3S15K

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s15K00
3K7AK 3WODA 3FKIK 2PMZD 4MQ9A 2B63K 4A3GK 4OIOA 2NVYC 5C44C 5IP9C 1BDFA 3RZDC 3RZOC 1TWCK 4LK0A 4G7ZA 5M3FK 2E2IC 1IW7A 2NVXK 4JK1A 4QJVA 1Y1WC 3CQZK 3M3YC 1WCMC 4QIWD 5IP7C 2NVYK 5C44K 3S2DC 5IP9K 2BE5A 1TWHC 5C4JC 4YFXA 3DXJA 3RZDK 2B63C 2WAQL 2JA8K 2R92C 4Q4ZA 4A3LK 3I4NK 3GTKC 5M5XK 3M4OC 4ZH4A 4KN4A 2E2JK 4XLPA 3HOVC 2JA6K 3S1MK 3M3YK 1HQMA 2NVXC 2R93C 4C2MK 5M5WK 2Y0SL 5IP7K 3CQZC 2PPBA 3S14C 3S2DK 5IYCC 4Q5SA 1TWHK 5C4JK 2R92K 2R93K 1TWGK 2NVQC 3S16C 5FLMC 3GTKK 3M4OK 2JA8C 4A3LC 4OINA 2A69A 2PMZL 3H3VD 2WB1D 4LLGA 3HOVK 3I4NC 3H3VL 2E2JC 2JA6C 4YFKA 2NVTK 4A3JC 4GZYA 3S2HK 3HOWK 3S14K 3S1MC 5IYCK 1SFOK 3I4MC 4BBRK 1I3QC 2NVQK 4BBSC 3S16K 5FLMK 5C3EK 4QIWL 4X6AC 1TWGC 2A68A 4C3JK 3GTMK 3GTOK 2A6EA 4A3FC 3HOUC 3PO3C 4A3JK 2PA8D 4MEYA 3S1RC 4BY1K 4A3KK 3S15K 2NVTC 5TMCA 4G7HA 3GTLC 3I4MK 1I3QK 4C3IK 3HOWC 3S2HC 4BBSK 4A93K 3EQLA 1SFOC 4BBRC 4KN7A 4X6AK 4QJVB 1SMYA 4OIPA 5C3EC 3HOYK 4A3DC 4A3FK 3HOUK 3PO3K 3GTMC 5IYBC 4Y7NK 3GTOC 5C4XK 3S1RK 1I6VA 2WB1L 3GTGK 4A3MC 3GTLK 3HKZD 2JA5C 1Y1VC 4BY1C 2VUMC 4A3KC 1YNJA 3HOXC 3S15C 3PO2K 4MEXA 4BY7C 3HOZC 3GTPC 2CW0A 3S1NK 4A93C 1YNNA 4A3IC 4BXXK 4A3DK 5IYDK 1TWAC 3S1QC 5IYBK 3HOYC 4Y52K 1ZYRA 3S17K 1I50C 4A3MK 4Y7NC 2JA5K 1K83C 2R7ZK 1R9TK 2JA7C 1TWFK 1Y1VK 2VUMK 5C4XC 3GTGC 3HOXK 3H0GC 4XSZA 4BY7K 2A6HA 2PA8L 5FJ8K 3HOZK 3GTPK 4KMUA 2O5IA 2YU9C 4YFNA 3PO2C 4C3HK 4A3IK 3GTJC 3GTQC 4A3CK 4LJZA 1I6HC 1TWAK 3S1QK 3S1NC 4A3BC 4BXXC 4YG2A 5IYDC 1I50K 5TMFA 4A3EC 2E2HC 1K83K 4Y52C 4AYBD 5M5YK 4OIRA 2JA7K 3S17C 2WAQD 3K7AC 3H0GK 2R7ZC 1R9TC 4AYBL 1TWFC 3FKIC 3RZOK 4A3GC 2YU9K 4NOIA 3HKZL 2O5JA 3GTJK 3GTQK 1TWCC 2E2IK 4LK1A 1I6HK 5D4DA 4A3BK 4A3CC 1Y1WK 4XSXA 5M3MK 2Y0SD 4XLNA 4A3EK 2E2HK 4G7OA 1WCMK 1XPPA 4OIQA
chains in the Genus database with same CATH superfamily
3WODA 4MQ9A 3IPJA 5IP9C 3RZDC 1J6WA 1WQFA 4FM9A 1TWHA 3GTKA 4QJVA 4GTEA 5IP9K 1TWHC 3RZDK 2JA8K 2RGRA 4Q4ZA 3CAGA 3S0XA 3GTKC 4ZH4A 4KN4A 1IBAA 3FOEA 2NVXC 2JA6A 4Q5SA 1TWHK 3AD8C 1O26A 1WSRA 2NVQC 3GTKK 1EFWA 1F7UA 3H3VD 4KB4A 2WB1D 1IL2A 2P8TA 2JA6C 4YFKA 3L4KA 3S1MC 1SFOK 2NVQK 4BBSC 1BGWA 1PJ6A 2A68A 4C3JK 2PA8D 4BY1K 3GTMA 3GTOA 5TMCA 1WORA 1YX2A 1J6VA 3HOWC 4BBSK 3EQLA 1EI6A 2R7ZA 4BBRC 1J98A 1R9TA 1PJ7A 4PAAA 1WQHA 4A3DC 3GTMC 4Y7NK 3GTOC 1O24A 2WB1L 4KASA 3GTGK 3TTGA 2P5MA 4A3KC 1YNJA 4P5AA 3AD7C 2CW0A 4A93C 1YNNA 4A3IC 4A3DK 5IYDK 2ZFZA 3HOYC 1ZYRA 2KWAA 4Y52K 2R7ZK 1Y1WA 1R9TK 3LAPA 2PA8L 1ZXOA 4KMUA 1WOOA 1XZQB 1XXBA 4A3IK 2B63A 2ZUFA 3S1NC 3G4AA 4BXXC 4A3EC 1JVIA 5L46A 4AYBD 2GSOA 3SZZA 1JOEA 3K7AC 3RZOK 1TWFC 2XCRB 1IQ0A 3JSTA 3QX3A 2E2IK 4C3HC 1Y1WK 4XSXA 2Y0SD 4KB2A 4A3EK 4G7OA 1EQRA 3K7AK 2B63K 4P5BA 5C44C 1BDFA 4LK0A 2V6TA 2R93A 2R92A 4ILDA 5M3FK 1TWGA 3LAJA 4GTFA 1X31C 3CQZK 2FQOA 1WCMC 4QIWD 5C44K 2R92C 5C4JC 4A3LK 2R93C 5EGEA 3OREA 1KQ4A 3I4NK 5M5XK 4WILA 2E2JK 4DDQA 1HQMA 4G0VA 2Y0SL 1O2AA 1WOPA 3S14C 4KDDA 4KC6A 5JFEA 5IYCC 5C4JK 3FHZA 2R92K 2R93K 1J6XA 1TWGK 1AB4A 4P9SA 2JA8C 2A69A 1I3QA 1UV7A 4KM8A 3A8KA 5TJ3A 3S14K 1WQGA 3GEIA 5IYCK 4GTCA 1VLOA 1I3QC 5C3EK 3TFJA 4QIWL 4X6AC 3N0CA 2Y3PA 4O2DA 1SFOA 5IOSA 4A3FC 3HOUC 3ERED 1I3QK 2JA5A 1SFOC 1Y1VA 4X6AK 4QJVB 1PJ5A 3OEPA 3SZYA 3GEHA 4C3JC 4A3FK 3MMLB 3HOUK 5IYBC 5C4XK 4A3MC 2JA5C 1Y1VC 4M1XA 4BY1C 4J3NA 1I50A 3PO2K 1K83A 4LQYA 3HOZC 1WOSA 4KM9A 3GTGA 3H0GA 1VJEA 2JH3A 5IYBK 3GTJA 3S17K 1O2FB 1I50C 2V6UA 4A3MK 4Y7NC 2JA5K 1K83C 1Y1VK 1XXCA 3GDZA 3GTGC 3H0GC 4XSZA 2A6HA 3HOZK 4GTLA 2O5IA 4A3CK 3GTJC 4A3BC 5IYDC 1I50K 1K83K 1USOA 2V6SA 3GEEA 4Y52C 4OIRA 3H0GK 2R7ZC 1R9TC 4LR2A 3GTJK 4GTBA 5D4DA 4A3BK 1O29A 3GSIA 1EK8A 2E2IA 4OIQA 5HL8A 2FQTA 3AD9C 4PABA 3TFHA 4OIOA 3RZOC 3GIRA 4G7ZA 2E2IC 1IW7A 1Y1WC 2XCQA 3M3YC 4BLAA 4C2MC 1BJTA 4G0WA 5IP7C 1ISEA 2PHCB 2B63C 3CQZA 4KAWX 3M4OC 1O25A 4XLPA 3HOVC 2GAGC 4RMFA 1L0WA 1IS1A 3M3YK 4C2MK 5IOTA 2GAHC 5IP7K 5CJ9A 1BS2A 3CQZC 5M5WK 2PPBA 3S16C 3T02A 5FLMC 3M4OK 4A3LC 4OINA 3HOVK 3AQOA 3I4NC 1F93A 2E2JC 4GFQA 2NVTK 3S2HK 3A8IA 1VRQC 1B4BA 3V4GA 4C3IC 3VA7A 3S16K 1B4AA 5JVOA 5FLMK 1TWGC 1O28A 2A6EA 3PO3C 4GTDA 4C45A 4MEYA 3S1RC 3S15K 4G7HA 5IOQA 4C3IK 3BP8C 1F9NA 2VUMA 1SMYA 5C3EC 3PO3K 3S1RK 3BUEA 1TWAA 3HKZD 1DCOA 2VUMC 2CFAA 3HOXC 4BY7C 4MEXA 3FOFA 3N3YA 1DCPA 2RH6A 1VGXA 4KARA 1TWAC 1DD5A 4XCHA 1O27A 1O2BA 5C4XC 2VUMK 3HOXK 4BY7K 3ADAC 3PO2C 3FKIA 4LJZA 1I6HC 1TWAK 1GE9A 2W7VA 2CFAB 1TWCA 4YG2A 4WJ4A 5TMFA 5EGHA 3S17C 2WAQD 2NVXA 3LPXA 3FKIC 4A3GC 1XXAA 4WJ3M 4NOIA 3HKZL 1TWCC 1I6HK 1C0AA 2NVYA 4A3CC 5M3MK 4XLNA 3AQPA 1XPPA 3FKIK 2PMZD 4A3GK 1G51A 3A8JA 1WIHA 2NVYC 4LOWA 1TWCK 2XCOA 3TFIA 3NUHA 1IE0A 2NVXK 4JK1A 2D6FC 4KMHA 4KMAA 1INNA 2NVYK 3S2DC 2BE5A 1ZQ1C 4KMDA 3DXJA 4YFXA 2WAQL 4BKWA 3AH5A 2JA6K 4KATA 1ZBSA 3S1MK 1V5VA 5CHPA 3S2DK 3G4CA 1XZPA 2PMZL 3HXAA 4LLGA 3H3VL 1XZQA 4A3JC 4GZYA 3HOWK 3I4MC 4BBRK 3GTLA 3GTMK 1HI9A 1F7VA 1YCLA 3GTOK 3BP3A 4A3JK 1XZPB 1VH2A 4A3KK 2NVTC 3GTLC 3I4MK 3S2HC 4A93K 1TWFA 2GSNA 4KN7A 1WSVA 4BLBA 4OIPA 3HOYK 3N0BA 3GTPA 3Q3QA 2ZUEA 1I6VA 4GTAA 3GTLK 1DCHA 3S15C 2JA7A 3GTPC 1USMA 3S1NK 3L4JA 4BXXK 2GSUA 2YU9A 3S1QC 3GTQA 2JA7C 1TWFK 3OPFA 4GT9A 5IORA 2E2HA 1WCMA 4AH6A 5FJ8K 3GTPK 2YU9C 4YFNA 3T00A 5E68A 4C3HK 3GTQC 1JQWA 1EH1A 3S1QK 2E2HC 1ZVUA 2JA7K 5M5YK 4AYBL 4G0UA 2YU9K 2O5JA 3GTQK 4LK1A 1RU0A 3T01A 2E2HK 1WCMK 2EBBA 4FZBA
chains in the Genus database with same CATH topology
3K7AK 3WODA 3FKIK 2PMZD 4MQ9A 2B63K 4A3GK 4OIOA 2NVYC 5C44C 5IP9C 1BDFA 3RZDC 3RZOC 1TWCK 4LK0A 4G7ZA 5M3FK 2E2IC 1IW7A 2NVXK 4JK1A 4QJVA 1Y1WC 3CQZK 3M3YC 1WCMC 4QIWD 5IP7C 2NVYK 5C44K 3S2DC 5IP9K 2BE5A 1TWHC 5C4JC 4YFXA 3DXJA 3RZDK 2B63C 2WAQL 2JA8K 2R92C 4Q4ZA 4A3LK 3I4NK 3GTKC 5M5XK 3M4OC 4ZH4A 4KN4A 2E2JK 4XLPA 3HOVC 2JA6K 3S1MK 3M3YK 1HQMA 2NVXC 2R93C 4C2MK 5M5WK 2Y0SL 5IP7K 3CQZC 2PPBA 3S14C 3S2DK 5IYCC 4Q5SA 1TWHK 5C4JK 2R92K 2R93K 1TWGK 2NVQC 3S16C 5FLMC 3GTKK 3M4OK 2JA8C 4A3LC 4OINA 2A69A 2PMZL 3H3VD 2WB1D 4LLGA 3HOVK 3I4NC 3H3VL 2E2JC 2JA6C 4YFKA 2NVTK 4A3JC 4GZYA 3S2HK 3HOWK 3S14K 3S1MC 5IYCK 1SFOK 3I4MC 4BBRK 1I3QC 2NVQK 4BBSC 3S16K 5FLMK 5C3EK 4QIWL 4X6AC 1TWGC 2A68A 4C3JK 3GTMK 3GTOK 2A6EA 4A3FC 3HOUC 3PO3C 4A3JK 2PA8D 4MEYA 3S1RC 4BY1K 4A3KK 3S15K 2NVTC 5TMCA 4G7HA 3GTLC 3I4MK 1I3QK 4C3IK 3HOWC 3S2HC 4BBSK 4A93K 3EQLA 1SFOC 4BBRC 4KN7A 4X6AK 4QJVB 1SMYA 4OIPA 5C3EC 3HOYK 4A3DC 4A3FK 3HOUK 3PO3K 3GTMC 5IYBC 4Y7NK 3GTOC 5C4XK 3S1RK 1I6VA 2WB1L 3GTGK 4A3MC 3GTLK 3HKZD 2JA5C 1Y1VC 4BY1C 2VUMC 4A3KC 1YNJA 3HOXC 3S15C 3PO2K 4MEXA 4BY7C 3HOZC 3GTPC 2CW0A 3S1NK 4A93C 1YNNA 4A3IC 4BXXK 4A3DK 5IYDK 1TWAC 3S1QC 5IYBK 3HOYC 4Y52K 1ZYRA 3S17K 1I50C 4A3MK 4Y7NC 2JA5K 1K83C 2R7ZK 1R9TK 2JA7C 1TWFK 1Y1VK 2VUMK 5C4XC 3GTGC 3HOXK 3H0GC 4XSZA 4BY7K 2A6HA 2PA8L 5FJ8K 3HOZK 3GTPK 4KMUA 2O5IA 2YU9C 4YFNA 3PO2C 4C3HK 4A3IK 3GTJC 3GTQC 4A3CK 4LJZA 1I6HC 1TWAK 3S1QK 3S1NC 4A3BC 4BXXC 4YG2A 5IYDC 1I50K 5TMFA 4A3EC 2E2HC 1K83K 4Y52C 4AYBD 5M5YK 4OIRA 2JA7K 3S17C 2WAQD 3K7AC 3H0GK 2R7ZC 1R9TC 4AYBL 1TWFC 3FKIC 3RZOK 4A3GC 2YU9K 4NOIA 3HKZL 2O5JA 3GTJK 3GTQK 1TWCC 2E2IK 4LK1A 1I6HK 5D4DA 4A3BK 4A3CC 1Y1WK 4XSXA 5M3MK 2Y0SD 4XLNA 4A3EK 2E2HK 4G7OA 1WCMK 1XPPA 4OIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7A K;  3WOD A;  3FKI K;  2PMZ D;  4MQ9 A;  2B63 K;  4A3G K;  4OIO A;  2NVY C;  5C44 C;  5IP9 C;  1BDF A;  3RZD C;  3RZO C;  1TWC K;  4LK0 A;  4G7Z A;  5M3F K;  2E2I C;  1IW7 A;  2NVX K;  4JK1 A;  4QJV A;  1Y1W C;  3CQZ K;  3M3Y C;  1WCM C;  4QIW D;  5IP7 C;  2NVY K;  5C44 K;  3S2D C;  5IP9 K;  2BE5 A;  1TWH C;  5C4J C;  4YFX A;  3DXJ A;  3RZD K;  2B63 C;  2WAQ L;  2JA8 K;  2R92 C;  4Q4Z A;  4A3L K;  3I4N K;  3GTK C;  5M5X K;  3M4O C;  4ZH4 A;  4KN4 A;  2E2J K;  4XLP A;  3HOV C;  2JA6 K;  3S1M K;  3M3Y K;  1HQM A;  2NVX C;  2R93 C;  4C2M K;  5M5W K;  2Y0S L;  5IP7 K;  3CQZ C;  2PPB A;  3S14 C;  3S2D K;  5IYC C;  4Q5S A;  1TWH K;  5C4J K;  2R92 K;  2R93 K;  1TWG K;  2NVQ C;  3S16 C;  5FLM C;  3GTK K;  3M4O K;  2JA8 C;  4A3L C;  4OIN A;  2A69 A;  2PMZ L;  3H3V D;  2WB1 D;  4LLG A;  3HOV K;  3I4N C;  3H3V L;  2E2J C;  2JA6 C;  4YFK A;  2NVT K;  4A3J C;  4GZY A;  3S2H K;  3HOW K;  3S14 K;  3S1M C;  5IYC K;  1SFO K;  3I4M C;  4BBR K;  1I3Q C;  2NVQ K;  4BBS C;  3S16 K;  5FLM K;  5C3E K;  4QIW L;  4X6A C;  1TWG C;  2A68 A;  4C3J K;  3GTM K;  3GTO K;  2A6E A;  4A3F C;  3HOU C;  3PO3 C;  4A3J K;  2PA8 D;  4MEY A;  3S1R C;  4BY1 K;  4A3K K;  3S15 K;  2NVT C;  5TMC A;  4G7H A;  3GTL C;  3I4M K;  1I3Q K;  4C3I K;  3HOW C;  3S2H C;  4BBS K;  4A93 K;  3EQL A;  1SFO C;  4BBR C;  4KN7 A;  4X6A K;  4QJV B;  1SMY A;  4OIP A;  5C3E C;  3HOY K;  4A3D C;  4A3F K;  3HOU K;  3PO3 K;  3GTM C;  5IYB C;  4Y7N K;  3GTO C;  5C4X K;  3S1R K;  1I6V A;  2WB1 L;  3GTG K;  4A3M C;  3GTL K;  3HKZ D;  2JA5 C;  1Y1V C;  4BY1 C;  2VUM C;  4A3K C;  1YNJ A;  3HOX C;  3S15 C;  3PO2 K;  4MEX A;  4BY7 C;  3HOZ C;  3GTP C;  2CW0 A;  3S1N K;  4A93 C;  1YNN A;  4A3I C;  4BXX K;  4A3D K;  5IYD K;  1TWA C;  3S1Q C;  5IYB K;  3HOY C;  4Y52 K;  1ZYR A;  3S17 K;  1I50 C;  4A3M K;  4Y7N C;  2JA5 K;  1K83 C;  2R7Z K;  1R9T K;  2JA7 C;  1TWF K;  1Y1V K;  2VUM K;  5C4X C;  3GTG C;  3HOX K;  3H0G C;  4XSZ A;  4BY7 K;  2A6H A;  2PA8 L;  5FJ8 K;  3HOZ K;  3GTP K;  4KMU A;  2O5I A;  2YU9 C;  4YFN A;  3PO2 C;  4C3H K;  4A3I K;  3GTJ C;  3GTQ C;  4A3C K;  4LJZ A;  1I6H C;  1TWA K;  3S1Q K;  3S1N C;  4A3B C;  4BXX C;  4YG2 A;  5IYD C;  1I50 K;  5TMF A;  4A3E C;  2E2H C;  1K83 K;  4Y52 C;  4AYB D;  5M5Y K;  4OIR A;  2JA7 K;  3S17 C;  2WAQ D;  3K7A C;  3H0G K;  2R7Z C;  1R9T C;  4AYB L;  1TWF C;  3FKI C;  3RZO K;  4A3G C;  2YU9 K;  4NOI A;  3HKZ L;  2O5J A;  3GTJ K;  3GTQ K;  1TWC C;  2E2I K;  4LK1 A;  1I6H K;  5D4D A;  4A3B K;  4A3C C;  1Y1W K;  4XSX A;  5M3M K;  2Y0S D;  4XLN A;  4A3E K;  2E2H K;  4G7O A;  1WCM K;  1XPP A;  4OIQ A; 
#chains in the Genus database with same CATH topology
 3WOD A;  4MQ9 A;  3IPJ A;  5IP9 C;  3RZD C;  1J6W A;  1WQF A;  4FM9 A;  1TWH A;  3GTK A;  4QJV A;  4GTE A;  5IP9 K;  1TWH C;  3RZD K;  2JA8 K;  2RGR A;  4Q4Z A;  3CAG A;  3S0X A;  3GTK C;  4ZH4 A;  4KN4 A;  1IBA A;  3FOE A;  2NVX C;  2JA6 A;  4Q5S A;  1TWH K;  3AD8 C;  1O26 A;  1WSR A;  2NVQ C;  3GTK K;  1EFW A;  1F7U A;  3H3V D;  4KB4 A;  2WB1 D;  1IL2 A;  2P8T A;  2JA6 C;  4YFK A;  3L4K A;  3S1M C;  1SFO K;  2NVQ K;  4BBS C;  1BGW A;  1PJ6 A;  2A68 A;  4C3J K;  2PA8 D;  4BY1 K;  3GTM A;  3GTO A;  5TMC A;  1WOR A;  1YX2 A;  1J6V A;  3HOW C;  4BBS K;  3EQL A;  1EI6 A;  2R7Z A;  4BBR C;  1J98 A;  1R9T A;  1PJ7 A;  4PAA A;  1WQH A;  4A3D C;  3GTM C;  4Y7N K;  3GTO C;  1O24 A;  2WB1 L;  4KAS A;  3GTG K;  3TTG A;  2P5M A;  4A3K C;  1YNJ A;  4P5A A;  3AD7 C;  2CW0 A;  4A93 C;  1YNN A;  4A3I C;  4A3D K;  5IYD K;  2ZFZ A;  3HOY C;  1ZYR A;  2KWA A;  4Y52 K;  2R7Z K;  1Y1W A;  1R9T K;  3LAP A;  2PA8 L;  1ZXO A;  4KMU A;  1WOO A;  1XZQ B;  1XXB A;  4A3I K;  2B63 A;  2ZUF A;  3S1N C;  3G4A A;  4BXX C;  4A3E C;  1JVI A;  5L46 A;  4AYB D;  2GSO A;  3SZZ A;  1JOE A;  3K7A C;  3RZO K;  1TWF C;  2XCR B;  1IQ0 A;  3JST A;  3QX3 A;  2E2I K;  4C3H C;  1Y1W K;  4XSX A;  2Y0S D;  4KB2 A;  4A3E K;  4G7O A;  1EQR A;  3K7A K;  2B63 K;  4P5B A;  5C44 C;  1BDF A;  4LK0 A;  2V6T A;  2R93 A;  2R92 A;  4ILD A;  5M3F K;  1TWG A;  3LAJ A;  4GTF A;  1X31 C;  3CQZ K;  2FQO A;  1WCM C;  4QIW D;  5C44 K;  2R92 C;  5C4J C;  4A3L K;  2R93 C;  5EGE A;  3ORE A;  1KQ4 A;  3I4N K;  5M5X K;  4WIL A;  2E2J K;  4DDQ A;  1HQM A;  4G0V A;  2Y0S L;  1O2A A;  1WOP A;  3S14 C;  4KDD A;  4KC6 A;  5JFE A;  5IYC C;  5C4J K;  3FHZ A;  2R92 K;  2R93 K;  1J6X A;  1TWG K;  1AB4 A;  4P9S A;  2JA8 C;  2A69 A;  1I3Q A;  1UV7 A;  4KM8 A;  3A8K A;  5TJ3 A;  3S14 K;  1WQG A;  3GEI A;  5IYC K;  4GTC A;  1VLO A;  1I3Q C;  5C3E K;  3TFJ A;  4QIW L;  4X6A C;  3N0C A;  2Y3P A;  4O2D A;  1SFO A;  5IOS A;  4A3F C;  3HOU C;  3ERE D;  1I3Q K;  2JA5 A;  1SFO C;  1Y1V A;  4X6A K;  4QJV B;  1PJ5 A;  3OEP A;  3SZY A;  3GEH A;  4C3J C;  4A3F K;  3MML B;  3HOU K;  5IYB C;  5C4X K;  4A3M C;  2JA5 C;  1Y1V C;  4M1X A;  4BY1 C;  4J3N A;  1I50 A;  3PO2 K;  1K83 A;  4LQY A;  3HOZ C;  1WOS A;  4KM9 A;  3GTG A;  3H0G A;  1VJE A;  2JH3 A;  5IYB K;  3GTJ A;  3S17 K;  1O2F B;  1I50 C;  2V6U A;  4A3M K;  4Y7N C;  2JA5 K;  1K83 C;  1Y1V K;  1XXC A;  3GDZ A;  3GTG C;  3H0G C;  4XSZ A;  2A6H A;  3HOZ K;  4GTL A;  2O5I A;  4A3C K;  3GTJ C;  4A3B C;  5IYD C;  1I50 K;  1K83 K;  1USO A;  2V6S A;  3GEE A;  4Y52 C;  4OIR A;  3H0G K;  2R7Z C;  1R9T C;  4LR2 A;  3GTJ K;  4GTB A;  5D4D A;  4A3B K;  1O29 A;  3GSI A;  1EK8 A;  2E2I A;  4OIQ A;  5HL8 A;  2FQT A;  3AD9 C;  4PAB A;  3TFH A;  4OIO A;  3RZO C;  3GIR A;  4G7Z A;  2E2I C;  1IW7 A;  1Y1W C;  2XCQ A;  3M3Y C;  4BLA A;  4C2M C;  1BJT A;  4G0W A;  5IP7 C;  1ISE A;  2PHC B;  2B63 C;  3CQZ A;  4KAW X;  3M4O C;  1O25 A;  4XLP A;  3HOV C;  2GAG C;  4RMF A;  1L0W A;  1IS1 A;  3M3Y K;  4C2M K;  5IOT A;  2GAH C;  5IP7 K;  5CJ9 A;  1BS2 A;  3CQZ C;  5M5W K;  2PPB A;  3S16 C;  3T02 A;  5FLM C;  3M4O K;  4A3L C;  4OIN A;  3HOV K;  3AQO A;  3I4N C;  1F93 A;  2E2J C;  4GFQ A;  2NVT K;  3S2H K;  3A8I A;  1VRQ C;  1B4B A;  3V4G A;  4C3I C;  3VA7 A;  3S16 K;  1B4A A;  5JVO A;  5FLM K;  1TWG C;  1O28 A;  2A6E A;  3PO3 C;  4GTD A;  4C45 A;  4MEY A;  3S1R C;  3S15 K;  4G7H A;  5IOQ A;  4C3I K;  3BP8 C;  1F9N A;  2VUM A;  1SMY A;  5C3E C;  3PO3 K;  3S1R K;  3BUE A;  1TWA A;  3HKZ D;  1DCO A;  2VUM C;  2CFA A;  3HOX C;  4BY7 C;  4MEX A;  3FOF A;  3N3Y A;  1DCP A;  2RH6 A;  1VGX A;  4KAR A;  1TWA C;  1DD5 A;  4XCH A;  1O27 A;  1O2B A;  5C4X C;  2VUM K;  3HOX K;  4BY7 K;  3ADA C;  3PO2 C;  3FKI A;  4LJZ A;  1I6H C;  1TWA K;  1GE9 A;  2W7V A;  2CFA B;  1TWC A;  4YG2 A;  4WJ4 A;  5TMF A;  5EGH A;  3S17 C;  2WAQ D;  2NVX A;  3LPX A;  3FKI C;  4A3G C;  1XXA A;  4WJ3 M;  4NOI A;  3HKZ L;  1TWC C;  1I6H K;  1C0A A;  2NVY A;  4A3C C;  5M3M K;  4XLN A;  3AQP A;  1XPP A;  3FKI K;  2PMZ D;  4A3G K;  1G51 A;  3A8J A;  1WIH A;  2NVY C;  4LOW A;  1TWC K;  2XCO A;  3TFI A;  3NUH A;  1IE0 A;  2NVX K;  4JK1 A;  2D6F C;  4KMH A;  4KMA A;  1INN A;  2NVY K;  3S2D C;  2BE5 A;  1ZQ1 C;  4KMD A;  3DXJ A;  4YFX A;  2WAQ L;  4BKW A;  3AH5 A;  2JA6 K;  4KAT A;  1ZBS A;  3S1M K;  1V5V A;  5CHP A;  3S2D K;  3G4C A;  1XZP A;  2PMZ L;  3HXA A;  4LLG A;  3H3V L;  1XZQ A;  4A3J C;  4GZY A;  3HOW K;  3I4M C;  4BBR K;  3GTL A;  3GTM K;  1HI9 A;  1F7V A;  1YCL A;  3GTO K;  3BP3 A;  4A3J K;  1XZP B;  1VH2 A;  4A3K K;  2NVT C;  3GTL C;  3I4M K;  3S2H C;  4A93 K;  1TWF A;  2GSN A;  4KN7 A;  1WSV A;  4BLB A;  4OIP A;  3HOY K;  3N0B A;  3GTP A;  3Q3Q A;  2ZUE A;  1I6V A;  4GTA A;  3GTL K;  1DCH A;  3S15 C;  2JA7 A;  3GTP C;  1USM A;  3S1N K;  3L4J A;  4BXX K;  2GSU A;  2YU9 A;  3S1Q C;  3GTQ A;  2JA7 C;  1TWF K;  3OPF A;  4GT9 A;  5IOR A;  2E2H A;  1WCM A;  4AH6 A;  5FJ8 K;  3GTP K;  2YU9 C;  4YFN A;  3T00 A;  5E68 A;  4C3H K;  3GTQ C;  1JQW A;  1EH1 A;  3S1Q K;  2E2H C;  1ZVU A;  2JA7 K;  5M5Y K;  4AYB L;  4G0U A;  2YU9 K;  2O5J A;  3GTQ K;  4LK1 A;  1RU0 A;  3T01 A;  2E2H K;  1WCM K;  2EBB A;  4FZB A; 
#chains in the Genus database with same CATH homology
 3K7A K;  3WOD A;  3FKI K;  2PMZ D;  4MQ9 A;  2B63 K;  4A3G K;  4OIO A;  2NVY C;  5C44 C;  5IP9 C;  1BDF A;  3RZD C;  3RZO C;  1TWC K;  4LK0 A;  4G7Z A;  5M3F K;  2E2I C;  1IW7 A;  2NVX K;  4JK1 A;  4QJV A;  1Y1W C;  3CQZ K;  3M3Y C;  1WCM C;  4QIW D;  5IP7 C;  2NVY K;  5C44 K;  3S2D C;  5IP9 K;  2BE5 A;  1TWH C;  5C4J C;  4YFX A;  3DXJ A;  3RZD K;  2B63 C;  2WAQ L;  2JA8 K;  2R92 C;  4Q4Z A;  4A3L K;  3I4N K;  3GTK C;  5M5X K;  3M4O C;  4ZH4 A;  4KN4 A;  2E2J K;  4XLP A;  3HOV C;  2JA6 K;  3S1M K;  3M3Y K;  1HQM A;  2NVX C;  2R93 C;  4C2M K;  5M5W K;  2Y0S L;  5IP7 K;  3CQZ C;  2PPB A;  3S14 C;  3S2D K;  5IYC C;  4Q5S A;  1TWH K;  5C4J K;  2R92 K;  2R93 K;  1TWG K;  2NVQ C;  3S16 C;  5FLM C;  3GTK K;  3M4O K;  2JA8 C;  4A3L C;  4OIN A;  2A69 A;  2PMZ L;  3H3V D;  2WB1 D;  4LLG A;  3HOV K;  3I4N C;  3H3V L;  2E2J C;  2JA6 C;  4YFK A;  2NVT K;  4A3J C;  4GZY A;  3S2H K;  3HOW K;  3S14 K;  3S1M C;  5IYC K;  1SFO K;  3I4M C;  4BBR K;  1I3Q C;  2NVQ K;  4BBS C;  3S16 K;  5FLM K;  5C3E K;  4QIW L;  4X6A C;  1TWG C;  2A68 A;  4C3J K;  3GTM K;  3GTO K;  2A6E A;  4A3F C;  3HOU C;  3PO3 C;  4A3J K;  2PA8 D;  4MEY A;  3S1R C;  4BY1 K;  4A3K K;  3S15 K;  2NVT C;  5TMC A;  4G7H A;  3GTL C;  3I4M K;  1I3Q K;  4C3I K;  3HOW C;  3S2H C;  4BBS K;  4A93 K;  3EQL A;  1SFO C;  4BBR C;  4KN7 A;  4X6A K;  4QJV B;  1SMY A;  4OIP A;  5C3E C;  3HOY K;  4A3D C;  4A3F K;  3HOU K;  3PO3 K;  3GTM C;  5IYB C;  4Y7N K;  3GTO C;  5C4X K;  3S1R K;  1I6V A;  2WB1 L;  3GTG K;  4A3M C;  3GTL K;  3HKZ D;  2JA5 C;  1Y1V C;  4BY1 C;  2VUM C;  4A3K C;  1YNJ A;  3HOX C;  3S15 C;  3PO2 K;  4MEX A;  4BY7 C;  3HOZ C;  3GTP C;  2CW0 A;  3S1N K;  4A93 C;  1YNN A;  4A3I C;  4BXX K;  4A3D K;  5IYD K;  1TWA C;  3S1Q C;  5IYB K;  3HOY C;  4Y52 K;  1ZYR A;  3S17 K;  1I50 C;  4A3M K;  4Y7N C;  2JA5 K;  1K83 C;  2R7Z K;  1R9T K;  2JA7 C;  1TWF K;  1Y1V K;  2VUM K;  5C4X C;  3GTG C;  3HOX K;  3H0G C;  4XSZ A;  4BY7 K;  2A6H A;  2PA8 L;  5FJ8 K;  3HOZ K;  3GTP K;  4KMU A;  2O5I A;  2YU9 C;  4YFN A;  3PO2 C;  4C3H K;  4A3I K;  3GTJ C;  3GTQ C;  4A3C K;  4LJZ A;  1I6H C;  1TWA K;  3S1Q K;  3S1N C;  4A3B C;  4BXX C;  4YG2 A;  5IYD C;  1I50 K;  5TMF A;  4A3E C;  2E2H C;  1K83 K;  4Y52 C;  4AYB D;  5M5Y K;  4OIR A;  2JA7 K;  3S17 C;  2WAQ D;  3K7A C;  3H0G K;  2R7Z C;  1R9T C;  4AYB L;  1TWF C;  3FKI C;  3RZO K;  4A3G C;  2YU9 K;  4NOI A;  3HKZ L;  2O5J A;  3GTJ K;  3GTQ K;  1TWC C;  2E2I K;  4LK1 A;  1I6H K;  5D4D A;  4A3B K;  4A3C C;  1Y1W K;  4XSX A;  5M3M K;  2Y0S D;  4XLN A;  4A3E K;  2E2H K;  4G7O A;  1WCM K;  1XPP A;  4OIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...