3S15K

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription/rna/dna
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s15K00
3S14C 3RZOC 4AYBD 5IP7K 2WAQL 4A3LC 3S17K 4KMUA 3GTJC 3S2DK 4Y52K 4C3HK 2NVYC 4G7OA 3S16K 2VUMK 1BDFA 1TWGC 3HKZL 1TWCC 2PPBA 2NVQC 3S1MC 4A3GK 3CQZK 3RZDC 1WCMK 3GTKC 2JA8K 2R92C 3HOUC 4BY7K 3HOXC 2A69A 3M3YK 4A3CK 2E2IK 2E2HC 1SFOK 4QJVA 1TWHK 4XLNA 4A3FK 2JA7C 1I3QC 4YFKA 2NVXC 3S1RK 3H0GK 3S1QC 1Y1VC 1R9TC 2NVTC 3GTQK 4A3DK 3S2HC 3GTOC 4A3BK 2R7ZK 4QIWD 4A3JC 4BXXK 1I6HC 1TWAC 2PMZL 3HOYK 4Q4ZA 3HOVC 5IP7C 5M5WK 3S17C 5C3EC 4XSXA 2O5JA 4A3MK 3GTGK 3GTLK 3HOWC 2Y0SL 2JA5K 4A3KK 2YU9C 2VUMC 4MEXA 3M4OK 3WODA 4A3IC 1ZYRA 5FLMK 4JK1A 2B63K 3H3VL 3CQZC 4OIOA 3HOZC 3PO3C 4A93K 2WB1D 3GTMK 2JA8C 5M3MK 3S1NK 2CW0A 1K83C 2R93K 5M5XK 5C4XC 3FKIC 1SFOC 4A3FC 3K7AC 4A3EK 3PO2K 2E2JC 5C4JK 3S1RC 3S15K 4C2MK 3GTQC 4A3DC 2WAQD 1Y1WC 2A6HA 4A3BC 4LJZA 2R7ZC 3I4NK 3HOYC 1TWFK 4OIQA 3GTPC 3HKZD 4X6AK 4Q5SA 5IYCK 1I50C 3EQLA 4A3MC 5IYDK 2JA6C 2JA5C 4GZYA 1YNJA 4BBSK 4ZH4A 4Y52C 4NOIA 3S2DC 1SMYA 4BBRK 1HQMA 4Y7NK 3S14K 5TMCA 4A3LK 3S16C 3GTJK 4OIRA 2O5IA 2PA8L 4A3GC 3I4MK 2NVYK 4MQ9A 4XSZA 1YNNA 1WCMC 4YFNA 4YG2A 4BY7C 2NVQK 4A3EC 4G7ZA 4OIPA 3M3YC 2E2IC 5C4JC 4A3CC 2PMZD 3RZDK 5IP9K 4AYBL 3GTKK 3HOUK 1TWHC 4LK1A 3HOXK 4MEYA 2E2HK 3H0GC 2Y0SD 3DXJA 5C44K 2JA7K 4BY1K 4X6AC 3H3VD 3S1QK 1R9TK 4BXXC 4LLGA 3S2HK 5FJ8K 3GTOK 4A3JK 1I6HK 4G7HA 1TWAK 5M5YK 4Y7NC 5TMFA 3GTGC 3GTLC 3HOVK 4A3KC 5C3EK 3M4OC 5IYBK 4KN7A 4OINA 2B63C 5FLMC 3HOWK 3I4MC 3RZOK 4BBSC 4LK0A 2YU9K 4A93C 3GTMC 4A3IK 3HOZK 3S1NC 4QIWL 3PO3K 5IP9C 1I6VA 2R93C 5D4DA 1TWGK 1TWCK 4XLPA 3S1MK 3PO2C 1K83K 2A6EA 5C4XK 3FKIK 3S15C 2A68A 2R92K 3K7AK 1XPPA 5C44C 4BY1C 2JA6K 2E2JK 4C3IK 3I4NC 1TWFC 2WB1L 4KN4A 1Y1WK 4QJVB 4YFXA 1I3QK 1IW7A 2PA8D 5IYCC 2NVXK 2BE5A 1Y1VK 5IYDC 2NVTK 5M3FK 3GTPK 4C3JK 5IYBC 1I50K 4BBRC
chains in the Genus database with same CATH superfamily
1PJ5A 3S14C 4AYBD 1V5VA 3JSTA 2WAQL 4A3LC 3GTJC 1Y1WA 2JA7A 4G7OA 1TWGC 1DCOA 1I50A 2R92C 3G4CA 3M3YK 4LQYA 3GIRA 2V6UA 2JA7C 3L4KA 2VUMA 2PHCB 2ZFZA 1R9TC 2NVTC 3S2HC 1I6HC 2XCQA 3AD7C 1K83A 1SFOA 4XSXA 2O5JA 4A3MK 2RGRA 4A3KK 2VUMC 4MEXA 3GTQA 3WODA 5FLMK 4BBSK 2GSUA 3PO3C 5JFEA 2CW0A 1IQ0A 1K83C 3FKIC 1SFOC 3GTGA 3K7AC 3GTLA 2JA6A 4A3EK 1F7UA 3TFHA 3S1RC 3S15K 3GTQC 4A3DC 3A8KA 1JVIA 3HOYC 1TWFK 4GTEA 3GTPC 2R93A 5IYCK 3FHZA 5IYDK 2JA6C 4GTDA 3IPJA 3S2DC 4GFQA 3S14K 1HQMA 4AH6A 4A3LK 3S16C 3GTJK 1WCMC 2PMZD 5JVOA 1IL2A 3SZZA 2Y0SD 2B63A 2JA7K 1R9TK 3S2HK 5FJ8K 1I6HK 3VA7A 5M5YK 4Y7NC 5TMFA 1WOOA 2B63C 1B4BA 4A93C 2Y3PA 2V6SA 3S1NC 3GTOA 4XCHA 3PO3K 5IP9C 1EH1A 1TWCK 4XLPA 2P8TA 1K83K 3FKIK 2A68A 4C2MC 3K7AK 1J6XA 1XPPA 2YU9A 4GTLA 1WOPA 4WILA 3I4NC 2WB1L 4KN4A 2V6TA 3TFJA 5IOSA 2PA8D 2NVXK 1O28A 3AQPA 4P9SA 3GTPK 2JA6K 3RZOC 3T01A 5EGEA 1J6WA 3S2DK 1I3QA 3S16K 4KC6A 1VLOA 3HKZL 3S1MC 3RZDC 1WCMK 4WJ4A 4KB4A 2JA8K 1IS1A 4KASA 2E2HC 2KWAA 1I3QC 3CQZA 4A3BK 4QIWD 2E2IA 5IP7C 3S17C 1INNA 4GTFA 4KMAA 1WOSA 2B63K 1ZYRA 3H3VL 3CQZC 1JOEA 4A93K 2R7ZA 3TTGA 1IBAA 5M3MK 3S1NK 4GTCA 5M5XK 1XXBA 4A3FC 3T00A 3A8JA 2FQOA 2JA5A 5C4JK 4C2MK 1Y1WC 2R7ZC 3GTMA 3OEPA 4FM9A 3I4NK 5L46A 4OIQA 1J98A 1I50C 3EQLA 3GSIA 2JA5C 5IORA 1YNJA 4ZH4A 2XCOA 4NOIA 3LAPA 1TWHA 2ZUFA 3H0GA 3I4MK 3SZYA 4KARA 4MQ9A 3GEEA 4LR2A 4G0UA 4G7ZA 3RZDK 4AYBL 1EFWA 1TWHC 4LK1A 2E2HK 3AD8C 3H0GC 1F93A 2NVYA 4X6AC 1B4AA 4BXXC 4KMDA 3BP8C 3GTGC 3GTLC 3FOEA 5CHPA 1ZXOA 2GSOA 4OINA 2R93C 1TWGK 1HI9A 4WJ3M 2A6EA 1EI6A 1USOA 5C44C 2R92K 3HXAA 1JQWA 1XXCA 5HL8A 4BY1C 1Y1WK 3LPXA 4GTAA 4QJVB 1IW7A 3L4JA 1WQGA 3ADAC 1YX2A 2BE5A 2NVTK 3QX3A 1BGWA 1ZBSA 3LAJA 3FOFA 5IYBC 1I50K 1O2FB 4KMUA 4BLBA 1G51A 2VUMK 2D6FC 1Y1VA 2PPBA 1EQRA 4KDDA 3HOUC 2EBBA 1SFOK 4C3IC 4QJVA 1TWHK 4YFKA 1O24A 3H0GK 3S1RK 1Y1VC 1DCHA 3GEIA 3GTQK 3S1QC 4A3DK 4C3JC 3GTOC 1WSVA 4BXXK 2PMZL 3HOYK 4Q4ZA 3HOVC 3OREA 5C3EC 3GTGK 3GTLK 4KAWX 5CJ9A 2Y0SL 1WORA 4BLAA 2YU9C 1DCPA 1L0WA 4JK1A 1EK8A 1VGXA 1PJ6A 4G0WA 5C4XC 2R93K 4PAAA 1ISEA 2FQTA 3BUEA 2E2JC 1XXAA 2WAQD 1KQ4A 1O2AA 2A6HA 1O25A 3NUHA 1ZQ1C 4A3MC 4FZBA 4Y52C 2P5MA 4Y7NK 4C3HC 4KM9A 5TMCA 1TWFA 2PA8L 4A3GC 4YFNA 4C45A 2ZUEA 4BY7C 2XCRB 4A3EC 4GT9A 4OIPA 4A3CC 2E2IC 1YCLA 5IP9K 3HOUK 2GSNA 1XZQB 4ILDA 3BP3A 4MEYA 4KM8A 4J3NA 1ZVUA 3S1QK 1BJTA 4DDQA 4LLGA 1WQFA 3GDZA 3GTOK 3N3YA 5E68A 1O2BA 1WQHA 1VJEA 3HOVK 5C3EK 3M4OC 2JH3A 3RZOK 4LK0A 2YU9K 3GTMC 1R9TA 5EGHA 1VRQC 4QIWL 4LOWA 1I6VA 5D4DA 1X31C 1XZQA 4PABA 3S1MK 3PO2C 5C4XK 4M1XA 2E2JK 3GEHA 1O29A 4YFXA 1I3QK 4P5AA 1F9NA 1TWCA 3FKIA 3GTKA 5IOQA 3AH5A 4BBRC 3AD9C 1WIHA 5IP7K 3S17K 4Y52K 4C3HK 3S0XA 1UV7A 2NVYC 2NVXA 1BDFA 4BKWA 1TWCC 2NVQC 3GTPA 4A3GK 3CQZK 3GTKC 5TJ3A 4BY7K 1TWAA 2A69A 3HOXC 1VH2A 4A3CK 2E2IK 5IOTA 4A3FK 1PJ7A 3A8IA 4XLNA 4P5BA 1AB4A 2NVXC 1O27A 1WCMA 2R7ZK 4A3JC 3TFIA 1O26A 1TWAC 5M5WK 1WSRA 1USMA 3HOWC 2JA5K 3M4OK 3OPFA 4A3IC 4Q5SA 3HOZC 3G4AA 4OIOA 3Q3QA 1IE0A 2WB1D 3GTMK 3AQOA 2JA8C 4G0VA 1XZPB 3PO2K 4KMHA 4A3BC 4LJZA 1RU0A 4O2DA 4KATA 3HKZD 4X6AK 4GZYA 1SMYA 4BBRK 4KB2A 1F7VA 2RH6A 1GE9A 1J6VA 2CFAB 4OIRA 2O5IA 2NVYK 4XSZA 1YNNA 3V4GA 1XZPA 4YG2A 2NVQK 3M3YC 3ERED 3T02A 5C4JC 3GTKK 1BS2A 2GAGC 3HOXK 3DXJA 2GAHC 5C44K 4BY1K 1DD5A 3H3VD 3N0CA 4A3JK 4G7HA 1TWAK 2CFAA 4A3KC 2E2HA 2W7VA 5IYBK 4KN7A 5FLMC 3HOWK 3I4MC 4BBSC 3MMLB 4A3IK 3HOZK 4GTBA 3S15C 1C0AA 3GTJA 4C3IK 1TWFC 3N0BA 5IYCC 1TWGA 1Y1VK 5IYDC 5M3FK 4RMFA 3CAGA 4C3JK 2R92A
chains in the Genus database with same CATH topology
3S14C 3RZOC 4AYBD 5IP7K 2WAQL 4A3LC 3S17K 4KMUA 3GTJC 3S2DK 4Y52K 4C3HK 2NVYC 4G7OA 3S16K 2VUMK 1BDFA 1TWGC 3HKZL 1TWCC 2PPBA 2NVQC 3S1MC 4A3GK 3CQZK 3RZDC 1WCMK 3GTKC 2JA8K 2R92C 3HOUC 4BY7K 3HOXC 2A69A 3M3YK 4A3CK 2E2IK 2E2HC 1SFOK 4QJVA 1TWHK 4XLNA 4A3FK 2JA7C 1I3QC 4YFKA 2NVXC 3S1RK 3H0GK 3S1QC 1Y1VC 1R9TC 2NVTC 3GTQK 4A3DK 3S2HC 3GTOC 4A3BK 2R7ZK 4QIWD 4A3JC 4BXXK 1I6HC 1TWAC 2PMZL 3HOYK 4Q4ZA 3HOVC 5IP7C 5M5WK 3S17C 5C3EC 4XSXA 2O5JA 4A3MK 3GTGK 3GTLK 3HOWC 2Y0SL 2JA5K 4A3KK 2YU9C 2VUMC 4MEXA 3M4OK 3WODA 4A3IC 1ZYRA 5FLMK 4JK1A 2B63K 3H3VL 3CQZC 4OIOA 3HOZC 3PO3C 4A93K 2WB1D 3GTMK 2JA8C 5M3MK 3S1NK 2CW0A 1K83C 2R93K 5M5XK 5C4XC 3FKIC 1SFOC 4A3FC 3K7AC 4A3EK 3PO2K 2E2JC 5C4JK 3S1RC 3S15K 4C2MK 3GTQC 4A3DC 2WAQD 1Y1WC 2A6HA 4A3BC 4LJZA 2R7ZC 3I4NK 3HOYC 1TWFK 4OIQA 3GTPC 3HKZD 4X6AK 4Q5SA 5IYCK 1I50C 3EQLA 4A3MC 5IYDK 2JA6C 2JA5C 4GZYA 1YNJA 4BBSK 4ZH4A 4Y52C 4NOIA 3S2DC 1SMYA 4BBRK 1HQMA 4Y7NK 3S14K 5TMCA 4A3LK 3S16C 3GTJK 4OIRA 2O5IA 2PA8L 4A3GC 3I4MK 2NVYK 4MQ9A 4XSZA 1YNNA 1WCMC 4YFNA 4YG2A 4BY7C 2NVQK 4A3EC 4G7ZA 4OIPA 3M3YC 2E2IC 5C4JC 4A3CC 2PMZD 3RZDK 5IP9K 4AYBL 3GTKK 3HOUK 1TWHC 4LK1A 3HOXK 4MEYA 2E2HK 3H0GC 2Y0SD 3DXJA 5C44K 2JA7K 4BY1K 4X6AC 3H3VD 3S1QK 1R9TK 4BXXC 4LLGA 3S2HK 5FJ8K 3GTOK 4A3JK 1I6HK 4G7HA 1TWAK 5M5YK 4Y7NC 5TMFA 3GTGC 3GTLC 3HOVK 4A3KC 5C3EK 3M4OC 5IYBK 4KN7A 4OINA 2B63C 5FLMC 3HOWK 3I4MC 3RZOK 4BBSC 4LK0A 2YU9K 4A93C 3GTMC 4A3IK 3HOZK 3S1NC 4QIWL 3PO3K 5IP9C 1I6VA 2R93C 5D4DA 1TWGK 1TWCK 4XLPA 3S1MK 3PO2C 1K83K 2A6EA 5C4XK 3FKIK 3S15C 2A68A 2R92K 3K7AK 1XPPA 5C44C 4BY1C 2JA6K 2E2JK 4C3IK 3I4NC 1TWFC 2WB1L 4KN4A 1Y1WK 4QJVB 4YFXA 1I3QK 1IW7A 2PA8D 5IYCC 2NVXK 2BE5A 1Y1VK 5IYDC 2NVTK 5M3FK 3GTPK 4C3JK 5IYBC 1I50K 4BBRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 C;  3RZO C;  4AYB D;  5IP7 K;  2WAQ L;  4A3L C;  3S17 K;  4KMU A;  3GTJ C;  3S2D K;  4Y52 K;  4C3H K;  2NVY C;  4G7O A;  3S16 K;  2VUM K;  1BDF A;  1TWG C;  3HKZ L;  1TWC C;  2PPB A;  2NVQ C;  3S1M C;  4A3G K;  3CQZ K;  3RZD C;  1WCM K;  3GTK C;  2JA8 K;  2R92 C;  3HOU C;  4BY7 K;  3HOX C;  2A69 A;  3M3Y K;  4A3C K;  2E2I K;  2E2H C;  1SFO K;  4QJV A;  1TWH K;  4XLN A;  4A3F K;  2JA7 C;  1I3Q C;  4YFK A;  2NVX C;  3S1R K;  3H0G K;  3S1Q C;  1Y1V C;  1R9T C;  2NVT C;  3GTQ K;  4A3D K;  3S2H C;  3GTO C;  4A3B K;  2R7Z K;  4QIW D;  4A3J C;  4BXX K;  1I6H C;  1TWA C;  2PMZ L;  3HOY K;  4Q4Z A;  3HOV C;  5IP7 C;  5M5W K;  3S17 C;  5C3E C;  4XSX A;  2O5J A;  4A3M K;  3GTG K;  3GTL K;  3HOW C;  2Y0S L;  2JA5 K;  4A3K K;  2YU9 C;  2VUM C;  4MEX A;  3M4O K;  3WOD A;  4A3I C;  1ZYR A;  5FLM K;  4JK1 A;  2B63 K;  3H3V L;  3CQZ C;  4OIO A;  3HOZ C;  3PO3 C;  4A93 K;  2WB1 D;  3GTM K;  2JA8 C;  5M3M K;  3S1N K;  2CW0 A;  1K83 C;  2R93 K;  5M5X K;  5C4X C;  3FKI C;  1SFO C;  4A3F C;  3K7A C;  4A3E K;  3PO2 K;  2E2J C;  5C4J K;  3S1R C;  3S15 K;  4C2M K;  3GTQ C;  4A3D C;  2WAQ D;  1Y1W C;  2A6H A;  4A3B C;  4LJZ A;  2R7Z C;  3I4N K;  3HOY C;  1TWF K;  4OIQ A;  3GTP C;  3HKZ D;  4X6A K;  4Q5S A;  5IYC K;  1I50 C;  3EQL A;  4A3M C;  5IYD K;  2JA6 C;  2JA5 C;  4GZY A;  1YNJ A;  4BBS K;  4ZH4 A;  4Y52 C;  4NOI A;  3S2D C;  1SMY A;  4BBR K;  1HQM A;  4Y7N K;  3S14 K;  5TMC A;  4A3L K;  3S16 C;  3GTJ K;  4OIR A;  2O5I A;  2PA8 L;  4A3G C;  3I4M K;  2NVY K;  4MQ9 A;  4XSZ A;  1YNN A;  1WCM C;  4YFN A;  4YG2 A;  4BY7 C;  2NVQ K;  4A3E C;  4G7Z A;  4OIP A;  3M3Y C;  2E2I C;  5C4J C;  4A3C C;  2PMZ D;  3RZD K;  5IP9 K;  4AYB L;  3GTK K;  3HOU K;  1TWH C;  4LK1 A;  3HOX K;  4MEY A;  2E2H K;  3H0G C;  2Y0S D;  3DXJ A;  5C44 K;  2JA7 K;  4BY1 K;  4X6A C;  3H3V D;  3S1Q K;  1R9T K;  4BXX C;  4LLG A;  3S2H K;  5FJ8 K;  3GTO K;  4A3J K;  1I6H K;  4G7H A;  1TWA K;  5M5Y K;  4Y7N C;  5TMF A;  3GTG C;  3GTL C;  3HOV K;  4A3K C;  5C3E K;  3M4O C;  5IYB K;  4KN7 A;  4OIN A;  2B63 C;  5FLM C;  3HOW K;  3I4M C;  3RZO K;  4BBS C;  4LK0 A;  2YU9 K;  4A93 C;  3GTM C;  4A3I K;  3HOZ K;  3S1N C;  4QIW L;  3PO3 K;  5IP9 C;  1I6V A;  2R93 C;  5D4D A;  1TWG K;  1TWC K;  4XLP A;  3S1M K;  3PO2 C;  1K83 K;  2A6E A;  5C4X K;  3FKI K;  3S15 C;  2A68 A;  2R92 K;  3K7A K;  1XPP A;  5C44 C;  4BY1 C;  2JA6 K;  2E2J K;  4C3I K;  3I4N C;  1TWF C;  2WB1 L;  4KN4 A;  1Y1W K;  4QJV B;  4YFX A;  1I3Q K;  1IW7 A;  2PA8 D;  5IYC C;  2NVX K;  2BE5 A;  1Y1V K;  5IYD C;  2NVT K;  5M3F K;  3GTP K;  4C3J K;  5IYB C;  1I50 K;  4BBR C; 
#chains in the Genus database with same CATH topology
 1PJ5 A;  3S14 C;  4AYB D;  1V5V A;  3JST A;  2WAQ L;  4A3L C;  3GTJ C;  1Y1W A;  2JA7 A;  4G7O A;  1TWG C;  1DCO A;  1I50 A;  2R92 C;  3G4C A;  3M3Y K;  4LQY A;  3GIR A;  2V6U A;  2JA7 C;  3L4K A;  2VUM A;  2PHC B;  2ZFZ A;  1R9T C;  2NVT C;  3S2H C;  1I6H C;  2XCQ A;  3AD7 C;  1K83 A;  1SFO A;  4XSX A;  2O5J A;  4A3M K;  2RGR A;  4A3K K;  2VUM C;  4MEX A;  3GTQ A;  3WOD A;  5FLM K;  4BBS K;  2GSU A;  3PO3 C;  5JFE A;  2CW0 A;  1IQ0 A;  1K83 C;  3FKI C;  1SFO C;  3GTG A;  3K7A C;  3GTL A;  2JA6 A;  4A3E K;  1F7U A;  3TFH A;  3S1R C;  3S15 K;  3GTQ C;  4A3D C;  3A8K A;  1JVI A;  3HOY C;  1TWF K;  4GTE A;  3GTP C;  2R93 A;  5IYC K;  3FHZ A;  5IYD K;  2JA6 C;  4GTD A;  3IPJ A;  3S2D C;  4GFQ A;  3S14 K;  1HQM A;  4AH6 A;  4A3L K;  3S16 C;  3GTJ K;  1WCM C;  2PMZ D;  5JVO A;  1IL2 A;  3SZZ A;  2Y0S D;  2B63 A;  2JA7 K;  1R9T K;  3S2H K;  5FJ8 K;  1I6H K;  3VA7 A;  5M5Y K;  4Y7N C;  5TMF A;  1WOO A;  2B63 C;  1B4B A;  4A93 C;  2Y3P A;  2V6S A;  3S1N C;  3GTO A;  4XCH A;  3PO3 K;  5IP9 C;  1EH1 A;  1TWC K;  4XLP A;  2P8T A;  1K83 K;  3FKI K;  2A68 A;  4C2M C;  3K7A K;  1J6X A;  1XPP A;  2YU9 A;  4GTL A;  1WOP A;  4WIL A;  3I4N C;  2WB1 L;  4KN4 A;  2V6T A;  3TFJ A;  5IOS A;  2PA8 D;  2NVX K;  1O28 A;  3AQP A;  4P9S A;  3GTP K;  2JA6 K;  3RZO C;  3T01 A;  5EGE A;  1J6W A;  3S2D K;  1I3Q A;  3S16 K;  4KC6 A;  1VLO A;  3HKZ L;  3S1M C;  3RZD C;  1WCM K;  4WJ4 A;  4KB4 A;  2JA8 K;  1IS1 A;  4KAS A;  2E2H C;  2KWA A;  1I3Q C;  3CQZ A;  4A3B K;  4QIW D;  2E2I A;  5IP7 C;  3S17 C;  1INN A;  4GTF A;  4KMA A;  1WOS A;  2B63 K;  1ZYR A;  3H3V L;  3CQZ C;  1JOE A;  4A93 K;  2R7Z A;  3TTG A;  1IBA A;  5M3M K;  3S1N K;  4GTC A;  5M5X K;  1XXB A;  4A3F C;  3T00 A;  3A8J A;  2FQO A;  2JA5 A;  5C4J K;  4C2M K;  1Y1W C;  2R7Z C;  3GTM A;  3OEP A;  4FM9 A;  3I4N K;  5L46 A;  4OIQ A;  1J98 A;  1I50 C;  3EQL A;  3GSI A;  2JA5 C;  5IOR A;  1YNJ A;  4ZH4 A;  2XCO A;  4NOI A;  3LAP A;  1TWH A;  2ZUF A;  3H0G A;  3I4M K;  3SZY A;  4KAR A;  4MQ9 A;  3GEE A;  4LR2 A;  4G0U A;  4G7Z A;  3RZD K;  4AYB L;  1EFW A;  1TWH C;  4LK1 A;  2E2H K;  3AD8 C;  3H0G C;  1F93 A;  2NVY A;  4X6A C;  1B4A A;  4BXX C;  4KMD A;  3BP8 C;  3GTG C;  3GTL C;  3FOE A;  5CHP A;  1ZXO A;  2GSO A;  4OIN A;  2R93 C;  1TWG K;  1HI9 A;  4WJ3 M;  2A6E A;  1EI6 A;  1USO A;  5C44 C;  2R92 K;  3HXA A;  1JQW A;  1XXC A;  5HL8 A;  4BY1 C;  1Y1W K;  3LPX A;  4GTA A;  4QJV B;  1IW7 A;  3L4J A;  1WQG A;  3ADA C;  1YX2 A;  2BE5 A;  2NVT K;  3QX3 A;  1BGW A;  1ZBS A;  3LAJ A;  3FOF A;  5IYB C;  1I50 K;  1O2F B;  4KMU A;  4BLB A;  1G51 A;  2VUM K;  2D6F C;  1Y1V A;  2PPB A;  1EQR A;  4KDD A;  3HOU C;  2EBB A;  1SFO K;  4C3I C;  4QJV A;  1TWH K;  4YFK A;  1O24 A;  3H0G K;  3S1R K;  1Y1V C;  1DCH A;  3GEI A;  3GTQ K;  3S1Q C;  4A3D K;  4C3J C;  3GTO C;  1WSV A;  4BXX K;  2PMZ L;  3HOY K;  4Q4Z A;  3HOV C;  3ORE A;  5C3E C;  3GTG K;  3GTL K;  4KAW X;  5CJ9 A;  2Y0S L;  1WOR A;  4BLA A;  2YU9 C;  1DCP A;  1L0W A;  4JK1 A;  1EK8 A;  1VGX A;  1PJ6 A;  4G0W A;  5C4X C;  2R93 K;  4PAA A;  1ISE A;  2FQT A;  3BUE A;  2E2J C;  1XXA A;  2WAQ D;  1KQ4 A;  1O2A A;  2A6H A;  1O25 A;  3NUH A;  1ZQ1 C;  4A3M C;  4FZB A;  4Y52 C;  2P5M A;  4Y7N K;  4C3H C;  4KM9 A;  5TMC A;  1TWF A;  2PA8 L;  4A3G C;  4YFN A;  4C45 A;  2ZUE A;  4BY7 C;  2XCR B;  4A3E C;  4GT9 A;  4OIP A;  4A3C C;  2E2I C;  1YCL A;  5IP9 K;  3HOU K;  2GSN A;  1XZQ B;  4ILD A;  3BP3 A;  4MEY A;  4KM8 A;  4J3N A;  1ZVU A;  3S1Q K;  1BJT A;  4DDQ A;  4LLG A;  1WQF A;  3GDZ A;  3GTO K;  3N3Y A;  5E68 A;  1O2B A;  1WQH A;  1VJE A;  3HOV K;  5C3E K;  3M4O C;  2JH3 A;  3RZO K;  4LK0 A;  2YU9 K;  3GTM C;  1R9T A;  5EGH A;  1VRQ C;  4QIW L;  4LOW A;  1I6V A;  5D4D A;  1X31 C;  1XZQ A;  4PAB A;  3S1M K;  3PO2 C;  5C4X K;  4M1X A;  2E2J K;  3GEH A;  1O29 A;  4YFX A;  1I3Q K;  4P5A A;  1F9N A;  1TWC A;  3FKI A;  3GTK A;  5IOQ A;  3AH5 A;  4BBR C;  3AD9 C;  1WIH A;  5IP7 K;  3S17 K;  4Y52 K;  4C3H K;  3S0X A;  1UV7 A;  2NVY C;  2NVX A;  1BDF A;  4BKW A;  1TWC C;  2NVQ C;  3GTP A;  4A3G K;  3CQZ K;  3GTK C;  5TJ3 A;  4BY7 K;  1TWA A;  2A69 A;  3HOX C;  1VH2 A;  4A3C K;  2E2I K;  5IOT A;  4A3F K;  1PJ7 A;  3A8I A;  4XLN A;  4P5B A;  1AB4 A;  2NVX C;  1O27 A;  1WCM A;  2R7Z K;  4A3J C;  3TFI A;  1O26 A;  1TWA C;  5M5W K;  1WSR A;  1USM A;  3HOW C;  2JA5 K;  3M4O K;  3OPF A;  4A3I C;  4Q5S A;  3HOZ C;  3G4A A;  4OIO A;  3Q3Q A;  1IE0 A;  2WB1 D;  3GTM K;  3AQO A;  2JA8 C;  4G0V A;  1XZP B;  3PO2 K;  4KMH A;  4A3B C;  4LJZ A;  1RU0 A;  4O2D A;  4KAT A;  3HKZ D;  4X6A K;  4GZY A;  1SMY A;  4BBR K;  4KB2 A;  1F7V A;  2RH6 A;  1GE9 A;  1J6V A;  2CFA B;  4OIR A;  2O5I A;  2NVY K;  4XSZ A;  1YNN A;  3V4G A;  1XZP A;  4YG2 A;  2NVQ K;  3M3Y C;  3ERE D;  3T02 A;  5C4J C;  3GTK K;  1BS2 A;  2GAG C;  3HOX K;  3DXJ A;  2GAH C;  5C44 K;  4BY1 K;  1DD5 A;  3H3V D;  3N0C A;  4A3J K;  4G7H A;  1TWA K;  2CFA A;  4A3K C;  2E2H A;  2W7V A;  5IYB K;  4KN7 A;  5FLM C;  3HOW K;  3I4M C;  4BBS C;  3MML B;  4A3I K;  3HOZ K;  4GTB A;  3S15 C;  1C0A A;  3GTJ A;  4C3I K;  1TWF C;  3N0B A;  5IYC C;  1TWG A;  1Y1V K;  5IYD C;  5M3F K;  4RMF A;  3CAG A;  4C3J K;  2R92 A; 
#chains in the Genus database with same CATH homology
 3S14 C;  3RZO C;  4AYB D;  5IP7 K;  2WAQ L;  4A3L C;  3S17 K;  4KMU A;  3GTJ C;  3S2D K;  4Y52 K;  4C3H K;  2NVY C;  4G7O A;  3S16 K;  2VUM K;  1BDF A;  1TWG C;  3HKZ L;  1TWC C;  2PPB A;  2NVQ C;  3S1M C;  4A3G K;  3CQZ K;  3RZD C;  1WCM K;  3GTK C;  2JA8 K;  2R92 C;  3HOU C;  4BY7 K;  3HOX C;  2A69 A;  3M3Y K;  4A3C K;  2E2I K;  2E2H C;  1SFO K;  4QJV A;  1TWH K;  4XLN A;  4A3F K;  2JA7 C;  1I3Q C;  4YFK A;  2NVX C;  3S1R K;  3H0G K;  3S1Q C;  1Y1V C;  1R9T C;  2NVT C;  3GTQ K;  4A3D K;  3S2H C;  3GTO C;  4A3B K;  2R7Z K;  4QIW D;  4A3J C;  4BXX K;  1I6H C;  1TWA C;  2PMZ L;  3HOY K;  4Q4Z A;  3HOV C;  5IP7 C;  5M5W K;  3S17 C;  5C3E C;  4XSX A;  2O5J A;  4A3M K;  3GTG K;  3GTL K;  3HOW C;  2Y0S L;  2JA5 K;  4A3K K;  2YU9 C;  2VUM C;  4MEX A;  3M4O K;  3WOD A;  4A3I C;  1ZYR A;  5FLM K;  4JK1 A;  2B63 K;  3H3V L;  3CQZ C;  4OIO A;  3HOZ C;  3PO3 C;  4A93 K;  2WB1 D;  3GTM K;  2JA8 C;  5M3M K;  3S1N K;  2CW0 A;  1K83 C;  2R93 K;  5M5X K;  5C4X C;  3FKI C;  1SFO C;  4A3F C;  3K7A C;  4A3E K;  3PO2 K;  2E2J C;  5C4J K;  3S1R C;  3S15 K;  4C2M K;  3GTQ C;  4A3D C;  2WAQ D;  1Y1W C;  2A6H A;  4A3B C;  4LJZ A;  2R7Z C;  3I4N K;  3HOY C;  1TWF K;  4OIQ A;  3GTP C;  3HKZ D;  4X6A K;  4Q5S A;  5IYC K;  1I50 C;  3EQL A;  4A3M C;  5IYD K;  2JA6 C;  2JA5 C;  4GZY A;  1YNJ A;  4BBS K;  4ZH4 A;  4Y52 C;  4NOI A;  3S2D C;  1SMY A;  4BBR K;  1HQM A;  4Y7N K;  3S14 K;  5TMC A;  4A3L K;  3S16 C;  3GTJ K;  4OIR A;  2O5I A;  2PA8 L;  4A3G C;  3I4M K;  2NVY K;  4MQ9 A;  4XSZ A;  1YNN A;  1WCM C;  4YFN A;  4YG2 A;  4BY7 C;  2NVQ K;  4A3E C;  4G7Z A;  4OIP A;  3M3Y C;  2E2I C;  5C4J C;  4A3C C;  2PMZ D;  3RZD K;  5IP9 K;  4AYB L;  3GTK K;  3HOU K;  1TWH C;  4LK1 A;  3HOX K;  4MEY A;  2E2H K;  3H0G C;  2Y0S D;  3DXJ A;  5C44 K;  2JA7 K;  4BY1 K;  4X6A C;  3H3V D;  3S1Q K;  1R9T K;  4BXX C;  4LLG A;  3S2H K;  5FJ8 K;  3GTO K;  4A3J K;  1I6H K;  4G7H A;  1TWA K;  5M5Y K;  4Y7N C;  5TMF A;  3GTG C;  3GTL C;  3HOV K;  4A3K C;  5C3E K;  3M4O C;  5IYB K;  4KN7 A;  4OIN A;  2B63 C;  5FLM C;  3HOW K;  3I4M C;  3RZO K;  4BBS C;  4LK0 A;  2YU9 K;  4A93 C;  3GTM C;  4A3I K;  3HOZ K;  3S1N C;  4QIW L;  3PO3 K;  5IP9 C;  1I6V A;  2R93 C;  5D4D A;  1TWG K;  1TWC K;  4XLP A;  3S1M K;  3PO2 C;  1K83 K;  2A6E A;  5C4X K;  3FKI K;  3S15 C;  2A68 A;  2R92 K;  3K7A K;  1XPP A;  5C44 C;  4BY1 C;  2JA6 K;  2E2J K;  4C3I K;  3I4N C;  1TWF C;  2WB1 L;  4KN4 A;  1Y1W K;  4QJV B;  4YFX A;  1I3Q K;  1IW7 A;  2PA8 D;  5IYC C;  2NVX K;  2BE5 A;  1Y1V K;  5IYD C;  2NVT K;  5M3F K;  3GTP K;  4C3J K;  5IYB C;  1I50 K;  4BBR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...