3S15K

Rna polymerase ii initiation complex with a 7-nt rna
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s15K00
4C3JK 3S16C 3S14K 4QIWD 2B63K 3GTKK 3K7AK 2A69A 4MEXA 5FLMC 3H3VL 3HOVK 3S15C 4BBSC 2Y0SD 2JA8K 3S2DK 4A3FC 1TWFK 3S1RC 2O5JA 3S1NK 3GTMC 5IYDC 4C3HK 3HOXK 3DXJA 4X6AK 4ZH4A 1R9TK 1TWGC 2E2HC 4A3GC 1Y1WK 4A3JK 2JA5K 2JA7K 2O5IA 3S17C 2E2IK 4Y52C 4A3CK 3HOYK 2JA6K 2R7ZK 3HOWK 4BBRK 4GZYA 1TWHK 2R93K 2E2JC 3PO3K 3I4NK 4Y7NC 2VUMC 4BY7C 2NVQK 1ZYRA 3GTJC 3HOZC 3FKIC 1IW7A 1WCMK 4AYBL 2WAQL 2NVTK 3S1QC 2PA8L 3GTLK 3GTPC 1TWCC 2NVYC 1TWAK 4A3MC 1SFOK 3S16K 5TMFA 5IP7K 4KN4A 5M5XK 3I4MC 4G7OA 2BE5A 1YNNA 5FLMK 3M3YC 3S15K 4A93C 3S1MC 4A3FK 4XSZA 3GTOC 3GTMK 4A3BC 3EQLA 1BDFA 3PO2K 5C4JC 3HOUC 5IYDK 5D4DA 2A68A 5C4XC 1SMYA 1I6VA 4QIWL 1TWGK 2E2HK 4A3GK 4A3KC 4XLPA 2Y0SL 2R92K 4A3IC 4XLNA 4LK1A 3M4OC 3S17K 3S14C 4BXXC 4Y52K 2A6EA 4KN7A 4LK0A 3GTQC 1I6HC 3HOVC 4YFNA 4YG2A 2E2JK 1I3QC 4Y7NK 4BY7K 5IYBC 3GTJK 4OIPA 3FKIK 3CQZC 4BY1C 4OINA 3RZOC 2PMZD 1I50C 1HQMA 4A3EC 3RZDC 3S1QK 4JK1A 4KMUA 5IYCC 3GTPK 4OIQA 1TWCK 2NVYK 2JA5C 3HKZD 2YU9C 4BBSK 2WB1D 1K83C 2E2IC 4A3CC 3S1RK 4XSXA 3S2HC 3M3YK 3H0GC 3H3VD 3GTGC 3S1MK 4A93K 5IP9C 1YNJA 5M5WK 4A3LC 1Y1VC 2NVXC 5M5YK 5C44C 4QJVB 4Q4ZA 4A3BK 4A3DC 4QJVA 5C4JK 4NOIA 5C3EC 3HOUK 5C4XK 4YFXA 2B63C 3HKZL 4A3KK 3K7AC 3GTKC 4Q5SA 5FJ8K 4A3IK 3M4OK 5IP7C 2CW0A 2JA8C 3S2DC 4C2MK 4OIRA 1TWFC 3GTQK 4BXXK 1I6HK 3S1NC 2VUMK 4G7ZA 4OIOA 3HOZK 1XPPA 1I3QK 5IYBK 4MEYA 3HOXC 3PO2C 4X6AC 1R9TC 4BY1K 3CQZK 3RZOK 4A3MK 1Y1WC 1I50K 4A3EK 4A3JC 5M3FK 3RZDK 5IYCK 4AYBD 2WAQD 2JA7C 5M3MK 2PA8D 3I4MK 2PPBA 4LLGA 3HOYC 2R92C 4G7HA 2JA6C 2YU9K 2R7ZC 3HOWC 4BBRC 1K83K 1TWHC 2A6HA 2R93C 4LJZA 3WODA 3GTOK 3PO3C 3S2HK 3I4NC 3H0GK 3GTGK 4YFKA 2NVQC 5IP9K 4A3LK 2PMZL 1Y1VK 2NVXK 5C44K 5TMCA 2NVTC 1WCMC 4MQ9A 4A3DK 3GTLC 5C3EK 1SFOC 1TWAC 4C3IK 2WB1L
chains in the Genus database with same CATH superfamily
3ERED 3HXAA 3S14K 5IOTA 5FLMC 1B4AA 2V6TA 2Y0SD 4BBSC 4A3FC 3T01A 1TWFK 1ZQ1C 5HL8A 3GTMC 4WILA 4C3HK 1TWGC 1WSVA 1Y1WK 2JA5K 1EK8A 2V6UA 3S17C 1O26A 2E2JC 3HOZC 1F93A 1IW7A 4AYBL 2NVTK 2PA8L 1DD5A 3GTGA 3S16K 3I4MC 1JQWA 3S15K 1XZPA 3S1MC 5IYDK 3HOUC 1WOPA 2A68A 1TWFA 1BGWA 3AQPA 2E2HK 4A3GK 4A3IC 1USMA 3GEHA 3N0CA 4BKWA 4C2MC 4LK0A 1YCLA 3HOVC 2JA5A 1ZXOA 1XZQB 4OIPA 1C0AA 3OREA 4GTFA 3GIRA 1XZPB 4GTLA 3GEIA 4C45A 4BBSK 4A3CC 2V6SA 3GTGC 5IP9C 5C44C 4Q4ZA 4A3BK 4QJVA 5C4JK 4NOIA 1XXBA 3GDZA 1O27A 3AD9C 5C4XK 4YFXA 1JOEA 1O2AA 4Q5SA 3M4OK 1J6WA 5CJ9A 5TJ3A 1F7VA 1TWFC 3GTQK 5IORA 3HOZK 1PJ7A 4C3HC 1I3QK 2Y3PA 1VJEA 5IYBK 3FHZA 1HI9A 5JVOA 1Y1WC 1VH2A 3N0BA 3I4MK 2R92C 1TWAA 3WODA 4GFQA 4A3LK 2XCRB 2NVTC 4A3DK 4XCHA 3S16C 4QIWD 3GTKK 1TWGA 3H3VL 3HOVK 3S15C 3S2DK 3SZYA 5IYDC 4GTBA 3LAJA 5IOSA 3VA7A 1IS1A 2E2HC 4A3GC 1GE9A 1I3QA 4A3CK 2FQOA 2XCOA 3HOWK 3PO3K 3T00A 1WSRA 1ZYRA 4KC6A 3IPJA 1WCMK 3TTGA 3GTLK 4P5BA 1BJTA 4A3MC 3FOFA 1DCOA 2BE5A 1YNNA 4XSZA 3GTOC 1IE0A 3GTKA 4A3BC 2GAHC 1J6XA 4P5AA 5C4JC 4LR2A 5C4XC 1SMYA 3TFIA 1I6VA 1WOSA 4G0VA 2GAGC 3NUHA 4XLPA 2Y0SL 4KASA 2R92K 3M4OC 4Y52K 4PABA 3GTQC 3AD7C 4YFNA 4YG2A 1XZQA 1I3QC 4Y7NK 4BY7K 5IYBC 3GTJK 4KMHA 3S1QK 2KWAA 1TWCK 2GSNA 1WCMA 1WQFA 2WB1D 4GTCA 3GTLA 5EGHA 3M3YK 5M5WK 1YNJA 4A3LC 2FQTA 4FZBA 4A3DC 4PAAA 3MMLB 3GTKC 1VGXA 5FJ8K 1Y1WA 5JFEA 2CW0A 3S2DC 3G4CA 2R92A 4GTEA 1O29A 1XPPA 1IBAA 3PO2C 4KMAA 3CQZK 1J6VA 1XXAA 4A3MK 3RZOK 1I50K 4A3EK 3RZDK 5IYCK 2WAQD 3T02A 3OPFA 2RH6A 3TFJA 2YU9K 3HOWC 3GTOK 1TWCA 3PO3C 1JVIA 4RMFA 1Y1VK 2NVXK 1WCMC 3GTLC 5C3EK 3AH5A 4KB2A 1EQRA 4C3IK 4C3JK 3ADAC 2A69A 2E2HA 4GTAA 3N3YA 3S1RC 2O5JA 3S1NK 2ZUFA 1AB4A 4X6AK 3DXJA 1R9TK 2GSOA 2P8TA 3L4KA 4DDQA 2JA7K 3QX3A 2O5IA 4Y52C 3CQZA 2JA6K 4KM9A 1I50A 4BBRK 3I4NK 4Y7NC 2VUMC 4BY7C 3GTJC 3GTOA 3S1QC 4FM9A 1TWCC 1SFOK 1Y1VA 4LQYA 4KMDA 5TMFA 5M5XK 1G51A 3M3YC 2CFAB 3GTQA 3PO2K 3LAPA 4QIWL 1WQHA 2D6FC 3G4AA 4XLNA 4LK1A 2XCQA 4GTDA 1R9TA 1O28A 1IQ0A 2JA7A 3FKIK 3CQZC 4OINA 4J3NA 3RZOC 2PMZD 1I50C 1UV7A 4A3EC 1O2BA 3RZDC 4JK1A 3JSTA 5IYCC 3A8KA 3GTPK 2NVYK 1WOOA 2YU9C 2E2IC 3S1RK 1SFOA 4A93K 1WQGA 1Y1VC 2NVXC 2PHCB 5C3EC 3A8IA 1F9NA 3GSIA 1O24A 3BP8C 4C3IC 4C3JC 1J98A 3AD8C 4BLBA 4A3KK 5IP7C 4BXXK 4OIRA 1I6HK 3S1NC 2RGRA 2VUMK 4OIOA 1X31C 2ZFZA 4KAWX 4MEYA 4X6AC 1WORA 2GSUA 1R9TC 4BY1K 3BP3A 3V4GA 4WJ3M 4AYBD 2JA7C 2P5MA 5M3MK 2PA8D 4GT9A 2PPBA 3FKIA 2JA6C 4AH6A 3LPXA 4BBRC 1K83K 3GTPA 2A6HA 2NVYA 3S2HK 3L4JA 3I4NC 3H0GK 4WJ4A 1EH1A 3Q3QA 1IL2A 1SFOC 4BLAA 1VRQC 5L46A 1PJ5A 2WB1L 1VLOA 2B63K 3K7AK 4MEXA 2JA8K 1YX2A 1ZVUA 2ZUEA 4ILDA 3HOXK 4ZH4A 2VUMA 1L0WA 4O2DA 3GTJA 4A3JK 1EFWA 3A8JA 1WIHA 2E2IK 3GEEA 3HOYK 3FOEA 2R7ZK 4GZYA 1TWHK 2R93K 1ISEA 2NVQK 3FKIC 1K83A 3AQOA 2WAQL 1EI6A 2W7VA 3GTPC 3H0GA 2NVYC 1TWAK 5IP7K 4KN4A 4G7OA 5FLMK 4A93C 1DCPA 4A3FK 1XXCA 2CFAA 2B63A 5CHPA 1BS2A 4M1XA 3EQLA 3GTMK 1BDFA 5D4DA 1USOA 4KB4A 1TWGK 3CAGA 4A3KC 2EBBA 3S17K 3S14C 4BXXC 1RU0A 2A6EA 4KN7A 1I6HC 5EGEA 1DCHA 2JH3A 2YU9A 5IOQA 2E2JK 2E2IA 3S0XA 4KATA 4KM8A 2R7ZA 4BY1C 1TWHA 4G0WA 2R93A 1PJ6A 1HQMA 2NVXA 4KMUA 4OIQA 1KQ4A 1B4BA 2JA5C 1INNA 3HKZD 1K83C 4XSXA 1F7UA 3S2HC 3H0GC 3H3VD 3S1MK 5M5YK 4QJVB 4KARA 3HOUK 4KDDA 3GTMA 2B63C 3HKZL 3K7AC 4A3IK 2JA8C 1O25A 4C2MK 4G7ZA 2JA6A 3BUEA 3HOXC 4A3JC 5M3FK 5E68A 1O2FB 4LOWA 4LLGA 3HOYC 1V5VA 3OEPA 4G7HA 2R7ZC 1TWHC 2R93C 4LJZA 3SZZA 3GTGK 4YFKA 2NVQC 5IP9K 2PMZL 5C44K 5TMCA 4MQ9A 4P9SA 1ZBSA 1TWAC 3TFHA 4G0UA
chains in the Genus database with same CATH topology
4C3JK 3S16C 3S14K 4QIWD 2B63K 3GTKK 3K7AK 2A69A 4MEXA 5FLMC 3H3VL 3HOVK 3S15C 4BBSC 2Y0SD 2JA8K 3S2DK 4A3FC 1TWFK 3S1RC 2O5JA 3S1NK 3GTMC 5IYDC 4C3HK 3HOXK 3DXJA 4X6AK 4ZH4A 1R9TK 1TWGC 2E2HC 4A3GC 1Y1WK 4A3JK 2JA5K 2JA7K 2O5IA 3S17C 2E2IK 4Y52C 4A3CK 3HOYK 2JA6K 2R7ZK 3HOWK 4BBRK 4GZYA 1TWHK 2R93K 2E2JC 3PO3K 3I4NK 4Y7NC 2VUMC 4BY7C 2NVQK 1ZYRA 3GTJC 3HOZC 3FKIC 1IW7A 1WCMK 4AYBL 2WAQL 2NVTK 3S1QC 2PA8L 3GTLK 3GTPC 1TWCC 2NVYC 1TWAK 4A3MC 1SFOK 3S16K 5TMFA 5IP7K 4KN4A 5M5XK 3I4MC 4G7OA 2BE5A 1YNNA 5FLMK 3M3YC 3S15K 4A93C 3S1MC 4A3FK 4XSZA 3GTOC 3GTMK 4A3BC 3EQLA 1BDFA 3PO2K 5C4JC 3HOUC 5IYDK 5D4DA 2A68A 5C4XC 1SMYA 1I6VA 4QIWL 1TWGK 2E2HK 4A3GK 4A3KC 4XLPA 2Y0SL 2R92K 4A3IC 4XLNA 4LK1A 3M4OC 3S17K 3S14C 4BXXC 4Y52K 2A6EA 4KN7A 4LK0A 3GTQC 1I6HC 3HOVC 4YFNA 4YG2A 2E2JK 1I3QC 4Y7NK 4BY7K 5IYBC 3GTJK 4OIPA 3FKIK 3CQZC 4BY1C 4OINA 3RZOC 2PMZD 1I50C 1HQMA 4A3EC 3RZDC 3S1QK 4JK1A 4KMUA 5IYCC 3GTPK 4OIQA 1TWCK 2NVYK 2JA5C 3HKZD 2YU9C 4BBSK 2WB1D 1K83C 2E2IC 4A3CC 3S1RK 4XSXA 3S2HC 3M3YK 3H0GC 3H3VD 3GTGC 3S1MK 4A93K 5IP9C 1YNJA 5M5WK 4A3LC 1Y1VC 2NVXC 5M5YK 5C44C 4QJVB 4Q4ZA 4A3BK 4A3DC 4QJVA 5C4JK 4NOIA 5C3EC 3HOUK 5C4XK 4YFXA 2B63C 3HKZL 4A3KK 3K7AC 3GTKC 4Q5SA 5FJ8K 4A3IK 3M4OK 5IP7C 2CW0A 2JA8C 3S2DC 4C2MK 4OIRA 1TWFC 3GTQK 4BXXK 1I6HK 3S1NC 2VUMK 4G7ZA 4OIOA 3HOZK 1XPPA 1I3QK 5IYBK 4MEYA 3HOXC 3PO2C 4X6AC 1R9TC 4BY1K 3CQZK 3RZOK 4A3MK 1Y1WC 1I50K 4A3EK 4A3JC 5M3FK 3RZDK 5IYCK 4AYBD 2WAQD 2JA7C 5M3MK 2PA8D 3I4MK 2PPBA 4LLGA 3HOYC 2R92C 4G7HA 2JA6C 2YU9K 2R7ZC 3HOWC 4BBRC 1K83K 1TWHC 2A6HA 2R93C 4LJZA 3WODA 3GTOK 3PO3C 3S2HK 3I4NC 3H0GK 3GTGK 4YFKA 2NVQC 5IP9K 4A3LK 2PMZL 1Y1VK 2NVXK 5C44K 5TMCA 2NVTC 1WCMC 4MQ9A 4A3DK 3GTLC 5C3EK 1SFOC 1TWAC 4C3IK 2WB1L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3J K;  3S16 C;  3S14 K;  4QIW D;  2B63 K;  3GTK K;  3K7A K;  2A69 A;  4MEX A;  5FLM C;  3H3V L;  3HOV K;  3S15 C;  4BBS C;  2Y0S D;  2JA8 K;  3S2D K;  4A3F C;  1TWF K;  3S1R C;  2O5J A;  3S1N K;  3GTM C;  5IYD C;  4C3H K;  3HOX K;  3DXJ A;  4X6A K;  4ZH4 A;  1R9T K;  1TWG C;  2E2H C;  4A3G C;  1Y1W K;  4A3J K;  2JA5 K;  2JA7 K;  2O5I A;  3S17 C;  2E2I K;  4Y52 C;  4A3C K;  3HOY K;  2JA6 K;  2R7Z K;  3HOW K;  4BBR K;  4GZY A;  1TWH K;  2R93 K;  2E2J C;  3PO3 K;  3I4N K;  4Y7N C;  2VUM C;  4BY7 C;  2NVQ K;  1ZYR A;  3GTJ C;  3HOZ C;  3FKI C;  1IW7 A;  1WCM K;  4AYB L;  2WAQ L;  2NVT K;  3S1Q C;  2PA8 L;  3GTL K;  3GTP C;  1TWC C;  2NVY C;  1TWA K;  4A3M C;  1SFO K;  3S16 K;  5TMF A;  5IP7 K;  4KN4 A;  5M5X K;  3I4M C;  4G7O A;  2BE5 A;  1YNN A;  5FLM K;  3M3Y C;  3S15 K;  4A93 C;  3S1M C;  4A3F K;  4XSZ A;  3GTO C;  3GTM K;  4A3B C;  3EQL A;  1BDF A;  3PO2 K;  5C4J C;  3HOU C;  5IYD K;  5D4D A;  2A68 A;  5C4X C;  1SMY A;  1I6V A;  4QIW L;  1TWG K;  2E2H K;  4A3G K;  4A3K C;  4XLP A;  2Y0S L;  2R92 K;  4A3I C;  4XLN A;  4LK1 A;  3M4O C;  3S17 K;  3S14 C;  4BXX C;  4Y52 K;  2A6E A;  4KN7 A;  4LK0 A;  3GTQ C;  1I6H C;  3HOV C;  4YFN A;  4YG2 A;  2E2J K;  1I3Q C;  4Y7N K;  4BY7 K;  5IYB C;  3GTJ K;  4OIP A;  3FKI K;  3CQZ C;  4BY1 C;  4OIN A;  3RZO C;  2PMZ D;  1I50 C;  1HQM A;  4A3E C;  3RZD C;  3S1Q K;  4JK1 A;  4KMU A;  5IYC C;  3GTP K;  4OIQ A;  1TWC K;  2NVY K;  2JA5 C;  3HKZ D;  2YU9 C;  4BBS K;  2WB1 D;  1K83 C;  2E2I C;  4A3C C;  3S1R K;  4XSX A;  3S2H C;  3M3Y K;  3H0G C;  3H3V D;  3GTG C;  3S1M K;  4A93 K;  5IP9 C;  1YNJ A;  5M5W K;  4A3L C;  1Y1V C;  2NVX C;  5M5Y K;  5C44 C;  4QJV B;  4Q4Z A;  4A3B K;  4A3D C;  4QJV A;  5C4J K;  4NOI A;  5C3E C;  3HOU K;  5C4X K;  4YFX A;  2B63 C;  3HKZ L;  4A3K K;  3K7A C;  3GTK C;  4Q5S A;  5FJ8 K;  4A3I K;  3M4O K;  5IP7 C;  2CW0 A;  2JA8 C;  3S2D C;  4C2M K;  4OIR A;  1TWF C;  3GTQ K;  4BXX K;  1I6H K;  3S1N C;  2VUM K;  4G7Z A;  4OIO A;  3HOZ K;  1XPP A;  1I3Q K;  5IYB K;  4MEY A;  3HOX C;  3PO2 C;  4X6A C;  1R9T C;  4BY1 K;  3CQZ K;  3RZO K;  4A3M K;  1Y1W C;  1I50 K;  4A3E K;  4A3J C;  5M3F K;  3RZD K;  5IYC K;  4AYB D;  2WAQ D;  2JA7 C;  5M3M K;  2PA8 D;  3I4M K;  2PPB A;  4LLG A;  3HOY C;  2R92 C;  4G7H A;  2JA6 C;  2YU9 K;  2R7Z C;  3HOW C;  4BBR C;  1K83 K;  1TWH C;  2A6H A;  2R93 C;  4LJZ A;  3WOD A;  3GTO K;  3PO3 C;  3S2H K;  3I4N C;  3H0G K;  3GTG K;  4YFK A;  2NVQ C;  5IP9 K;  4A3L K;  2PMZ L;  1Y1V K;  2NVX K;  5C44 K;  5TMC A;  2NVT C;  1WCM C;  4MQ9 A;  4A3D K;  3GTL C;  5C3E K;  1SFO C;  1TWA C;  4C3I K;  2WB1 L; 
#chains in the Genus database with same CATH topology
 3ERE D;  3HXA A;  3S14 K;  5IOT A;  5FLM C;  1B4A A;  2V6T A;  2Y0S D;  4BBS C;  4A3F C;  3T01 A;  1TWF K;  1ZQ1 C;  5HL8 A;  3GTM C;  4WIL A;  4C3H K;  1TWG C;  1WSV A;  1Y1W K;  2JA5 K;  1EK8 A;  2V6U A;  3S17 C;  1O26 A;  2E2J C;  3HOZ C;  1F93 A;  1IW7 A;  4AYB L;  2NVT K;  2PA8 L;  1DD5 A;  3GTG A;  3S16 K;  3I4M C;  1JQW A;  3S15 K;  1XZP A;  3S1M C;  5IYD K;  3HOU C;  1WOP A;  2A68 A;  1TWF A;  1BGW A;  3AQP A;  2E2H K;  4A3G K;  4A3I C;  1USM A;  3GEH A;  3N0C A;  4BKW A;  4C2M C;  4LK0 A;  1YCL A;  3HOV C;  2JA5 A;  1ZXO A;  1XZQ B;  4OIP A;  1C0A A;  3ORE A;  4GTF A;  3GIR A;  1XZP B;  4GTL A;  3GEI A;  4C45 A;  4BBS K;  4A3C C;  2V6S A;  3GTG C;  5IP9 C;  5C44 C;  4Q4Z A;  4A3B K;  4QJV A;  5C4J K;  4NOI A;  1XXB A;  3GDZ A;  1O27 A;  3AD9 C;  5C4X K;  4YFX A;  1JOE A;  1O2A A;  4Q5S A;  3M4O K;  1J6W A;  5CJ9 A;  5TJ3 A;  1F7V A;  1TWF C;  3GTQ K;  5IOR A;  3HOZ K;  1PJ7 A;  4C3H C;  1I3Q K;  2Y3P A;  1VJE A;  5IYB K;  3FHZ A;  1HI9 A;  5JVO A;  1Y1W C;  1VH2 A;  3N0B A;  3I4M K;  2R92 C;  1TWA A;  3WOD A;  4GFQ A;  4A3L K;  2XCR B;  2NVT C;  4A3D K;  4XCH A;  3S16 C;  4QIW D;  3GTK K;  1TWG A;  3H3V L;  3HOV K;  3S15 C;  3S2D K;  3SZY A;  5IYD C;  4GTB A;  3LAJ A;  5IOS A;  3VA7 A;  1IS1 A;  2E2H C;  4A3G C;  1GE9 A;  1I3Q A;  4A3C K;  2FQO A;  2XCO A;  3HOW K;  3PO3 K;  3T00 A;  1WSR A;  1ZYR A;  4KC6 A;  3IPJ A;  1WCM K;  3TTG A;  3GTL K;  4P5B A;  1BJT A;  4A3M C;  3FOF A;  1DCO A;  2BE5 A;  1YNN A;  4XSZ A;  3GTO C;  1IE0 A;  3GTK A;  4A3B C;  2GAH C;  1J6X A;  4P5A A;  5C4J C;  4LR2 A;  5C4X C;  1SMY A;  3TFI A;  1I6V A;  1WOS A;  4G0V A;  2GAG C;  3NUH A;  4XLP A;  2Y0S L;  4KAS A;  2R92 K;  3M4O C;  4Y52 K;  4PAB A;  3GTQ C;  3AD7 C;  4YFN A;  4YG2 A;  1XZQ A;  1I3Q C;  4Y7N K;  4BY7 K;  5IYB C;  3GTJ K;  4KMH A;  3S1Q K;  2KWA A;  1TWC K;  2GSN A;  1WCM A;  1WQF A;  2WB1 D;  4GTC A;  3GTL A;  5EGH A;  3M3Y K;  5M5W K;  1YNJ A;  4A3L C;  2FQT A;  4FZB A;  4A3D C;  4PAA A;  3MML B;  3GTK C;  1VGX A;  5FJ8 K;  1Y1W A;  5JFE A;  2CW0 A;  3S2D C;  3G4C A;  2R92 A;  4GTE A;  1O29 A;  1XPP A;  1IBA A;  3PO2 C;  4KMA A;  3CQZ K;  1J6V A;  1XXA A;  4A3M K;  3RZO K;  1I50 K;  4A3E K;  3RZD K;  5IYC K;  2WAQ D;  3T02 A;  3OPF A;  2RH6 A;  3TFJ A;  2YU9 K;  3HOW C;  3GTO K;  1TWC A;  3PO3 C;  1JVI A;  4RMF A;  1Y1V K;  2NVX K;  1WCM C;  3GTL C;  5C3E K;  3AH5 A;  4KB2 A;  1EQR A;  4C3I K;  4C3J K;  3ADA C;  2A69 A;  2E2H A;  4GTA A;  3N3Y A;  3S1R C;  2O5J A;  3S1N K;  2ZUF A;  1AB4 A;  4X6A K;  3DXJ A;  1R9T K;  2GSO A;  2P8T A;  3L4K A;  4DDQ A;  2JA7 K;  3QX3 A;  2O5I A;  4Y52 C;  3CQZ A;  2JA6 K;  4KM9 A;  1I50 A;  4BBR K;  3I4N K;  4Y7N C;  2VUM C;  4BY7 C;  3GTJ C;  3GTO A;  3S1Q C;  4FM9 A;  1TWC C;  1SFO K;  1Y1V A;  4LQY A;  4KMD A;  5TMF A;  5M5X K;  1G51 A;  3M3Y C;  2CFA B;  3GTQ A;  3PO2 K;  3LAP A;  4QIW L;  1WQH A;  2D6F C;  3G4A A;  4XLN A;  4LK1 A;  2XCQ A;  4GTD A;  1R9T A;  1O28 A;  1IQ0 A;  2JA7 A;  3FKI K;  3CQZ C;  4OIN A;  4J3N A;  3RZO C;  2PMZ D;  1I50 C;  1UV7 A;  4A3E C;  1O2B A;  3RZD C;  4JK1 A;  3JST A;  5IYC C;  3A8K A;  3GTP K;  2NVY K;  1WOO A;  2YU9 C;  2E2I C;  3S1R K;  1SFO A;  4A93 K;  1WQG A;  1Y1V C;  2NVX C;  2PHC B;  5C3E C;  3A8I A;  1F9N A;  3GSI A;  1O24 A;  3BP8 C;  4C3I C;  4C3J C;  1J98 A;  3AD8 C;  4BLB A;  4A3K K;  5IP7 C;  4BXX K;  4OIR A;  1I6H K;  3S1N C;  2RGR A;  2VUM K;  4OIO A;  1X31 C;  2ZFZ A;  4KAW X;  4MEY A;  4X6A C;  1WOR A;  2GSU A;  1R9T C;  4BY1 K;  3BP3 A;  3V4G A;  4WJ3 M;  4AYB D;  2JA7 C;  2P5M A;  5M3M K;  2PA8 D;  4GT9 A;  2PPB A;  3FKI A;  2JA6 C;  4AH6 A;  3LPX A;  4BBR C;  1K83 K;  3GTP A;  2A6H A;  2NVY A;  3S2H K;  3L4J A;  3I4N C;  3H0G K;  4WJ4 A;  1EH1 A;  3Q3Q A;  1IL2 A;  1SFO C;  4BLA A;  1VRQ C;  5L46 A;  1PJ5 A;  2WB1 L;  1VLO A;  2B63 K;  3K7A K;  4MEX A;  2JA8 K;  1YX2 A;  1ZVU A;  2ZUE A;  4ILD A;  3HOX K;  4ZH4 A;  2VUM A;  1L0W A;  4O2D A;  3GTJ A;  4A3J K;  1EFW A;  3A8J A;  1WIH A;  2E2I K;  3GEE A;  3HOY K;  3FOE A;  2R7Z K;  4GZY A;  1TWH K;  2R93 K;  1ISE A;  2NVQ K;  3FKI C;  1K83 A;  3AQO A;  2WAQ L;  1EI6 A;  2W7V A;  3GTP C;  3H0G A;  2NVY C;  1TWA K;  5IP7 K;  4KN4 A;  4G7O A;  5FLM K;  4A93 C;  1DCP A;  4A3F K;  1XXC A;  2CFA A;  2B63 A;  5CHP A;  1BS2 A;  4M1X A;  3EQL A;  3GTM K;  1BDF A;  5D4D A;  1USO A;  4KB4 A;  1TWG K;  3CAG A;  4A3K C;  2EBB A;  3S17 K;  3S14 C;  4BXX C;  1RU0 A;  2A6E A;  4KN7 A;  1I6H C;  5EGE A;  1DCH A;  2JH3 A;  2YU9 A;  5IOQ A;  2E2J K;  2E2I A;  3S0X A;  4KAT A;  4KM8 A;  2R7Z A;  4BY1 C;  1TWH A;  4G0W A;  2R93 A;  1PJ6 A;  1HQM A;  2NVX A;  4KMU A;  4OIQ A;  1KQ4 A;  1B4B A;  2JA5 C;  1INN A;  3HKZ D;  1K83 C;  4XSX A;  1F7U A;  3S2H C;  3H0G C;  3H3V D;  3S1M K;  5M5Y K;  4QJV B;  4KAR A;  3HOU K;  4KDD A;  3GTM A;  2B63 C;  3HKZ L;  3K7A C;  4A3I K;  2JA8 C;  1O25 A;  4C2M K;  4G7Z A;  2JA6 A;  3BUE A;  3HOX C;  4A3J C;  5M3F K;  5E68 A;  1O2F B;  4LOW A;  4LLG A;  3HOY C;  1V5V A;  3OEP A;  4G7H A;  2R7Z C;  1TWH C;  2R93 C;  4LJZ A;  3SZZ A;  3GTG K;  4YFK A;  2NVQ C;  5IP9 K;  2PMZ L;  5C44 K;  5TMC A;  4MQ9 A;  4P9S A;  1ZBS A;  1TWA C;  3TFH A;  4G0U A; 
#chains in the Genus database with same CATH homology
 4C3J K;  3S16 C;  3S14 K;  4QIW D;  2B63 K;  3GTK K;  3K7A K;  2A69 A;  4MEX A;  5FLM C;  3H3V L;  3HOV K;  3S15 C;  4BBS C;  2Y0S D;  2JA8 K;  3S2D K;  4A3F C;  1TWF K;  3S1R C;  2O5J A;  3S1N K;  3GTM C;  5IYD C;  4C3H K;  3HOX K;  3DXJ A;  4X6A K;  4ZH4 A;  1R9T K;  1TWG C;  2E2H C;  4A3G C;  1Y1W K;  4A3J K;  2JA5 K;  2JA7 K;  2O5I A;  3S17 C;  2E2I K;  4Y52 C;  4A3C K;  3HOY K;  2JA6 K;  2R7Z K;  3HOW K;  4BBR K;  4GZY A;  1TWH K;  2R93 K;  2E2J C;  3PO3 K;  3I4N K;  4Y7N C;  2VUM C;  4BY7 C;  2NVQ K;  1ZYR A;  3GTJ C;  3HOZ C;  3FKI C;  1IW7 A;  1WCM K;  4AYB L;  2WAQ L;  2NVT K;  3S1Q C;  2PA8 L;  3GTL K;  3GTP C;  1TWC C;  2NVY C;  1TWA K;  4A3M C;  1SFO K;  3S16 K;  5TMF A;  5IP7 K;  4KN4 A;  5M5X K;  3I4M C;  4G7O A;  2BE5 A;  1YNN A;  5FLM K;  3M3Y C;  3S15 K;  4A93 C;  3S1M C;  4A3F K;  4XSZ A;  3GTO C;  3GTM K;  4A3B C;  3EQL A;  1BDF A;  3PO2 K;  5C4J C;  3HOU C;  5IYD K;  5D4D A;  2A68 A;  5C4X C;  1SMY A;  1I6V A;  4QIW L;  1TWG K;  2E2H K;  4A3G K;  4A3K C;  4XLP A;  2Y0S L;  2R92 K;  4A3I C;  4XLN A;  4LK1 A;  3M4O C;  3S17 K;  3S14 C;  4BXX C;  4Y52 K;  2A6E A;  4KN7 A;  4LK0 A;  3GTQ C;  1I6H C;  3HOV C;  4YFN A;  4YG2 A;  2E2J K;  1I3Q C;  4Y7N K;  4BY7 K;  5IYB C;  3GTJ K;  4OIP A;  3FKI K;  3CQZ C;  4BY1 C;  4OIN A;  3RZO C;  2PMZ D;  1I50 C;  1HQM A;  4A3E C;  3RZD C;  3S1Q K;  4JK1 A;  4KMU A;  5IYC C;  3GTP K;  4OIQ A;  1TWC K;  2NVY K;  2JA5 C;  3HKZ D;  2YU9 C;  4BBS K;  2WB1 D;  1K83 C;  2E2I C;  4A3C C;  3S1R K;  4XSX A;  3S2H C;  3M3Y K;  3H0G C;  3H3V D;  3GTG C;  3S1M K;  4A93 K;  5IP9 C;  1YNJ A;  5M5W K;  4A3L C;  1Y1V C;  2NVX C;  5M5Y K;  5C44 C;  4QJV B;  4Q4Z A;  4A3B K;  4A3D C;  4QJV A;  5C4J K;  4NOI A;  5C3E C;  3HOU K;  5C4X K;  4YFX A;  2B63 C;  3HKZ L;  4A3K K;  3K7A C;  3GTK C;  4Q5S A;  5FJ8 K;  4A3I K;  3M4O K;  5IP7 C;  2CW0 A;  2JA8 C;  3S2D C;  4C2M K;  4OIR A;  1TWF C;  3GTQ K;  4BXX K;  1I6H K;  3S1N C;  2VUM K;  4G7Z A;  4OIO A;  3HOZ K;  1XPP A;  1I3Q K;  5IYB K;  4MEY A;  3HOX C;  3PO2 C;  4X6A C;  1R9T C;  4BY1 K;  3CQZ K;  3RZO K;  4A3M K;  1Y1W C;  1I50 K;  4A3E K;  4A3J C;  5M3F K;  3RZD K;  5IYC K;  4AYB D;  2WAQ D;  2JA7 C;  5M3M K;  2PA8 D;  3I4M K;  2PPB A;  4LLG A;  3HOY C;  2R92 C;  4G7H A;  2JA6 C;  2YU9 K;  2R7Z C;  3HOW C;  4BBR C;  1K83 K;  1TWH C;  2A6H A;  2R93 C;  4LJZ A;  3WOD A;  3GTO K;  3PO3 C;  3S2H K;  3I4N C;  3H0G K;  3GTG K;  4YFK A;  2NVQ C;  5IP9 K;  4A3L K;  2PMZ L;  1Y1V K;  2NVX K;  5C44 K;  5TMC A;  2NVT C;  1WCM C;  4MQ9 A;  4A3D K;  3GTL C;  5C3E K;  1SFO C;  1TWA C;  4C3I K;  2WB1 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...