3S15K

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s15K00
2PA8D 1K83C 1Y1WC 5IYCC 4C3JK 2WAQD 5FJ8K 2JA5K 4Y7NC 1TWGK 1YNJA 3M4OK 3M4OC 3EQLA 1TWHC 4A3IC 4Y7NK 2B63K 2NVTK 3HOXK 3GTOK 1R9TK 3GTLK 4A3DC 4BBRK 1R9TC 1TWAC 1TWAK 4QJVB 4XSZA 2PPBA 2B63C 4JK1A 4QIWD 1XPPA 2E2JC 2NVXC 4XLPA 2E2JK 2WB1D 4QIWL 3GTKC 1WCMK 2A68A 2YU9C 4Y52C 3HOYK 4MEXA 4OINA 4ZH4A 5IYDK 4YFXA 3S15K 4A3BC 2E2IK 5M3MK 1IW7A 1SMYA 3CQZK 2R7ZK 3GTOC 2O5IA 3RZDK 3S2DK 1I6HC 4A3MC 3PO3C 5FLMK 2R92C 3WODA 3S16K 3S16C 5C4JK 5C44C 1TWFC 5FLMC 4A3KK 2JA8C 2R92K 3GTGC 4A3LC 3H0GK 3S1RC 4BY7K 4LJZA 2R93C 1I6VA 2R7ZC 3GTPK 3GTGK 4KN7A 3S1QC 3H0GC 4OIQA 2A6EA 3K7AK 4C2MK 2E2HK 3HOZK 3S14K 3S14C 5M3FK 4OIRA 2BE5A 4MQ9A 3GTJK 3HOUK 4X6AC 4KN4A 5TMFA 4A3JC 3H3VL 3S2HK 3S2DC 4C3HK 5C3EK 4AYBL 1SFOK 2E2IC 2VUMC 3GTMC 5IP7K 4A93K 1Y1VC 4LK0A 4BXXK 2A6HA 4BBRC 4MEYA 3DXJA 4XSXA 5C44K 4A3KC 2JA8K 3GTLC 2WAQL 3GTQK 3PO2K 4BBSK 1I50C 2PA8L 5IP9K 4C3IK 3FKIC 4G7OA 2NVXK 4A3FK 4A3FC 3FKIK 3HKZD 1TWCC 5IYCK 4A3CC 3S17K 4G7HA 3S1NK 2PMZL 3S15C 4KMUA 3S17C 3RZOK 3RZOC 3S1MK 1Y1VK 4A3BK 3S1MC 5IYDC 5TMCA 3GTKK 3S1NC 4Y52K 3H3VD 2JA7C 3S2HC 4A3CK 2NVQK 3HOXC 1TWGC 1I50K 5IP9C 1TWHK 4LLGA 4A3IK 2NVQC 4G7ZA 4A3EK 4YFNA 5IYBK 3I4NC 2CW0A 4OIPA 1Y1WK 3HOVC 3PO2C 4BBSC 3GTQC 4A3DK 1HQMA 2PMZD 5C4XK 1SFOC 2NVYK 2JA6K 4BXXC 2R93K 2NVTC 1TWCK 3GTJC 3HKZL 3HOUC 3HOWC 3I4MK 2O5JA 1BDFA 4BY1C 2JA5C 3K7AC 2E2HC 3HOZC 1K83K 4Q5SA 3M3YC 4QJVA 3GTPC 4OIOA 5M5YK 5IP7C 4A93C 1I3QK 1I3QC 5C3EC 4AYBD 2VUMK 3GTMK 1YNNA 4LK1A 5D4DA 4A3JK 3CQZC 4GZYA 4X6AK 1TWFK 4A3LK 3S1RK 4BY7C 5C4JC 2A69A 4NOIA 3HOVK 5M5WK 4YFKA 2Y0SD 5IYBC 2WB1L 5M5XK 4A3MK 3I4NK 3PO3K 3I4MC 4A3GC 3S1QK 3RZDC 4BY1K 4Q4ZA 1I6HK 2Y0SL 2NVYC 2JA7K 2JA6C 3HOWK 5C4XC 1ZYRA 4A3GK 1WCMC 2YU9K 3HOYC 3M3YK 4A3EC 4XLNA 4YG2A
chains in the Genus database with same CATH superfamily
2PA8D 1EH1A 1Y1WC 5FJ8K 1ZQ1C 4XCHA 1YNJA 3GTOA 4Y7NK 5EGEA 3BP8C 4A3DC 1R9TC 1TWAK 2P8TA 2PPBA 1J98A 2GSOA 4QIWD 2E2HA 2NVXC 1O28A 1ZVUA 3LAPA 2E2JK 1WCMK 2A68A 4OINA 1R9TA 2W7VA 5M3MK 1IW7A 1WSRA 3S2DK 3VA7A 5FLMC 2R92K 3GTGC 1F7VA 1WOOA 3S1RC 4O2DA 3OPFA 1O29A 1I6VA 3GTGK 3S1QC 2A6EA 2CFAA 4LR2A 4OIRA 2BE5A 4GTEA 4X6AC 4KN4A 3S2HK 5IOQA 2VUMC 1IQ0A 4A93K 4MEYA 3LPXA 4XSXA 1XXAA 3PO2K 2PA8L 1HI9A 4KM8A 1WORA 4A3FC 3JSTA 1JQWA 3S17K 2PMZL 3RZOK 4G0UA 1PJ6A 5TMCA 1XXCA 1I50A 3TFIA 3H3VD 4P9SA 2JA7C 1O25A 2GAGC 1TWFA 4KM9A 1TWHK 2ZUFA 3IPJA 1WQGA 1Y1VA 4KMAA 1Y1WK 1L0WA 2NVXA 4GTAA 1SFOC 3BUEA 1EQRA 3I4MK 4GT9A 3HXAA 4BY1C 2E2HC 1GE9A 2R93A 2PHCB 3GTMA 1SFOA 2JA7A 1VGXA 5IP7C 1I3QC 2VUMK 4C3HC 5D4DA 4A3LK 3S1RK 5C4JC 3AQOA 1TWCA 5M5XK 3S1QK 4A3GK 2YU9K 3M3YK 3T00A 4GTBA 1K83C 3T02A 2JA5K 3M4OC 3GEEA 2NVTK 2ZUEA 4BLAA 4BBRK 1TWAC 5IOSA 4QJVB 1WSVA 1XPPA 1YCLA 4KDDA 3GTQA 4XLPA 4LQYA 4M1XA 2EBBA 3GTKC 2YU9C 5IYDK 1TWGA 4YFXA 3CQZK 2R7ZK 2B63A 4KAWX 1YX2A 2O5IA 3AQPA 2R7ZA 4PAAA 1WOPA 2KWAA 3SZZA 4GFQA 3WODA 5C4JK 5C44C 3N3YA 3SZYA 4A3KK 2JA8C 4BY7K 4LJZA 4P5AA 2R93C 1RU0A 3N0CA 3HOZK 3AH5A 3S14K 4MQ9A 1EFWA 3H3VL 2E2IC 1Y1VC 4BXXK 2A6HA 4BBRC 1TWHA 5C44K 4A3KC 2NVYA 2JA8K 1I50C 4G7OA 4C3IK 3FKIC 4A3FK 1WCMA 2YU9A 1O26A 2E2IA 4G7HA 3S17C 3S1MK 2CFAB 4G0VA 1J6WA 3BP3A 3MMLB 1F7UA 2NVQK 3HOXC 1O2AA 5IYBK 3I4NC 4OIPA 3S0XA 1ZXOA 5C4XK 4J3NA 4BKWA 2NVYK 1VLOA 2R93K 2NVTC 1XZQB 3GTJC 2O5JA 1BDFA 3NUHA 3K7AC 3M3YC 2XCRB 1USMA 1PJ5A 1I3QK 5HL8A 1YNNA 4LK1A 4GZYA 4X6AK 1F9NA 1TWFK 2P5MA 5JFEA 4BY7C 3ERED 4YFKA 2Y0SD 2JH3A 1VJEA 3I4MC 1XXBA 4ILDA 4BY1K 2JA6C 3GTLA 1XZPA 1B4AA 3A8KA 1ZYRA 3HOYC 4YG2A 4C3JK 2WAQD 3FOEA 1TWGK 3M4OK 4KC6A 4A3IC 3CQZA 2B63K 1IE0A 3GTOK 3GTLK 5IOTA 1O2FB 4GTCA 3GTGA 2B63C 4KARA 4GTDA 2R92A 3HOYK 1I3QA 4Y52C 4ZH4A 3S15K 4A3BC 4KB4A 3RZDK 1I6HC 4A3MC 3PO3C 3GEIA 3S16C 4A3LC 1X31C 3G4CA 3GIRA 1UV7A 2R7ZC 4KATA 2Y3PA 2GSUA 4OIQA 2FQOA 2E2HK 4C2MK 3S14C 5M3FK 3L4JA 3A8JA 3FKIA 3GTJK 1C0AA 5TMFA 4A3JC 2GAHC 4WJ4A 4C3HK 3GTMC 1SFOK 1USOA 5IP7K 3V4GA 4FM9A 3GTQK 2WAQL 5IP9K 2NVXK 1WQHA 3FKIK 3GTJA 3AD9C 4P5BA 1K83A 4A3CC 3QX3A 1IBAA 2XCQA 1DCPA 3TFHA 3S1NK 3S15C 4A3BK 4A3GC 3S1MC 4KASA 4Y52K 1Y1VK 2XCOA 5IYDC 3GTKK 3G4AA 1O24A 4A3CK 1VH2A 1I50K 4LLGA 2NVQC 4KMHA 5CJ9A 3HOVC 4BBSC 3GTQC 1HQMA 2PMZD 3Q3QA 3GTKA 1TWCK 3HOUC 1TWAA 3HOWC 3AD8C 2JA5C 4C2MC 1K83K 2VUMA 3GTPC 4FZBA 2RGRA 5IORA 4OIOA 5M5YK 4A93C 1VRQC 3GTMK 1XZQA 4A3JK 3CQZC 5TJ3A 4G0WA 4NOIA 3HOVK 5M5WK 4LOWA 2WB1L 3ADAC 3RZDC 1I6HK 2Y0SL 1ISEA 3HOWK 1DD5A 3OREA 2GSNA 1DCOA 4A3EC 4XLNA 2FQTA 5E68A 5IYCC 4Y7NC 1INNA 3EQLA 1F93A 1TWHC 3HOXK 3FHZA 1R9TK 1B4BA 4XSZA 1J6XA 4JK1A 1WQFA 2E2JC 4BLBA 4KB2A 3LAJA 2WB1D 4QIWL 4MEXA 2E2IK 1SMYA 3GTOC 4DDQA 1PJ7A 4C3IC 1WIHA 5FLMK 2R92C 3S16K 4KMDA 1TWFC 3H0GK 2ZFZA 3GTPK 4KN7A 3H0GC 3K7AK 2V6TA 2RH6A 1AB4A 3HOUK 3GEHA 1XZPB 3S2DC 5C3EK 1IS1A 4AYBL 1V5VA 4LK0A 5JVOA 3DXJA 3L4KA 2V6SA 4PABA 3GTLC 2JA6A 4BBSK 1EI6A 3FOFA 3HKZD 1TWCC 5IYCK 1BS2A 2JA5A 3H0GA 4KMUA 1IL2A 3RZOC 3T01A 3S1NC 1JOEA 3S2HC 1TWGC 5IP9C 4C3JC 4A3IK 1KQ4A 4GTFA 4G7ZA 4A3EK 3CAGA 4YFNA 2CW0A 1EK8A 2V6UA 4WILA 3PO2C 1O27A 4AH6A 4A3DK 2D6FC 1J6VA 1BGWA 2JA6K 1O2BA 4BXXC 5L46A 4WJ3M 5EGHA 3HKZL 3OEPA 1ZBSA 3HOZC 4Q5SA 4QJVA 1G51A 5C3EC 4AYBD 3GSIA 3TFJA 4C45A 1JVIA 3AD7C 2A69A 1WOSA 4RMFA 1DCHA 5IYBC 4A3MK 3I4NK 3PO3K 1Y1WA 3GTPA 3TTGA 4GTLA 4Q4ZA 1BJTA 2NVYC 2JA7K 5CHPA 5C4XC 3A8IA 3GDZA 3N0BA 1WCMC
chains in the Genus database with same CATH topology
2PA8D 1K83C 1Y1WC 5IYCC 4C3JK 2WAQD 5FJ8K 2JA5K 4Y7NC 1TWGK 1YNJA 3M4OK 3M4OC 3EQLA 1TWHC 4A3IC 4Y7NK 2B63K 2NVTK 3HOXK 3GTOK 1R9TK 3GTLK 4A3DC 4BBRK 1R9TC 1TWAC 1TWAK 4QJVB 4XSZA 2PPBA 2B63C 4JK1A 4QIWD 1XPPA 2E2JC 2NVXC 4XLPA 2E2JK 2WB1D 4QIWL 3GTKC 1WCMK 2A68A 2YU9C 4Y52C 3HOYK 4MEXA 4OINA 4ZH4A 5IYDK 4YFXA 3S15K 4A3BC 2E2IK 5M3MK 1IW7A 1SMYA 3CQZK 2R7ZK 3GTOC 2O5IA 3RZDK 3S2DK 1I6HC 4A3MC 3PO3C 5FLMK 2R92C 3WODA 3S16K 3S16C 5C4JK 5C44C 1TWFC 5FLMC 4A3KK 2JA8C 2R92K 3GTGC 4A3LC 3H0GK 3S1RC 4BY7K 4LJZA 2R93C 1I6VA 2R7ZC 3GTPK 3GTGK 4KN7A 3S1QC 3H0GC 4OIQA 2A6EA 3K7AK 4C2MK 2E2HK 3HOZK 3S14K 3S14C 5M3FK 4OIRA 2BE5A 4MQ9A 3GTJK 3HOUK 4X6AC 4KN4A 5TMFA 4A3JC 3H3VL 3S2HK 3S2DC 4C3HK 5C3EK 4AYBL 1SFOK 2E2IC 2VUMC 3GTMC 5IP7K 4A93K 1Y1VC 4LK0A 4BXXK 2A6HA 4BBRC 4MEYA 3DXJA 4XSXA 5C44K 4A3KC 2JA8K 3GTLC 2WAQL 3GTQK 3PO2K 4BBSK 1I50C 2PA8L 5IP9K 4C3IK 3FKIC 4G7OA 2NVXK 4A3FK 4A3FC 3FKIK 3HKZD 1TWCC 5IYCK 4A3CC 3S17K 4G7HA 3S1NK 2PMZL 3S15C 4KMUA 3S17C 3RZOK 3RZOC 3S1MK 1Y1VK 4A3BK 3S1MC 5IYDC 5TMCA 3GTKK 3S1NC 4Y52K 3H3VD 2JA7C 3S2HC 4A3CK 2NVQK 3HOXC 1TWGC 1I50K 5IP9C 1TWHK 4LLGA 4A3IK 2NVQC 4G7ZA 4A3EK 4YFNA 5IYBK 3I4NC 2CW0A 4OIPA 1Y1WK 3HOVC 3PO2C 4BBSC 3GTQC 4A3DK 1HQMA 2PMZD 5C4XK 1SFOC 2NVYK 2JA6K 4BXXC 2R93K 2NVTC 1TWCK 3GTJC 3HKZL 3HOUC 3HOWC 3I4MK 2O5JA 1BDFA 4BY1C 2JA5C 3K7AC 2E2HC 3HOZC 1K83K 4Q5SA 3M3YC 4QJVA 3GTPC 4OIOA 5M5YK 5IP7C 4A93C 1I3QK 1I3QC 5C3EC 4AYBD 2VUMK 3GTMK 1YNNA 4LK1A 5D4DA 4A3JK 3CQZC 4GZYA 4X6AK 1TWFK 4A3LK 3S1RK 4BY7C 5C4JC 2A69A 4NOIA 3HOVK 5M5WK 4YFKA 2Y0SD 5IYBC 2WB1L 5M5XK 4A3MK 3I4NK 3PO3K 3I4MC 4A3GC 3S1QK 3RZDC 4BY1K 4Q4ZA 1I6HK 2Y0SL 2NVYC 2JA7K 2JA6C 3HOWK 5C4XC 1ZYRA 4A3GK 1WCMC 2YU9K 3HOYC 3M3YK 4A3EC 4XLNA 4YG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PA8 D;  1K83 C;  1Y1W C;  5IYC C;  4C3J K;  2WAQ D;  5FJ8 K;  2JA5 K;  4Y7N C;  1TWG K;  1YNJ A;  3M4O K;  3M4O C;  3EQL A;  1TWH C;  4A3I C;  4Y7N K;  2B63 K;  2NVT K;  3HOX K;  3GTO K;  1R9T K;  3GTL K;  4A3D C;  4BBR K;  1R9T C;  1TWA C;  1TWA K;  4QJV B;  4XSZ A;  2PPB A;  2B63 C;  4JK1 A;  4QIW D;  1XPP A;  2E2J C;  2NVX C;  4XLP A;  2E2J K;  2WB1 D;  4QIW L;  3GTK C;  1WCM K;  2A68 A;  2YU9 C;  4Y52 C;  3HOY K;  4MEX A;  4OIN A;  4ZH4 A;  5IYD K;  4YFX A;  3S15 K;  4A3B C;  2E2I K;  5M3M K;  1IW7 A;  1SMY A;  3CQZ K;  2R7Z K;  3GTO C;  2O5I A;  3RZD K;  3S2D K;  1I6H C;  4A3M C;  3PO3 C;  5FLM K;  2R92 C;  3WOD A;  3S16 K;  3S16 C;  5C4J K;  5C44 C;  1TWF C;  5FLM C;  4A3K K;  2JA8 C;  2R92 K;  3GTG C;  4A3L C;  3H0G K;  3S1R C;  4BY7 K;  4LJZ A;  2R93 C;  1I6V A;  2R7Z C;  3GTP K;  3GTG K;  4KN7 A;  3S1Q C;  3H0G C;  4OIQ A;  2A6E A;  3K7A K;  4C2M K;  2E2H K;  3HOZ K;  3S14 K;  3S14 C;  5M3F K;  4OIR A;  2BE5 A;  4MQ9 A;  3GTJ K;  3HOU K;  4X6A C;  4KN4 A;  5TMF A;  4A3J C;  3H3V L;  3S2H K;  3S2D C;  4C3H K;  5C3E K;  4AYB L;  1SFO K;  2E2I C;  2VUM C;  3GTM C;  5IP7 K;  4A93 K;  1Y1V C;  4LK0 A;  4BXX K;  2A6H A;  4BBR C;  4MEY A;  3DXJ A;  4XSX A;  5C44 K;  4A3K C;  2JA8 K;  3GTL C;  2WAQ L;  3GTQ K;  3PO2 K;  4BBS K;  1I50 C;  2PA8 L;  5IP9 K;  4C3I K;  3FKI C;  4G7O A;  2NVX K;  4A3F K;  4A3F C;  3FKI K;  3HKZ D;  1TWC C;  5IYC K;  4A3C C;  3S17 K;  4G7H A;  3S1N K;  2PMZ L;  3S15 C;  4KMU A;  3S17 C;  3RZO K;  3RZO C;  3S1M K;  1Y1V K;  4A3B K;  3S1M C;  5IYD C;  5TMC A;  3GTK K;  3S1N C;  4Y52 K;  3H3V D;  2JA7 C;  3S2H C;  4A3C K;  2NVQ K;  3HOX C;  1TWG C;  1I50 K;  5IP9 C;  1TWH K;  4LLG A;  4A3I K;  2NVQ C;  4G7Z A;  4A3E K;  4YFN A;  5IYB K;  3I4N C;  2CW0 A;  4OIP A;  1Y1W K;  3HOV C;  3PO2 C;  4BBS C;  3GTQ C;  4A3D K;  1HQM A;  2PMZ D;  5C4X K;  1SFO C;  2NVY K;  2JA6 K;  4BXX C;  2R93 K;  2NVT C;  1TWC K;  3GTJ C;  3HKZ L;  3HOU C;  3HOW C;  3I4M K;  2O5J A;  1BDF A;  4BY1 C;  2JA5 C;  3K7A C;  2E2H C;  3HOZ C;  1K83 K;  4Q5S A;  3M3Y C;  4QJV A;  3GTP C;  4OIO A;  5M5Y K;  5IP7 C;  4A93 C;  1I3Q K;  1I3Q C;  5C3E C;  4AYB D;  2VUM K;  3GTM K;  1YNN A;  4LK1 A;  5D4D A;  4A3J K;  3CQZ C;  4GZY A;  4X6A K;  1TWF K;  4A3L K;  3S1R K;  4BY7 C;  5C4J C;  2A69 A;  4NOI A;  3HOV K;  5M5W K;  4YFK A;  2Y0S D;  5IYB C;  2WB1 L;  5M5X K;  4A3M K;  3I4N K;  3PO3 K;  3I4M C;  4A3G C;  3S1Q K;  3RZD C;  4BY1 K;  4Q4Z A;  1I6H K;  2Y0S L;  2NVY C;  2JA7 K;  2JA6 C;  3HOW K;  5C4X C;  1ZYR A;  4A3G K;  1WCM C;  2YU9 K;  3HOY C;  3M3Y K;  4A3E C;  4XLN A;  4YG2 A; 
#chains in the Genus database with same CATH topology
 2PA8 D;  1EH1 A;  1Y1W C;  5FJ8 K;  1ZQ1 C;  4XCH A;  1YNJ A;  3GTO A;  4Y7N K;  5EGE A;  3BP8 C;  4A3D C;  1R9T C;  1TWA K;  2P8T A;  2PPB A;  1J98 A;  2GSO A;  4QIW D;  2E2H A;  2NVX C;  1O28 A;  1ZVU A;  3LAP A;  2E2J K;  1WCM K;  2A68 A;  4OIN A;  1R9T A;  2W7V A;  5M3M K;  1IW7 A;  1WSR A;  3S2D K;  3VA7 A;  5FLM C;  2R92 K;  3GTG C;  1F7V A;  1WOO A;  3S1R C;  4O2D A;  3OPF A;  1O29 A;  1I6V A;  3GTG K;  3S1Q C;  2A6E A;  2CFA A;  4LR2 A;  4OIR A;  2BE5 A;  4GTE A;  4X6A C;  4KN4 A;  3S2H K;  5IOQ A;  2VUM C;  1IQ0 A;  4A93 K;  4MEY A;  3LPX A;  4XSX A;  1XXA A;  3PO2 K;  2PA8 L;  1HI9 A;  4KM8 A;  1WOR A;  4A3F C;  3JST A;  1JQW A;  3S17 K;  2PMZ L;  3RZO K;  4G0U A;  1PJ6 A;  5TMC A;  1XXC A;  1I50 A;  3TFI A;  3H3V D;  4P9S A;  2JA7 C;  1O25 A;  2GAG C;  1TWF A;  4KM9 A;  1TWH K;  2ZUF A;  3IPJ A;  1WQG A;  1Y1V A;  4KMA A;  1Y1W K;  1L0W A;  2NVX A;  4GTA A;  1SFO C;  3BUE A;  1EQR A;  3I4M K;  4GT9 A;  3HXA A;  4BY1 C;  2E2H C;  1GE9 A;  2R93 A;  2PHC B;  3GTM A;  1SFO A;  2JA7 A;  1VGX A;  5IP7 C;  1I3Q C;  2VUM K;  4C3H C;  5D4D A;  4A3L K;  3S1R K;  5C4J C;  3AQO A;  1TWC A;  5M5X K;  3S1Q K;  4A3G K;  2YU9 K;  3M3Y K;  3T00 A;  4GTB A;  1K83 C;  3T02 A;  2JA5 K;  3M4O C;  3GEE A;  2NVT K;  2ZUE A;  4BLA A;  4BBR K;  1TWA C;  5IOS A;  4QJV B;  1WSV A;  1XPP A;  1YCL A;  4KDD A;  3GTQ A;  4XLP A;  4LQY A;  4M1X A;  2EBB A;  3GTK C;  2YU9 C;  5IYD K;  1TWG A;  4YFX A;  3CQZ K;  2R7Z K;  2B63 A;  4KAW X;  1YX2 A;  2O5I A;  3AQP A;  2R7Z A;  4PAA A;  1WOP A;  2KWA A;  3SZZ A;  4GFQ A;  3WOD A;  5C4J K;  5C44 C;  3N3Y A;  3SZY A;  4A3K K;  2JA8 C;  4BY7 K;  4LJZ A;  4P5A A;  2R93 C;  1RU0 A;  3N0C A;  3HOZ K;  3AH5 A;  3S14 K;  4MQ9 A;  1EFW A;  3H3V L;  2E2I C;  1Y1V C;  4BXX K;  2A6H A;  4BBR C;  1TWH A;  5C44 K;  4A3K C;  2NVY A;  2JA8 K;  1I50 C;  4G7O A;  4C3I K;  3FKI C;  4A3F K;  1WCM A;  2YU9 A;  1O26 A;  2E2I A;  4G7H A;  3S17 C;  3S1M K;  2CFA B;  4G0V A;  1J6W A;  3BP3 A;  3MML B;  1F7U A;  2NVQ K;  3HOX C;  1O2A A;  5IYB K;  3I4N C;  4OIP A;  3S0X A;  1ZXO A;  5C4X K;  4J3N A;  4BKW A;  2NVY K;  1VLO A;  2R93 K;  2NVT C;  1XZQ B;  3GTJ C;  2O5J A;  1BDF A;  3NUH A;  3K7A C;  3M3Y C;  2XCR B;  1USM A;  1PJ5 A;  1I3Q K;  5HL8 A;  1YNN A;  4LK1 A;  4GZY A;  4X6A K;  1F9N A;  1TWF K;  2P5M A;  5JFE A;  4BY7 C;  3ERE D;  4YFK A;  2Y0S D;  2JH3 A;  1VJE A;  3I4M C;  1XXB A;  4ILD A;  4BY1 K;  2JA6 C;  3GTL A;  1XZP A;  1B4A A;  3A8K A;  1ZYR A;  3HOY C;  4YG2 A;  4C3J K;  2WAQ D;  3FOE A;  1TWG K;  3M4O K;  4KC6 A;  4A3I C;  3CQZ A;  2B63 K;  1IE0 A;  3GTO K;  3GTL K;  5IOT A;  1O2F B;  4GTC A;  3GTG A;  2B63 C;  4KAR A;  4GTD A;  2R92 A;  3HOY K;  1I3Q A;  4Y52 C;  4ZH4 A;  3S15 K;  4A3B C;  4KB4 A;  3RZD K;  1I6H C;  4A3M C;  3PO3 C;  3GEI A;  3S16 C;  4A3L C;  1X31 C;  3G4C A;  3GIR A;  1UV7 A;  2R7Z C;  4KAT A;  2Y3P A;  2GSU A;  4OIQ A;  2FQO A;  2E2H K;  4C2M K;  3S14 C;  5M3F K;  3L4J A;  3A8J A;  3FKI A;  3GTJ K;  1C0A A;  5TMF A;  4A3J C;  2GAH C;  4WJ4 A;  4C3H K;  3GTM C;  1SFO K;  1USO A;  5IP7 K;  3V4G A;  4FM9 A;  3GTQ K;  2WAQ L;  5IP9 K;  2NVX K;  1WQH A;  3FKI K;  3GTJ A;  3AD9 C;  4P5B A;  1K83 A;  4A3C C;  3QX3 A;  1IBA A;  2XCQ A;  1DCP A;  3TFH A;  3S1N K;  3S15 C;  4A3B K;  4A3G C;  3S1M C;  4KAS A;  4Y52 K;  1Y1V K;  2XCO A;  5IYD C;  3GTK K;  3G4A A;  1O24 A;  4A3C K;  1VH2 A;  1I50 K;  4LLG A;  2NVQ C;  4KMH A;  5CJ9 A;  3HOV C;  4BBS C;  3GTQ C;  1HQM A;  2PMZ D;  3Q3Q A;  3GTK A;  1TWC K;  3HOU C;  1TWA A;  3HOW C;  3AD8 C;  2JA5 C;  4C2M C;  1K83 K;  2VUM A;  3GTP C;  4FZB A;  2RGR A;  5IOR A;  4OIO A;  5M5Y K;  4A93 C;  1VRQ C;  3GTM K;  1XZQ A;  4A3J K;  3CQZ C;  5TJ3 A;  4G0W A;  4NOI A;  3HOV K;  5M5W K;  4LOW A;  2WB1 L;  3ADA C;  3RZD C;  1I6H K;  2Y0S L;  1ISE A;  3HOW K;  1DD5 A;  3ORE A;  2GSN A;  1DCO A;  4A3E C;  4XLN A;  2FQT A;  5E68 A;  5IYC C;  4Y7N C;  1INN A;  3EQL A;  1F93 A;  1TWH C;  3HOX K;  3FHZ A;  1R9T K;  1B4B A;  4XSZ A;  1J6X A;  4JK1 A;  1WQF A;  2E2J C;  4BLB A;  4KB2 A;  3LAJ A;  2WB1 D;  4QIW L;  4MEX A;  2E2I K;  1SMY A;  3GTO C;  4DDQ A;  1PJ7 A;  4C3I C;  1WIH A;  5FLM K;  2R92 C;  3S16 K;  4KMD A;  1TWF C;  3H0G K;  2ZFZ A;  3GTP K;  4KN7 A;  3H0G C;  3K7A K;  2V6T A;  2RH6 A;  1AB4 A;  3HOU K;  3GEH A;  1XZP B;  3S2D C;  5C3E K;  1IS1 A;  4AYB L;  1V5V A;  4LK0 A;  5JVO A;  3DXJ A;  3L4K A;  2V6S A;  4PAB A;  3GTL C;  2JA6 A;  4BBS K;  1EI6 A;  3FOF A;  3HKZ D;  1TWC C;  5IYC K;  1BS2 A;  2JA5 A;  3H0G A;  4KMU A;  1IL2 A;  3RZO C;  3T01 A;  3S1N C;  1JOE A;  3S2H C;  1TWG C;  5IP9 C;  4C3J C;  4A3I K;  1KQ4 A;  4GTF A;  4G7Z A;  4A3E K;  3CAG A;  4YFN A;  2CW0 A;  1EK8 A;  2V6U A;  4WIL A;  3PO2 C;  1O27 A;  4AH6 A;  4A3D K;  2D6F C;  1J6V A;  1BGW A;  2JA6 K;  1O2B A;  4BXX C;  5L46 A;  4WJ3 M;  5EGH A;  3HKZ L;  3OEP A;  1ZBS A;  3HOZ C;  4Q5S A;  4QJV A;  1G51 A;  5C3E C;  4AYB D;  3GSI A;  3TFJ A;  4C45 A;  1JVI A;  3AD7 C;  2A69 A;  1WOS A;  4RMF A;  1DCH A;  5IYB C;  4A3M K;  3I4N K;  3PO3 K;  1Y1W A;  3GTP A;  3TTG A;  4GTL A;  4Q4Z A;  1BJT A;  2NVY C;  2JA7 K;  5CHP A;  5C4X C;  3A8I A;  3GDZ A;  3N0B A;  1WCM C; 
#chains in the Genus database with same CATH homology
 2PA8 D;  1K83 C;  1Y1W C;  5IYC C;  4C3J K;  2WAQ D;  5FJ8 K;  2JA5 K;  4Y7N C;  1TWG K;  1YNJ A;  3M4O K;  3M4O C;  3EQL A;  1TWH C;  4A3I C;  4Y7N K;  2B63 K;  2NVT K;  3HOX K;  3GTO K;  1R9T K;  3GTL K;  4A3D C;  4BBR K;  1R9T C;  1TWA C;  1TWA K;  4QJV B;  4XSZ A;  2PPB A;  2B63 C;  4JK1 A;  4QIW D;  1XPP A;  2E2J C;  2NVX C;  4XLP A;  2E2J K;  2WB1 D;  4QIW L;  3GTK C;  1WCM K;  2A68 A;  2YU9 C;  4Y52 C;  3HOY K;  4MEX A;  4OIN A;  4ZH4 A;  5IYD K;  4YFX A;  3S15 K;  4A3B C;  2E2I K;  5M3M K;  1IW7 A;  1SMY A;  3CQZ K;  2R7Z K;  3GTO C;  2O5I A;  3RZD K;  3S2D K;  1I6H C;  4A3M C;  3PO3 C;  5FLM K;  2R92 C;  3WOD A;  3S16 K;  3S16 C;  5C4J K;  5C44 C;  1TWF C;  5FLM C;  4A3K K;  2JA8 C;  2R92 K;  3GTG C;  4A3L C;  3H0G K;  3S1R C;  4BY7 K;  4LJZ A;  2R93 C;  1I6V A;  2R7Z C;  3GTP K;  3GTG K;  4KN7 A;  3S1Q C;  3H0G C;  4OIQ A;  2A6E A;  3K7A K;  4C2M K;  2E2H K;  3HOZ K;  3S14 K;  3S14 C;  5M3F K;  4OIR A;  2BE5 A;  4MQ9 A;  3GTJ K;  3HOU K;  4X6A C;  4KN4 A;  5TMF A;  4A3J C;  3H3V L;  3S2H K;  3S2D C;  4C3H K;  5C3E K;  4AYB L;  1SFO K;  2E2I C;  2VUM C;  3GTM C;  5IP7 K;  4A93 K;  1Y1V C;  4LK0 A;  4BXX K;  2A6H A;  4BBR C;  4MEY A;  3DXJ A;  4XSX A;  5C44 K;  4A3K C;  2JA8 K;  3GTL C;  2WAQ L;  3GTQ K;  3PO2 K;  4BBS K;  1I50 C;  2PA8 L;  5IP9 K;  4C3I K;  3FKI C;  4G7O A;  2NVX K;  4A3F K;  4A3F C;  3FKI K;  3HKZ D;  1TWC C;  5IYC K;  4A3C C;  3S17 K;  4G7H A;  3S1N K;  2PMZ L;  3S15 C;  4KMU A;  3S17 C;  3RZO K;  3RZO C;  3S1M K;  1Y1V K;  4A3B K;  3S1M C;  5IYD C;  5TMC A;  3GTK K;  3S1N C;  4Y52 K;  3H3V D;  2JA7 C;  3S2H C;  4A3C K;  2NVQ K;  3HOX C;  1TWG C;  1I50 K;  5IP9 C;  1TWH K;  4LLG A;  4A3I K;  2NVQ C;  4G7Z A;  4A3E K;  4YFN A;  5IYB K;  3I4N C;  2CW0 A;  4OIP A;  1Y1W K;  3HOV C;  3PO2 C;  4BBS C;  3GTQ C;  4A3D K;  1HQM A;  2PMZ D;  5C4X K;  1SFO C;  2NVY K;  2JA6 K;  4BXX C;  2R93 K;  2NVT C;  1TWC K;  3GTJ C;  3HKZ L;  3HOU C;  3HOW C;  3I4M K;  2O5J A;  1BDF A;  4BY1 C;  2JA5 C;  3K7A C;  2E2H C;  3HOZ C;  1K83 K;  4Q5S A;  3M3Y C;  4QJV A;  3GTP C;  4OIO A;  5M5Y K;  5IP7 C;  4A93 C;  1I3Q K;  1I3Q C;  5C3E C;  4AYB D;  2VUM K;  3GTM K;  1YNN A;  4LK1 A;  5D4D A;  4A3J K;  3CQZ C;  4GZY A;  4X6A K;  1TWF K;  4A3L K;  3S1R K;  4BY7 C;  5C4J C;  2A69 A;  4NOI A;  3HOV K;  5M5W K;  4YFK A;  2Y0S D;  5IYB C;  2WB1 L;  5M5X K;  4A3M K;  3I4N K;  3PO3 K;  3I4M C;  4A3G C;  3S1Q K;  3RZD C;  4BY1 K;  4Q4Z A;  1I6H K;  2Y0S L;  2NVY C;  2JA7 K;  2JA6 C;  3HOW K;  5C4X C;  1ZYR A;  4A3G K;  1WCM C;  2YU9 K;  3HOY C;  3M3Y K;  4A3E C;  4XLN A;  4YG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...