA
chains in the Genus database with same CATH topology
1FFTC 4LACB 2V3CC 1Z6AA 4OIPF 1MNDA 3LS0A 4KM8A 2E2HA 2Q9BA 2WVQA 3GANA 3BUEA 2JA6A 4WJ0A 1Z23A 3DZAA 2W9YA 1NU9C 1I3QA 3KMIA 3EGDA 2IXMA 4XTKA 4ZLCA 1FFHA 4DBQA 5IOQA 2Q9AA 4U5FE 1RJ9B 3DAFA 3Q7LA 3M1CB 2J46A 3F46A 3JRTA 4X0RA 2CFAA 4PJLA 1J8YF 3EJNA 3UGOA 1ZVUA 4KMHA 3GTJA 1SF8A 1M56C 5CI8A 1O29A 5KYYA 2PFDA 2VB6A 2ZXRA 3GTQA 1WQGA 3W2WA 4OD5A 2MWQA 2GSNA 2GFHA 4EBBA 4KDDA 2B63A 1ZYRF 2Y3PA 1JPJA 4K0DA 1OCRC 2EINC 4JZAA 4QDLA 3JSZA 4G7ZF 3KL4A 3AQCA 4YJWA 2R7UA 3FHZA 4GTFA 1MNEA 4K7BA 5EHHA 2ZXWC 3HJCA 1WQFA 4BKWA 2IXOA 3ECSA 2W4MA 3OEPA 3W2VA 3FHDA 4PK4A 3T4RA 3ZC4A 2CNWA 5JVOA 4I3MA 4ANJA 1IS1A 3EH2A 4OIOF 5CI9A 4GTAA 3N0CA 3FDQA 2NUPA 4LERA 3S29A 2XCRB 1OCCC 1VMAA 3UMIA 2G62A 4KMDA 5KYUA 4PFOA 5B3SC 1TKNA 2X51A 1TWFA 3EZIA 1SZIA 3VAYA 2R7TA 4GTBA 4LR2A 2A69F 5B1BC 4MNDA 3K1HA 2VASA 2Y3GA 5E33A 3UNGC 5D92A 1WQHA 3S0XA 2R7RA 1IZMA 1BGWA 3GTPA 3N0BA 2XL4A 4DDQA 3O6XA 3NUHA 3AG4C 3EGXB 2WVNA 2HV7A 2NUTB 4U5DE 4YT2A 3MMLB 3GTGA 3ZIBA 1TWHA 1XXAA 4DVYP 2D5RB 3HLZA 4BLAA 3ERED 3GTLA 2J9VA 5JFEA 1VK5A 3H0GA 1D1CA 2CGEA 2JA7A 1TR2A 2J0XA 2PP4A 2OCCC 3K1IC 3EHNA 4ZLDA 4QI2A 3NKDA 3RKOF 2CNWD 2Y69C 3SZRA 3PHF2 2Q9CA 4YWQA 2RGRA 3NYLA 4O6YA 4U5CE 5E3AA 4NY3A 4G0VA 1VYIA 2I8BA 5T3TA 1Z5ZA 4HFFB 1V54C 4U5GA 1ZU5A 4KATA 1Z3IX 4G0UA 4LLEA 3QZCA 3FKIA 4DOZA 1SMYF 2DYRC 1F9NA 3V4GA 4ULWA 3UGPA 4GEHA 2A6HF 3X1OA 4BEJA 3DM9B 2A6EF 2L81A 3AQPA 5IOTA 2IXPA 3NYJA 1Y1VA 4BJ1A 2KJGA 4BJTA 1EH1A 2R7QA 5KYXA 1W2WA 2ZPAA 4MQ9F 1LVKA 1O87A 3LLIA 4PFPA 1PD0A 2C03A 2FFHA 2IXNA 1NZEA 2EIKC 4HE8D 4M1XA 2Y3DA 4EWCA 3ABLC 4KARA 2G3KA 2H7VC 3GODA 2WL8A 2WZGA 2NVXA 3T6JA 4HEAJ 4BLBA 4PJMA 1K83A 2JD3A 3KH2A 2A68F 1EK8A 4FWVA 4Q7CA 4LQYA 3EZHA 2R7WA 4O6NA 4I1MA 3AQBA 4I1OB 4CS8A 2XSEA 5KYYB 5L3QA 2O9XA 4IJJA 5E3CA 1LS1A 3X2QC 2YZSA 3EHMA 4GTEA 3I4UA 3EH1A 3DXJF 3LAYA 1R9TA 3CAGA 3DMDA 4KAWX 2H7BA 4OINF 3NG1A 3IEEA 2Y3HA 4W8KA 3SNHA 1PD1A 2J0WA 4XLPF 1VYKA 4Q5SF 4FZBA 4IAOA 3ABMC 3JYHA 2KWAA 4GTLA 5B1AC 2A1DD 3N24A 3TD7A 5CJ9A 4GTDA 3GTMA 4OIRF 3ZSUA 5IORA 4RBNA 4C3DA 4U5HA 5E2QA 2G3VA 4BJ5C 3EFOA 3O39A 4AX2A 1AB4A 2GSUA 4KC6A 4PJNA 4BJ5A 1ZXOA 2R92A 4FX5A 1KU2A 3CSKA 1O5HA 1I50A 4KM9A 1NU7D 2KQ9A 4KI2A 4FESA 1D1AA 2XCOA 4B6IA 5F5HA 4GFQA 3AH5A 5DQTA 2Y3BA 4YT8A 2NUTA 4H4KC 3EGDB 3OREA 4CSAA 1WGWA 2YU9A 3NYMA 4CS7A 2V26A 4AK9A 1ISEA 3L34A 4JW1A 2Y39A 3OWTA 2J7PA 3NDBB 4U5BE 2R7OA 4KC9A 3UR3C 1TWGA 4F4BA 1ZHWA 2EILC 3SYNA 4KASA 1N1CA 4XWJA 4C7OB 4CBEA 4M63A 1MMNA 3PMRA 2NVYA 4KNVA 3EGXA 3UMKA 5BUOA 1ZBSA 1MMAA 2J7PD 4DVZA 1OKKA 1QZXA 4E7SA 3LEVA 5DS6A 4HFKB 3H65A 2NG1A 3VYWA 4YN0B 4C2MC 4PJJA 4G7OF 1Z63A 2B0JA 2CW0F 3DJNB 1BJTA 5KYWB 4P5BA 4Q4ZF 1BR2A 2L9JA 2VUMA 4KB4A 3GTKA 3L4KA 5D91A 2E2IA 2JA5A 4OD4A 3JCUQ 1J8MF 3EG9B 3DAGA 1ZHZA 3ABKC 5T1DB 1D0ZA 3KKBA 2P7VA 4C3EA 1ZHTA 3GTOA 5DS4A 1ST6A 2MYSA 3Q6MA 1MMGA 3K7DA 3AG1C 1SFOA 1O2BA 2FGYA 3DJUB 3RIPA 3JT1A 5DQZA 4CS9C 3F47A 2CDQA 3NRHA 2J9UA 3ASNC 2QTVA 1O25A 3N0TA 3MX3A 1TWAA 1B4AA 3POVA 1JPNA 1OCOC 5KYNA 3ITFA 3B9QA 4I44A 2R7XA 1M57C 4JCHA 3G4AA 3I5PA 4C3HC 3E70C 1NG1A 5KYUB 5IY5C 2R93A 3N3YA 5DLJA 4IRUA 4RDAA 3FOFA 4JVSA 1M2VA 3LPXA 4LLCA 4O7GA 1PCXA 3FOEA 3B0PA 4CSAC 2KW3C 4ILDA 3LAPA 4KNWA 1VOMA 2ZXOA 2GSOA 4FM9A 2EIMC 1QLEC 2QY9A 2VH3A 4C3BA 3AG2C 3WG7C 1FTSA 4E7ZA 2NUPB 3B0VC 4G7HF 4RD9A 2XCQA 2W45A 1FMWA 5L3VA 2WZFA 4XLNF 4JURI 3UMHA 4C3JC 4KB2A 2PX3A 2J9WA 2PHCB 2C04A 1OCZC 4OIQF 1O26A 5KYXB 5EGYA 1O27A 2WB7A 4J32B 3G4CA 1M2VB 3W8HA 4J3NA 1LKXA 2E87A 3K6BA 1BR4A 3EPVA 4U5EE 4CIHA 4JJGA 3ZG1A 3ZVRA 3LS1A 3W8IA 2ZFZA 1TWCA 2BE5F 2PX0A 2W4BA 1O24A 1MMDA 3RYLA 4A2NB 4CS9A 3N2ZB 2XXAA 2R7ZA 1IW7F 5DS5A 2XXAB 2OG2A 2WVOA 2WZLA 4GTCA 1S7ZA 4GT9A 3VA7A 2P5MA 4KBLA 3NKEA 1ZHXA 2CFAB 5T3WA 3HTKC 3WODF 3I5QA 2R7VA 2XRHA 3EQLF 4J30B 4CS8C 4YT4A 3K33A 4C7OA 5F5FA 3OEOA 1Y1WA 2HV6A 4KMAA 1BR1A 3K66A 2KGOA 4P6IC 3L0IA 3S28A 4G0WA 2DYSC 1OKKD 3B0UX 1O28A 4O79A 4BJ6C 3LJBA 2P6VA 4JJFA 4N06A 5DVWA 1M2OA 3L4JA 2EIJC 1D1BA 2IYLD 1RJ9A 3ASOC 3LNRA 3DM5A 1FMVA 2YHSA 3Q3QA 2YEVA 2H7OA 3Q7GA 3SEOA 2IOQA 1D0YA 2J45A 3SP1A 2M4EA 3LLKA 3AG3C 3S27A 1KQ4A 3E9VA 1WIHA 1ZHYA 3AQOA 2Z15A 5HSWA 1XXCA 1D0XA 3RFYA 2RH6A 3EG9A 1B4BA 2ZXPA 3Q6NA 2PF4E 1DD5A 3T6BA 2LSEA 4BJ6A 1GE9A 3LESA 2DGJA 3DD7A 1O2AA 5IOSA 3CZ6A 3V7OA 1V55C 3QX3A 5TJ3A 2R7SA 2Q3TA 2JH3A 3FAJA 4BG0A 1WCMA 4P5AA 1XXBA 4AE4A 3CQZA 5EGEA 4AE4B 4C3IC 5FCLA 5CHPA 3LAJA 4G0HA 3EFOB 2KNHA 4YT5A 1G8XA 4IWBA 3FVYA 5KYWA 1ZU4A 3OPFA 3MLGA 3RH3A 4DBRA 3QMKA 5EGHA 3OA1A 4QI0A 4O6MA 4GYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S0X A; 
#chains in the Genus database with same CATH topology
 3GDZ A;  1PV3 A;  3GAN A;  3HOV C;  2WAQ D;  3CQZ C;  4U9D A;  2W9Y A;  4PAB A;  4MTG A;  3SXY A;  4XLN A;  1LPE A;  4DBQ A;  5IOQ A;  5C44 C;  2Q9A A;  1IQ0 A;  1VB5 A;  3NMI A;  3A8I A;  3F46 A;  4X0R A;  4PJL A;  3UGO A;  3EJN A;  4K1O A;  2L6G A;  3GM2 A;  5CI8 A;  4O2D A;  5KYY A;  3GTM K;  3TK0 A;  3W2W A;  2B63 A;  4KDD A;  5BQI A;  1JPJ A;  1VJE A;  1OCR C;  4QDL A;  3M79 A;  4JZA A;  1SMY A;  4G7Z F;  3B71 A;  4YJW A;  2R7U A;  2OEV A;  5EHH A;  4BKW A;  2A6E A;  4LK1 A;  1GGQ A;  2CCY A;  3FHD A;  1T5O A;  2CNW A;  5JVO A;  3EH2 A;  3FAP B;  3S17 K;  3N0C A;  3S29 A;  2NSF A;  5JSL A;  2XCR B;  2G62 A;  3A8K A;  3PO3 K;  4KMD A;  2A69 F;  5L0F A;  3K1H A;  4MVO A;  2VAS A;  3BRJ A;  5E33 A;  3GEE A;  1K83 K;  2LQG A;  3O6X A;  4A3K C;  2WVN A;  2BC5 A;  1L0W A;  1C0A A;  3GTG A;  3ZIB A;  5BQH A;  4DVY P;  3ERE D;  1AUE A;  5JFE A;  1HI9 A;  1D1C A;  2YLD A;  1TR2 A;  2J0X A;  2PP4 A;  3NKD A;  2OJQ A;  3RKO F;  2YQY A;  3PHF 2;  4YWQ A;  2JPU A;  4NTB A;  3FKI K;  1G4W R;  1OW7 A;  1USM A;  1FNT c;  1XWJ A;  4JCZ A;  2JA5 K;  2JA8 C;  4JRZ A;  1Z5Z A;  1U6H A;  3S1Q C;  1APC A;  4G0U A;  5L0C A;  3K7A C;  2DYR C;  1E86 A;  3UGP A;  1F93 A;  3FKI C;  4GEH A;  2A6H F;  3U8V A;  1ZYR A;  4BEJ A;  1HE1 A;  2JA5 C;  2JA8 K;  3H3V L;  2R7Q A;  4A3M K;  1RKE B;  1RXQ A;  1W2W A;  3LNM B;  1I3Q K;  1PD0 A;  1BS2 A;  3S1R C;  4HE8 D;  4EWC A;  1OXK A;  3GTO C;  3GOD A;  4MVM A;  3M4B A;  3T6J A;  1K83 A;  2JD3 A;  4A3M C;  3AQB A;  4U9E A;  2XSE A;  2EPO A;  3GTO K;  3X2Q C;  2YZS A;  3EHM A;  1O2F B;  3S84 A;  2P8T A;  4GTE A;  3CAG A;  5IP9 K;  4CDA A;  3IEE A;  3WHN A;  4Q5S F;  3HOW C;  5FLM K;  1PJ6 A;  3JYH A;  3N24 A;  3TD7 A;  3T9O A;  3KYI A;  3QVY A;  1WCM C;  1LM3 B;  1FAP B;  3EFO A;  3SXM A;  2IBF A;  3GM3 A;  4AX2 A;  4KC6 A;  2R92 A;  4BJ5 A;  4A3D K;  1H6G A;  4Z9H A;  1C03 A;  1AVO B;  1L3P A;  5L0I A;  1NFO A;  3TFI A;  1JOG A;  5IYB K;  4PAA A;  4H4K C;  4XEK A;  3EGD B;  4CSA A;  1QSP A;  4E17 A;  3FMS A;  2XLH A;  4D4X A;  1ISE A;  2X0C A;  1QQ3 A;  3MBG A;  2J7P A;  3RZO C;  1XPP A;  3UR3 C;  3GSI A;  3SYN A;  1EQ1 A;  3U0C A;  3BEH A;  2R92 K;  3U3F A;  1SYQ A;  4G7H A;  3EGX A;  1V4A A;  3SXZ A;  4BEM J;  2NG1 A;  4C2M C;  3H2V A;  3K1I A;  4BBR C;  4P5B A;  1EI6 A;  2OQM A;  4QJV A;  2E2I A;  1S05 A;  1O3U A;  3GTK C;  3EG9 B;  5TMF A;  1HMD A;  4AYB L;  4NC3 A;  4C3E A;  5M5Y K;  4A3E K;  5DS4 A;  1ST6 A;  5COG A;  4BBR K;  1MMG A;  3K7D A;  1YLM A;  2PNO A;  5A6A A;  1OW6 A;  3F47 A;  2CDQ A;  4EUK B;  3ASN C;  5CIV A;  1O25 A;  1Y1W K;  1IBA A;  3JZ0 A;  3S1N C;  3B9Q A;  3EQL A;  1M57 C;  1VRQ C;  1YZC A;  4Y52 K;  2R93 A;  1C17 M;  2XLE A;  2BE5 A;  3R7C A;  3FOF A;  4JVS A;  1TWF K;  3LPX A;  4LLC A;  1Y1W C;  1PCX A;  3FOE A;  2RSE B;  4CSA C;  3S1N K;  2AWC A;  1SR2 A;  4YK5 A;  4KNW A;  4C3H K;  1H7I A;  2QLA A;  2QY9 A;  4C3B A;  1J6X A;  5A6J A;  2AWY A;  2DB4 A;  4RD9 A;  2E2I K;  4JTD B;  2PBE A;  2W45 A;  1FMW A;  2NVT C;  3TQO A;  4XPW A;  2J9W A;  2PHC B;  2C04 A;  1OCZ C;  4OIQ F;  1F7V A;  4H54 A;  2WB7 A;  3C18 A;  3W8H A;  2QUP A;  4JJG A;  3W8I A;  4NCQ A;  4UDV A;  1TWH C;  1MMD A;  2NVT K;  1GS9 A;  3JSE O;  3N2Z B;  1HW2 A;  1JVI A;  1IW7 F;  1H9G A;  2KSF A;  2L7A A;  4GT9 A;  3VA7 A;  4KBL A;  1Z7Q c;  1ZHX A;  1RCP A;  5AGF A;  4NQF A;  4J30 B;  4YT4 A;  5F5F A;  5M5X K;  3HXA A;  1C02 A;  2HKV A;  4P6I C;  4G0W A;  2OOC A;  2P6V A;  5DVW A;  3MYI A;  1ZVZ A;  3L4J A;  3LEO A;  1RJ9 A;  2VCC A;  1TQG A;  3JST A;  3Q7G A;  3SEO A;  5JUA A;  3AG3 C;  3HKZ D;  3S27 A;  3ZQY A;  3S2H K;  3PO2 C;  2XM4 A;  2Z15 A;  1XXC A;  1EA8 A;  3EG9 A;  1E84 A;  1DD5 A;  4BJ6 A;  3CZ6 A;  4AYB D;  3QX3 A;  3PO2 K;  2R7S A;  3FAJ A;  4A3G C;  3A11 A;  4BG0 A;  2CYD A;  1LE2 A;  5IYD K;  2EPL X;  4P5A A;  1XXB A;  5B3I A;  3HOV K;  4EHP A;  5C4J C;  1T6Q A;  4IWB A;  4XCH A;  3MLG A;  2E2H K;  4A93 K;  1YDI A;  4GQH A;  3QMK A;  3OA1 A;  4GYT A;  2V3C C;  1Z6A A;  4OIP F;  3I4N K;  3S90 A;  4KM8 A;  3TOL A;  2JA6 A;  3DZA A;  3EGD A;  1Y4C A;  4XTK A;  4ZLC A;  3M1C B;  4KMH A;  3I4N C;  3LUT B;  2HZ8 A;  1OQC A;  4D4N A;  1WAS A;  3GEH A;  1J6V A;  3GTQ A;  2ZXR A;  4ONS A;  3HOY C;  2P0N A;  3QW0 A;  1XZQ B;  2EIN C;  2R05 A;  1ZW3 A;  1F7U A;  1YVI A;  4G78 A;  3U3B A;  2L6F A;  4K7B A;  2ZXW C;  1R5I D;  1WSV A;  2W4M A;  3ZC4 A;  3T4R A;  4I3M A;  4OIO F;  4A3K K;  3S1Q K;  3HOY K;  3FDQ A;  2NUP A;  1OCC C;  1VLS A;  3MYF A;  1ORJ A;  3AOU A;  4LJZ A;  2X51 A;  3VAY A;  1YNN A;  5B1B C;  1GM5 A;  3I4M K;  5D92 A;  3S0X A;  2R7R A;  1IZM A;  3GTP A;  3EGX B;  2R03 A;  1H9T A;  4AH6 A;  3WOD A;  1RKC A;  3PDM P;  3ADA C;  3TJ5 A;  2Q00 A;  1BDF A;  2J9V A;  1VK5 A;  5COM A;  1Y1V K;  4ZLD A;  4QI2 A;  2Q9C A;  4JTC B;  4O6Y A;  4WGY A;  4OIR A;  4NY3 A;  4DXW A;  2HSB A;  3HOX K;  1VYI A;  4YG2 A;  3IPM O;  4JK1 A;  4U5G A;  3GTL C;  3HKZ L;  1LS4 A;  3AGU A;  4DOZ A;  1I3Q C;  1SMY F;  5FLM C;  3V4G A;  1M6T A;  2XLO A;  4Y7N C;  3C7J A;  2A6E F;  3AQP A;  5IOT A;  4E0I A;  2XL8 A;  1Y1V A;  4BJ1 A;  5L0G A;  1BBH A;  5KYX A;  1CGN A;  1I6H K;  3GTL K;  1O87 A;  1YAR O;  2C03 A;  1NZE A;  2Y3D A;  3ABL C;  2G3K A;  2HS5 A;  2WL8 A;  2L6H A;  2NVX A;  1JOE A;  1DOW A;  4HEA J;  1WOS A;  3DE9 A;  2A69 A;  3KH2 A;  2A68 F;  4FWV A;  4Q7C A;  3C8G D;  1WOR A;  2UUH A;  4LQY A;  3EZH A;  1EQR A;  4I1O B;  3AD7 C;  5L3Q A;  3T00 A;  3RZO K;  3EH1 A;  2W7V A;  3LAY A;  4E0H A;  1WCM K;  4OIO A;  4CX9 A;  4WGZ A;  2VUM K;  4OIN F;  3M3Y C;  2Y3H A;  4W8K A;  1PD1 A;  4XLP F;  1WN0 A;  3ABM C;  2KWA A;  4GTL A;  1A7D A;  1BDJ B;  3IQC A;  3GTM A;  3ZSU A;  5IOR A;  2WB1 L;  2LFD A;  5E2Q A;  3H0G C;  3O39 A;  2YRF A;  1AB4 A;  2GSU A;  2R93 C;  4KMU A;  3NMJ A;  1OXB A;  3CSK A;  1I50 A;  1CPR A;  2KQ9 A;  4KI2 A;  1I6V A;  2XCO A;  5F5H A;  4GFQ A;  3BP8 C;  3S2D K;  4A3E C;  2XLV A;  2NUT A;  4BBS K;  3ORE A;  4N6C A;  5L0J A;  4X6A C;  4CS7 A;  3HKK A;  3GIR A;  2J9B A;  2XLW A;  3G4Z A;  4XSZ A;  1UFB A;  3RQG A;  3FOP A;  1LI7 A;  1T6I A;  2EIL C;  4MTO A;  4GZY A;  4LK0 A;  1ZBS A;  1B68 A;  1MMA A;  2J7P D;  3S15 C;  1QZX A;  5L0D A;  4E7S A;  3LEV A;  3WAQ A;  5DS6 A;  4YN0 B;  4PJJ A;  4G7O F;  2PMZ L;  2B0J A;  3ZDL A;  3TUL A;  1BJT A;  5IYC K;  4FAP B;  5KYW B;  2M64 A;  4OD4 A;  4N4W A;  1J8M F;  2KK1 A;  4A3L C;  3DAG A;  1ZHZ A;  5HV9 A;  1VTM P;  2P7V A;  5AC5 A;  5JS5 A;  3GTO A;  2E2J C;  2MHR A;  3Q6M A;  3AG1 C;  4Y52 C;  1O2B A;  3DJU B;  2NPU A;  3JT1 A;  4G7Z A;  4JC7 A;  2QTV A;  1IL2 A;  3N0T A;  3MX3 A;  1TWH K;  2BL2 A;  4QIW L;  4C3H C;  3G4A A;  3I5P A;  4A3F C;  3E70 C;  1TWG C;  3QTH A;  2F22 A;  4IRU A;  4JTA B;  3QVZ A;  4EIY A;  3B0P A;  1DCP A;  4DJ9 A;  2NVX C;  2AU5 A;  1VOM A;  5K0I A;  1V74 B;  4KN7 A;  2HUJ A;  3U2L A;  1QLE C;  3CAX A;  3AG2 C;  4E7Z A;  1INN A;  1CGM E;  3CEX A;  2NUP B;  3B0V C;  4G7H F;  3RQE A;  4JUR I;  3UMH A;  4C3J C;  3AJM A;  4BXX K;  4KB2 A;  2PX3 A;  3S2H C;  5KYX B;  2NSG A;  2FAP B;  2E87 A;  1BR4 A;  1TFO B;  1NFN A;  4PAC A;  1TWC A;  1O24 A;  4C3J K;  2XXA A;  2R7Z A;  2XXA B;  2WVO A;  4CJG A;  3RF3 A;  2P5M A;  5JP7 A;  3U2M A;  2YL3 A;  5T3W A;  3HTK C;  2LP4 A;  3WOD F;  4YFK A;  3I5Q A;  3GTJ C;  4CS8 C;  3K33 A;  3OEO A;  1Y1W A;  4KMA A;  3K66 A;  3HOZ K;  1OKK D;  1SFO K;  1O28 A;  2OU6 A;  4BJ6 C;  3LJB A;  4P9T A;  4JJF A;  1DCH A;  3S16 K;  4N06 A;  1M2O A;  1EI7 A;  3CQZ K;  2EIJ C;  1D1B A;  2IYL D;  3RZD C;  1FR0 A;  2H7O A;  1D0Y A;  3SP1 A;  5C44 K;  1KQ4 A;  3AQO A;  3HOZ C;  3V5Y A;  5HSW A;  2OJE D;  4A3G K;  2RH6 A;  4MVU A;  3S14 C;  2A0U A;  1T01 A;  2CW0 A;  5C4J K;  2D6F C;  2NVY C;  3U8P A;  2E2H C;  4A93 C;  1V55 C;  2YKZ A;  4A4A A;  1VLT A;  5FCL A;  4G0H A;  3SZY A;  2KNH A;  3FVY A;  1ZU4 A;  2QNL A;  3C8Z A;  3L1M A;  4QI0 A;  4O6M A;  2IM8 A;  1MND A;  3LS0 A;  2E2H A;  2YLG A;  2Q9B A;  2WVQ A;  2LK4 A;  3BUE A;  1HY5 A;  1K83 C;  4WJ0 A;  1Z23 A;  1YCL A;  2NVQ C;  5EK0 A;  2ASR A;  4U5F E;  2FQO A;  2J46 A;  2CFA A;  3GTJ A;  4JEB A;  4A3I C;  3TOM A;  1GQA A;  5L0H A;  1USO A;  2VB6 A;  2XS8 A;  1WQG A;  3GEI A;  2MWQ A;  2GSN A;  1T9K A;  3O55 A;  4EBB A;  1ZYR F;  2Y3P A;  1J98 A;  1Q0D A;  3FHZ A;  4GTF A;  1MNE A;  3HJC A;  1Q0F A;  1WQF A;  3ECS A;  3OEP A;  4MVZ A;  4ANJ A;  1IS1 A;  4QIW D;  3DXJ A;  4GTA A;  2WB1 D;  5FZT A;  3GWL A;  1G5Z A;  2Y0S L;  1JAF A;  4BY1 C;  5KYU A;  1TKN A;  2WAQ L;  2GA0 A;  1SZI A;  1U89 A;  2R7T A;  1QPU A;  4LR2 A;  2UUI A;  2Y3G A;  1WQH A;  1BGW A;  3N0B A;  2XL4 A;  2ZUE A;  3NUH A;  3AG4 C;  3BP3 A;  2HV7 A;  2NUT B;  4YL1 A;  4YT2 A;  1WAT A;  1TWH A;  4AL1 A;  3HLZ A;  2PPB A;  3GTL A;  2AP3 A;  3H0G A;  2JA7 A;  2ICW G;  3GTM C;  2OCC C;  3K1I C;  2V6U A;  3EHN A;  2CNW D;  3SZR A;  2HMQ A;  3NYL A;  2YL0 A;  4Y7N K;  1RMV A;  4G0V A;  1KTM A;  5T3T A;  3R2P A;  2PA8 L;  3HNL A;  4A3B C;  4R32 A;  3S17 C;  4JE9 A;  3FKI A;  3HOW K;  3GTQ K;  3X1O A;  2JA7 C;  2JX0 A;  2L81 A;  2IXP A;  3NYJ A;  2KJG A;  3H0G K;  2ZPA A;  4MQ9 F;  1LVK A;  3ZWI A;  1PJ7 A;  2IXN A;  2FFH A;  3GTG K;  3ZTM A;  4KAR A;  3GTQ C;  3ZQV A;  1QKR A;  2WZG A;  1LIH A;  1TWC C;  5IP7 C;  1ZW2 A;  2R7W A;  4O6N A;  2VUM C;  4X6A K;  2YL1 A;  1MQV A;  4JKV A;  5KYY B;  1IW7 A;  2O9X A;  4IJJ A;  5E3C A;  1LS1 A;  3A9C A;  1R9T A;  1ZQ1 C;  2RD9 A;  4KAW X;  2H7B A;  1R9T C;  3RVZ A;  3K7A K;  1VYK A;  4IAO A;  2R25 A;  4A3J K;  2O5I A;  2XLM A;  3U9J A;  2O5J A;  3S2D C;  1HMO A;  4QJV B;  5CJ9 A;  4DRH B;  4RBN A;  2G3V A;  1K40 A;  4PJN A;  1R9T K;  1KU2 A;  1O5H A;  1NU7 D;  5TMC A;  3HNI A;  3U9M A;  1IE0 A;  1YZA A;  3VRC A;  4YT8 A;  2DI3 A;  1VH2 A;  3HNJ A;  3NYM A;  5E68 A;  2V26 A;  3M4O K;  4AK9 A;  4DRJ B;  1YYX A;  2Y39 A;  3OWT A;  3B29 A;  3S15 K;  3V5X A;  3KPH A;  4F4B A;  1ZHW A;  5IP9 C;  5JRA A;  4CBE A;  4M63 A;  3M4O C;  3S1M K;  3PMR A;  2NVY A;  3UMK A;  1UV7 A;  3VM6 A;  4DVZ A;  4A3L K;  1NBB A;  4HFK B;  3VYW A;  4XPX A;  4LOW A;  2CW0 F;  4N6H A;  2PMZ D;  4EKW A;  4MQ9 A;  1PJ5 A;  2E2J K;  4Q4Z F;  2R02 A;  4A3C C;  4XLP A;  3GTK A;  3L4K A;  3DKA A;  1A41 A;  2E2I C;  2A68 A;  3TFH A;  3H2U A;  1L7C A;  3KKB A;  2VCA A;  4IAR A;  4WJ3 M;  2OEX A;  3JYY A;  5IYB C;  1ZHT A;  2MYS A;  1ORY A;  4EBK A;  4A3C K;  3NRH A;  1JRA A;  1TWA A;  4C45 A;  1JPN A;  5KYN A;  4XEF A;  2YVK A;  2NVX K;  1Q0M A;  3ZTZ A;  1J6W A;  5KYU B;  5IY5 C;  4W8P A;  4ER9 A;  2R7Z K;  4RDA A;  4O7G A;  1CGO A;  3LAP A;  1SFO C;  2ZXO A;  2EIM C;  3MFN A;  5F28 E;  3S16 C;  2VCB A;  1FTS A;  2R7Z C;  3GTK K;  4MW8 A;  1JMW A;  2EPN A;  2PA8 D;  4RMF A;  1KNY A;  5L3V A;  2HMZ A;  4MS2 A;  5EGY A;  4PR9 A;  1O27 A;  4YFX A;  4J32 B;  3G4C A;  1M2V B;  1LKX A;  3S14 K;  1DCO A;  3EPV A;  3GTP C;  2NVY K;  3GTJ K;  3ZG1 A;  3ZVR A;  2QE9 A;  2ZFZ A;  2P1A A;  2W4B A;  2PX0 A;  4EBJ A;  4JIO A;  2YU9 C;  5DS5 A;  3PCV A;  2HJM A;  2OG2 A;  2V6S A;  3RW0 A;  2JA6 K;  2CFA B;  3M15 A;  3SZZ A;  3GTP K;  3RZD K;  3EQL F;  1XZQ A;  3HOU K;  1BR1 A;  2YU9 K;  1WOO A;  3L0I A;  1OR3 A;  4IB4 A;  3GOR A;  3ATP A;  3LNR A;  3ASO C;  3DM5 A;  2YHS A;  3Q3Q A;  2YEV A;  2J45 A;  3IQ6 A;  2A0B A;  5A6B D;  3LLK A;  1Q0G A;  2LIG A;  2R9R B;  5TJ5 E;  1WIH A;  2ZUF A;  4Z9J A;  2PF4 E;  1TFK B;  4YL3 A;  3J06 A;  3T6B A;  2LSE A;  3LES A;  2DGJ A;  4XQ1 A;  5IOS A;  4ULV A;  5TJ3 A;  2Q3T A;  2JH3 A;  1I5N A;  1WCM A;  2FQT A;  4IGG A;  3CQZ A;  5EGE A;  1G8X A;  1TWA C;  2NVQ K;  5KYW A;  5C3E C;  2LFF A;  5GPG B;  3RH3 A;  4DBR A;  5EGH A;  4BY1 K;  1FFT C;  1K04 A;  1UG7 A;  3L8J A;  4LAC B;  2XS1 A;  4LDK A;  2GDC A;  4CDY A;  4C3I K;  3IQT A;  4AL0 A;  3I4M C;  1YYJ A;  1WOL A;  1NU9 C;  2YWA A;  1I3Q A;  3KMI A;  2IXM A;  2LD6 A;  4MTF A;  2EBB A;  5C4X K;  1FFH A;  1VLO A;  1RJ9 B;  3DAF A;  3Q7L A;  3JRT A;  1J8Y F;  1ZVU A;  2HJ3 A;  1SF8 A;  1M56 C;  1O29 A;  1Y1V C;  3A8J A;  2PFD A;  3M4C A;  3SXK A;  4OD5 A;  2GFH A;  1LI5 A;  3IHU A;  4K0D A;  3HNK A;  3JSZ A;  3KL4 A;  3AQC A;  2HSQ A;  2GAG C;  2TMV P;  5IYD C;  3HOX C;  2IXO A;  3KYJ A;  3W2V A;  4PK4 A;  3DWW A;  5CI9 A;  4A3B K;  1T6U A;  4LER A;  5COF A;  1VMA A;  2J8W A;  3O10 A;  3UMI A;  2JA7 K;  4PFO A;  5B3S C;  2LCH A;  1TWF A;  3EZI A;  1A0B A;  4GTB A;  4MND A;  5A6K A;  3UNG C;  3NMK A;  1I6H C;  3T6G B;  4BPM A;  4DDQ A;  1HW1 A;  2GAH C;  3T01 A;  4U5D E;  3MML B;  1XXA A;  2D5R B;  4BLA A;  3IQ5 A;  4JEA A;  2ETS A;  1TWC K;  2CGE A;  3G4X A;  2Y69 C;  2RGR A;  1YNJ A;  1Q0K A;  4U5C E;  5E3A A;  4BY7 K;  3VF0 A;  1E2X A;  2I8B A;  1LE4 A;  4MEX A;  3S9O A;  3QW1 A;  4HFF B;  1V54 C;  4KN4 A;  2YL7 A;  4CIP A;  1ZU5 A;  4KAT A;  3M3Y K;  1Z3I X;  4LLE A;  3QZC A;  2B63 K;  3GTG C;  1F9N A;  4A3J C;  4ULW A;  4BY7 C;  3PO3 C;  5JLI A;  1XZP B;  1U0B B;  3DM9 B;  2XM0 A;  5M3M K;  4BJT A;  1EH1 A;  1CPQ A;  5IP7 K;  2R93 K;  4CDV A;  3LLI A;  4PFP A;  2B63 C;  2EIK C;  3L8I A;  4M1X A;  2H7V C;  3T02 A;  1Y6D A;  2P61 A;  3C8G B;  4BLB A;  4PJM A;  3AGT A;  4DRI B;  1EK8 A;  1F1M A;  4BBS C;  1XZP A;  4I1M A;  4CS8 A;  3S1R K;  3RVY A;  3I4U A;  2A6H A;  3DXJ F;  1X31 C;  5AC4 A;  3DMD A;  4XEV A;  2D4U A;  3NG1 A;  5HL8 A;  3SNH A;  4FZB A;  2J0W A;  4LDR A;  3S1M C;  5JT4 A;  2EPK X;  256B A;  5B1A C;  1WSR A;  2A1D D;  2GAQ A;  1WWP A;  3U5S A;  3JRM O;  4WJ4 A;  4GTD A;  2XL6 A;  4MEY A;  3JTL O;  4OIR F;  1R4T A;  4C3D A;  4LLG A;  4U5H A;  4BJ5 C;  3G50 A;  1NSG B;  4OIP A;  1YA7 O;  1ZXO A;  4FX5 A;  5L46 A;  4KM9 A;  4FES A;  1D1A A;  4B6I A;  3FOO A;  1OW8 A;  3AH5 A;  5DQT A;  2Y3B A;  3AD9 C;  3TFJ A;  4WIL A;  3IPJ A;  1AEP A;  1I4Z A;  3TJ6 A;  1WGW A;  2YU9 A;  4CJO A;  4A3D C;  3C63 A;  3L34 A;  4JW1 A;  2VC9 A;  1ORS C;  4Q5S A;  3V5Z A;  3NDB B;  4U5B E;  1YAU O;  2R7O A;  3FXH A;  4KC9 A;  5D4D A;  1TWG A;  4KAS A;  1N1C A;  4NTA A;  4XPY A;  4XWJ A;  4C7O B;  2KC3 A;  5M5W K;  1MMN A;  4KNV A;  5BUO A;  1YX2 A;  1OKK A;  3H65 A;  1DOV A;  1Z63 A;  4XSX A;  4OIN A;  3DJN B;  2Q4F A;  1BR2 A;  2L9J A;  5A69 A;  2VUM A;  4KB4 A;  5D91 A;  2JA5 A;  3C62 A;  3JCU Q;  4IAQ A;  3TTG A;  1K05 A;  3ABK C;  2I15 A;  1D0Z A;  1NLX A;  5T1D B;  4BXX C;  1RU0 A;  1OR2 A;  1SFO A;  5A6B A;  2FGY A;  3RIP A;  5DQZ A;  4CS9 C;  2J9U A;  1B4A A;  3POV A;  1OCO C;  4YL0 A;  1EKY A;  3ITF A;  3RQF A;  4I44 A;  4ZH4 A;  2R7X A;  4JCH A;  1WTY A;  1NG1 A;  1VGX A;  1G4U S;  1A7V A;  2R92 C;  4P9F A;  3N3Y A;  5DLJ A;  1M2V A;  1E85 A;  1JR8 A;  4J7Y A;  2KW3 C;  4ILD A;  4C2M K;  4E18 A;  2YLI A;  2GSO A;  1HE9 A;  2KYH A;  4YFN A;  4FM9 A;  5IYC C;  2VH3 A;  3WG7 C;  2XCQ A;  4G7O A;  4Z9I A;  2WZF A;  1WOP A;  4XLN F;  3DE8 A;  1O26 A;  4MW3 A;  4J3N A;  4L6R A;  2JA6 C;  3K6B A;  4U5E E;  4CIH A;  3LS1 A;  2BE5 F;  3RYL A;  2B0H A;  3HOU C;  4A2N B;  4CS9 A;  1YA9 A;  2EPM X;  2WZL A;  4A3F K;  4GTC A;  1TWG K;  1V5V A;  1S7Z A;  3NKE A;  3W4Y A;  1RKE A;  1TWA K;  1TWF C;  2R7V A;  2XRH A;  4MVR A;  3US6 A;  4C7O A;  2HV6 A;  1G51 A;  3AD8 C;  2KGO A;  2ZD9 A;  1HQM A;  3S28 A;  2DYS C;  2OKU A;  4Q4Z A;  3B0U X;  1YJG A;  4O79 A;  4MVQ A;  3H3V D;  1EFW A;  2Q7R A;  2H8A A;  4OIQ A;  1E83 A;  1ZZP A;  1I4Y A;  1FMV A;  1I50 K;  4P9S A;  2Y0S D;  2IOQ A;  2M4E A;  3GWN A;  3E9V A;  1A7E A;  1ZHY A;  1D0X A;  3RFY A;  4LDQ A;  1B4B A;  2ZXP A;  3Q6N A;  4A3I K;  2HFI A;  5C3E K;  4MVS A;  1I50 C;  5JVE A;  1GE9 A;  3DD7 A;  3C8G A;  4NTF A;  1O2A A;  2GWW A;  3V7O A;  4NOI A;  1QVX A;  1JQW A;  4AE4 A;  2V6T A;  4AE4 B;  4C3I C;  4WAB A;  5CHP A;  3LAJ A;  5FJ8 K;  3DI5 A;  3EFO B;  5M3F K;  4J7T A;  4YT5 A;  3GM1 A;  5BQG A;  3OPF A;  5C4X C;  1BZ4 A;  2XLD A;  2AVK A; 
#chains in the Genus database with same CATH homology
 1FFT C;  4LAC B;  2V3C C;  1Z6A A;  4OIP F;  1MND A;  3LS0 A;  4KM8 A;  2E2H A;  2Q9B A;  2WVQ A;  3GAN A;  3BUE A;  2JA6 A;  4WJ0 A;  1Z23 A;  3DZA A;  2W9Y A;  1NU9 C;  1I3Q A;  3KMI A;  3EGD A;  2IXM A;  4XTK A;  4ZLC A;  1FFH A;  4DBQ A;  5IOQ A;  2Q9A A;  4U5F E;  1RJ9 B;  3DAF A;  3Q7L A;  3M1C B;  2J46 A;  3F46 A;  3JRT A;  4X0R A;  2CFA A;  4PJL A;  1J8Y F;  3EJN A;  3UGO A;  1ZVU A;  4KMH A;  3GTJ A;  1SF8 A;  1M56 C;  5CI8 A;  1O29 A;  5KYY A;  2PFD A;  2VB6 A;  2ZXR A;  3GTQ A;  1WQG A;  3W2W A;  4OD5 A;  2MWQ A;  2GSN A;  2GFH A;  4EBB A;  4KDD A;  2B63 A;  1ZYR F;  2Y3P A;  1JPJ A;  4K0D A;  1OCR C;  2EIN C;  4JZA A;  4QDL A;  3JSZ A;  4G7Z F;  3KL4 A;  3AQC A;  4YJW A;  2R7U A;  3FHZ A;  4GTF A;  1MNE A;  4K7B A;  5EHH A;  2ZXW C;  3HJC A;  1WQF A;  4BKW A;  2IXO A;  3ECS A;  2W4M A;  3OEP A;  3W2V A;  3FHD A;  4PK4 A;  3T4R A;  3ZC4 A;  2CNW A;  5JVO A;  4I3M A;  4ANJ A;  1IS1 A;  3EH2 A;  4OIO F;  5CI9 A;  4GTA A;  3N0C A;  3FDQ A;  2NUP A;  4LER A;  3S29 A;  2XCR B;  1OCC C;  1VMA A;  3UMI A;  2G62 A;  4KMD A;  5KYU A;  4PFO A;  5B3S C;  1TKN A;  2X51 A;  1TWF A;  3EZI A;  1SZI A;  3VAY A;  2R7T A;  4GTB A;  4LR2 A;  2A69 F;  5B1B C;  4MND A;  3K1H A;  2VAS A;  2Y3G A;  5E33 A;  3UNG C;  5D92 A;  1WQH A;  3S0X A;  2R7R A;  1IZM A;  1BGW A;  3GTP A;  3N0B A;  2XL4 A;  4DDQ A;  3O6X A;  3NUH A;  3AG4 C;  3EGX B;  2WVN A;  2HV7 A;  2NUT B;  4U5D E;  4YT2 A;  3MML B;  3GTG A;  3ZIB A;  1TWH A;  1XXA A;  4DVY P;  2D5R B;  3HLZ A;  4BLA A;  3ERE D;  3GTL A;  2J9V A;  5JFE A;  1VK5 A;  3H0G A;  1D1C A;  2CGE A;  2JA7 A;  1TR2 A;  2J0X A;  2PP4 A;  2OCC C;  3K1I C;  3EHN A;  4ZLD A;  4QI2 A;  3NKD A;  3RKO F;  2CNW D;  2Y69 C;  3SZR A;  3PHF 2;  2Q9C A;  4YWQ A;  2RGR A;  3NYL A;  4O6Y A;  4U5C E;  5E3A A;  4NY3 A;  4G0V A;  1VYI A;  2I8B A;  5T3T A;  1Z5Z A;  4HFF B;  1V54 C;  4U5G A;  1ZU5 A;  4KAT A;  1Z3I X;  4G0U A;  4LLE A;  3QZC A;  3FKI A;  4DOZ A;  1SMY F;  2DYR C;  1F9N A;  3V4G A;  4ULW A;  3UGP A;  4GEH A;  2A6H F;  3X1O A;  4BEJ A;  3DM9 B;  2A6E F;  2L81 A;  3AQP A;  5IOT A;  2IXP A;  3NYJ A;  1Y1V A;  4BJ1 A;  2KJG A;  4BJT A;  1EH1 A;  2R7Q A;  5KYX A;  1W2W A;  2ZPA A;  4MQ9 F;  1LVK A;  1O87 A;  3LLI A;  4PFP A;  1PD0 A;  2C03 A;  2FFH A;  2IXN A;  1NZE A;  2EIK C;  4HE8 D;  4M1X A;  2Y3D A;  4EWC A;  3ABL C;  4KAR A;  2G3K A;  2H7V C;  3GOD A;  2WL8 A;  2WZG A;  2NVX A;  3T6J A;  4HEA J;  4BLB A;  4PJM A;  1K83 A;  2JD3 A;  3KH2 A;  2A68 F;  1EK8 A;  4FWV A;  4Q7C A;  4LQY A;  3EZH A;  2R7W A;  4O6N A;  4I1M A;  3AQB A;  4I1O B;  4CS8 A;  2XSE A;  5KYY B;  5L3Q A;  2O9X A;  4IJJ A;  5E3C A;  1LS1 A;  3X2Q C;  2YZS A;  3EHM A;  4GTE A;  3I4U A;  3EH1 A;  3DXJ F;  3LAY A;  1R9T A;  3CAG A;  3DMD A;  4KAW X;  2H7B A;  4OIN F;  3NG1 A;  3IEE A;  2Y3H A;  4W8K A;  3SNH A;  1PD1 A;  2J0W A;  4XLP F;  1VYK A;  4Q5S F;  4FZB A;  4IAO A;  3ABM C;  3JYH A;  2KWA A;  4GTL A;  5B1A C;  2A1D D;  3N24 A;  3TD7 A;  5CJ9 A;  4GTD A;  3GTM A;  4OIR F;  3ZSU A;  5IOR A;  4RBN A;  4C3D A;  4U5H A;  5E2Q A;  2G3V A;  4BJ5 C;  3EFO A;  3O39 A;  4AX2 A;  1AB4 A;  2GSU A;  4KC6 A;  4PJN A;  4BJ5 A;  1ZXO A;  2R92 A;  4FX5 A;  1KU2 A;  3CSK A;  1O5H A;  1I50 A;  4KM9 A;  1NU7 D;  2KQ9 A;  4KI2 A;  4FES A;  1D1A A;  2XCO A;  4B6I A;  5F5H A;  4GFQ A;  3AH5 A;  5DQT A;  2Y3B A;  4YT8 A;  2NUT A;  4H4K C;  3EGD B;  3ORE A;  4CSA A;  1WGW A;  2YU9 A;  3NYM A;  4CS7 A;  2V26 A;  4AK9 A;  1ISE A;  3L34 A;  4JW1 A;  2Y39 A;  3OWT A;  2J7P A;  3NDB B;  4U5B E;  2R7O A;  4KC9 A;  3UR3 C;  1TWG A;  4F4B A;  1ZHW A;  2EIL C;  3SYN A;  4KAS A;  1N1C A;  4XWJ A;  4C7O B;  4CBE A;  4M63 A;  1MMN A;  3PMR A;  2NVY A;  4KNV A;  3EGX A;  3UMK A;  5BUO A;  1ZBS A;  1MMA A;  2J7P D;  4DVZ A;  1OKK A;  1QZX A;  4E7S A;  3LEV A;  5DS6 A;  4HFK B;  3H65 A;  2NG1 A;  3VYW A;  4YN0 B;  4C2M C;  4PJJ A;  4G7O F;  1Z63 A;  2B0J A;  2CW0 F;  3DJN B;  1BJT A;  5KYW B;  4P5B A;  4Q4Z F;  1BR2 A;  2L9J A;  2VUM A;  4KB4 A;  3GTK A;  3L4K A;  5D91 A;  2E2I A;  2JA5 A;  4OD4 A;  3JCU Q;  1J8M F;  3EG9 B;  3DAG A;  1ZHZ A;  3ABK C;  5T1D B;  1D0Z A;  3KKB A;  2P7V A;  4C3E A;  1ZHT A;  3GTO A;  5DS4 A;  1ST6 A;  2MYS A;  3Q6M A;  1MMG A;  3K7D A;  3AG1 C;  1SFO A;  1O2B A;  2FGY A;  3DJU B;  3RIP A;  3JT1 A;  5DQZ A;  4CS9 C;  3F47 A;  2CDQ A;  3NRH A;  2J9U A;  3ASN C;  2QTV A;  1O25 A;  3N0T A;  3MX3 A;  1TWA A;  1B4A A;  3POV A;  1JPN A;  1OCO C;  5KYN A;  3ITF A;  3B9Q A;  4I44 A;  2R7X A;  1M57 C;  4JCH A;  3G4A A;  3I5P A;  4C3H C;  3E70 C;  1NG1 A;  5KYU B;  5IY5 C;  2R93 A;  3N3Y A;  5DLJ A;  4IRU A;  4RDA A;  3FOF A;  4JVS A;  1M2V A;  3LPX A;  4LLC A;  4O7G A;  1PCX A;  3FOE A;  3B0P A;  4CSA C;  2KW3 C;  4ILD A;  3LAP A;  4KNW A;  1VOM A;  2ZXO A;  2GSO A;  4FM9 A;  2EIM C;  1QLE C;  2QY9 A;  2VH3 A;  4C3B A;  3AG2 C;  3WG7 C;  1FTS A;  4E7Z A;  2NUP B;  3B0V C;  4G7H F;  4RD9 A;  2XCQ A;  2W45 A;  1FMW A;  5L3V A;  2WZF A;  4XLN F;  4JUR I;  3UMH A;  4C3J C;  4KB2 A;  2PX3 A;  2J9W A;  2PHC B;  2C04 A;  1OCZ C;  4OIQ F;  1O26 A;  5KYX B;  5EGY A;  1O27 A;  2WB7 A;  4J32 B;  3G4C A;  1M2V B;  3W8H A;  4J3N A;  1LKX A;  2E87 A;  3K6B A;  1BR4 A;  3EPV A;  4U5E E;  4CIH A;  4JJG A;  3ZG1 A;  3ZVR A;  3LS1 A;  3W8I A;  2ZFZ A;  1TWC A;  2BE5 F;  2PX0 A;  2W4B A;  1O24 A;  1MMD A;  3RYL A;  4A2N B;  4CS9 A;  3N2Z B;  2XXA A;  2R7Z A;  1IW7 F;  5DS5 A;  2XXA B;  2OG2 A;  2WVO A;  2WZL A;  4GTC A;  1S7Z A;  4GT9 A;  3VA7 A;  2P5M A;  4KBL A;  3NKE A;  1ZHX A;  2CFA B;  5T3W A;  3HTK C;  3WOD F;  3I5Q A;  2R7V A;  2XRH A;  3EQL F;  4J30 B;  4CS8 C;  4YT4 A;  3K33 A;  4C7O A;  5F5F A;  3OEO A;  1Y1W A;  2HV6 A;  4KMA A;  1BR1 A;  3K66 A;  2KGO A;  4P6I C;  3L0I A;  3S28 A;  4G0W A;  2DYS C;  1OKK D;  3B0U X;  1O28 A;  4O79 A;  4BJ6 C;  3LJB A;  2P6V A;  4JJF A;  4N06 A;  5DVW A;  1M2O A;  3L4J A;  2EIJ C;  1D1B A;  2IYL D;  1RJ9 A;  3ASO C;  3LNR A;  3DM5 A;  1FMV A;  2YHS A;  3Q3Q A;  2YEV A;  2H7O A;  3Q7G A;  3SEO A;  2IOQ A;  1D0Y A;  2J45 A;  3SP1 A;  2M4E A;  3LLK A;  3AG3 C;  3S27 A;  1KQ4 A;  3E9V A;  1WIH A;  1ZHY A;  3AQO A;  2Z15 A;  5HSW A;  1XXC A;  1D0X A;  3RFY A;  2RH6 A;  3EG9 A;  1B4B A;  2ZXP A;  3Q6N A;  2PF4 E;  1DD5 A;  3T6B A;  2LSE A;  4BJ6 A;  1GE9 A;  3LES A;  2DGJ A;  3DD7 A;  1O2A A;  5IOS A;  3CZ6 A;  3V7O A;  1V55 C;  3QX3 A;  5TJ3 A;  2R7S A;  2Q3T A;  2JH3 A;  3FAJ A;  4BG0 A;  1WCM A;  4P5A A;  1XXB A;  4AE4 A;  3CQZ A;  5EGE A;  4AE4 B;  4C3I C;  5FCL A;  5CHP A;  3LAJ A;  4G0H A;  3EFO B;  2KNH A;  4YT5 A;  1G8X A;  4IWB A;  3FVY A;  5KYW A;  1ZU4 A;  3OPF A;  3MLG A;  3RH3 A;  4DBR A;  3QMK A;  5EGH A;  3OA1 A;  4QI0 A;  4O6M A;  4GYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...