3S1NH

Rna polymerase ii initiation complex with a 5-nt rna (variant 2)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1nH00
4LF9L 2L15A 3HOZH 1PH2A 3HOYG 1IBLL 5IYDG 5FLMH 4NPSA 4GNXA 4LF8Q 5IYBG 4TVAB 5JJIA 2JA6H 1VQPA 4UY8C 4H02A 1L2FA 4LFAQ 3BU2A 4HIMA 5C4XH 3W1BA 3GTGH 3H15A 3T1YL 2ALYB 4C3IH 3PGZA 1LUZA 2VQFQ 3HOWH 3D31A 3PUVA 1V1QA 1VQCA 5JJLA 3M85A 4GN3B 3TREA 5M5YH 3NELA 5IP7G 3J81j 3S1RH 2JA8H 2WB1G 3M4PA 4LFCQ 2VNUD 2CWAA 3M3YH 4DV5Q 2UXBL 4J15A 1VS0A 1YI2A 5LMUQ 4IOAA 4EX5A 1SLJA 2XGTA 2N3SA 5AJ3Q 2K50A 3AQQA 3S2DH 1D7QA 3PV0A 4JC0A 3I55A 2B29A 3KJOA 2CKZB 2JK8A 3F2BA 1N36Q 5JEAG 1XMOL 2JA5G 1IBKL 1Y1VH 4LF7L 1VQHA 2N49A 2BH8A 4UP8A 5IYCH 1CSQA 4HJ8A 2E2JH 4A3LG 3PUWA 4DV6L 3RZDH 2LSSA 3HOZG 4POFA 1YHQA 2VUMH 4O2DA 1NMFA 2VZAA 1E24A 5FLMG 3G48A 2UUAL 4LF5L 4LF6L 3BJUA 1A0IA 3GTQH 1IL2A 3F1ZA 1ASYA 1N33L 1PVOA 3KDFB 2UUBQ 1WYDA 1SMXA 3HOUH 1G51A 3G4SA 3S1NH 1OXXK 4GLAC 4IJHA 4YCUA 2Q2TA 4RMFA 3HOWG 4JI0L 1WCMH 1P16A 1EUJA 4HIOA 4AQYL 1TWCH 2NN6I 1VQKA 3K0XA 3JAMi 4LF4Q 2R6GA 4IO9A 2K5VA 3E9HA 1B70B 2JJQA 1UE7A 3RLFA 4DV4Q 3GO5A 2Z0SA 1T9HA 4DUZL 4LFBL 4P72A 4JI2L 4GOPB 1GVPA 1Q1EA 3CW2C 3H0GH 4BBSH 3U58A 4KLKA 4LUVA 3S24A 3E0EA 3H3VH 5BR8Q 3M7NA 3CPFA 3CCEA 3F2DA 4DV2Q 4JI4Q 3I4MH 4R4QA 1O7IA 2HIXA 3CCMA 1Y1VG 4NXMQ 1PH3A 1QZHA 5IYCG 4BA2I 4GKJL 3GTJH 1B8AA 4JOIA 4QIWE 3KYHC 3D0FA 4GKKQ 5GADC 2MQHA 2QA4A 4QJFA 1VQ7A 4DKAC 3KF6B 1XPUA 4DR7L 2Z6KA 1Q12A 2EIFA 4BBRH 4A4IA 1XPRA 1X3EA 2R92G 5IYDH 4JBMA 4JI5L 1EOVA 5IYBH 5AJ3L 2PQAB 4C2MH 2PI2E 1OXSC 1Y14B 4KI0A 3L7ZC 1YHAA 3JAMc 1VQOA 1NTGA 3A74A 3HOUG 2NN6G 2WFWA 3HOXH 4B3RQ 1YBYA 1WCMG 3KF8B 3AFQA 3GTKH 4OX9L 2I5HA 3RZOH 1L1OC 3CCVA 2R7FA 5M5XH 3A5ZB 1Q7YC 4DR4Q 2ZM6L 4A3KH 2BA1A 4MNOA 3H0GG 2E5LL 4BBSG 4DV7Q 4HIDA 2JEAI 3EIVA 2YTYA 1C0AA 1PH9A 1YJNA 1WOCA 2Q2HA 2RF4A 4JI6Q 4YCWA 2YV5A 1J5EQ 2KBNA 4A3EH 4JI7L 1TWAH 2DGYA 2OQKA 1TWFH 3FHWA 2JA5H 2HIVA 4X6AH 1XTDA 4OO1G 2D0PA 4JBKA 4A3CG 1EYGA 1AE2A 1PH8A 2YTXA 5M3MG 2N78A 4AYBE 4YHHQ 4QQBX 4WJ4A 4A3LH 2GN5A 4HJ9A 3PO3G 3I7FA 1Q82C 1E3PA 4GN4B 4XIGS 4DV4L 4DR1Q 1XNRL 3HKZG 4IOCA 4BBRG 4IFDI 4JG2A 4DUYL 4Y7NH 1PYBA 4JI1L 3CCUA 2MNAA 1HNZQ 4JBWA 4DV3L 5M5WH 1VQMA 4UP9A 2K5HA 3CCRA 4JI4L 2IT1A 4APVA 4DV2L 3PCOB 4P75A 2E8GA 3HOXG 4B3TQ 4YWKA 4GOPC 3A5UA 1CSPA 2ID0A 3J81i 1CKMA 2AWOA 2NZOA 4YWLA 4WJ3M 4GN5A 4R4IA 2H5XA 2QGQA 2UUCQ 3CCQA 5JEAJ 3GTLH 1HZ9A 2YU9H 2UXDQ 4X66L 3WWVA 1QVCA 4A3KG 4A93H 4GNXC 1VQ6A 1W2BA 1I5FA 3PUYA 3S1MH 3L2PA 1K3RA 1K8AC 1L1OB 4BY1H 1HNWQ 1Y1WH 1HR0W 4A3EG 1QUQA 4K0KQ 1XMQL 4X65L 1HR0L 1I6HH 4PZ8A 2NVQH 2D0OA 1X3GA 1JJCB 3CQZH 3GD7A 1PHJA 3CCJA 3U4ZA 4B3ML 5IT9c 1PA6A 1JB7A 4KHPL 4IFDG 2KHIA 5IWAQ 1XNQQ 1Z9FA 2RHSB 2K75A 3RLOA 3T1HL 1VQLA 2Y0SE 1EQRA 4A3JH 4DR5L 1GO3E 3TS0A 1S72A 1YEZA 1Q81C 5FJ8H 2KCMA 4A3FH 1TWHH 3AFPA 1EIFA 4QGUA 4PZ7A 1HNXQ 3TRZA 3J81c 2UU9Q 4JI6L 4DR6L 1LYLA 4DR2Q 4A3MH 4DV0Q 4NB3A 2LXJA 4AH6A 4AIMA 4C3JH 4JV5Q 2HHHQ 2A1AA 3GTMH 4DV1Q 2B3GA 4LUOA 1X56A 2V1CC 2ZJQA 5DLQE 4P73A 4A76A 4JYAQ 5C44G 1CKNA 1OTCA 2ZTCA 1QVFA 1L0WA 2R92H 1H95A 1HZBA 3E9IA 1GM5A 3JC66 1YJ9A 2UXCQ 4B3SL 4JCVE 1N32Q 3UDGA 1VQ8A 1VQDA 2NZHA 4R4CA 4DR3Q 3UDFA 2R7ZH 4A93G 1AH9A 1JT8A 2JE6I 1KRSA 1J6QA 4PMWA 2ZJPA 1K8GA 1EFWA 4LF8L 3TS2A 1TXYA 2NVYH 1V43A 3I4OA 4LNQA 4BY1G 1OXVA 3UDIA 3CF5A 1Y1WG 1NE3A 2MO0A 3S15H 4LFAL 4A3DG 2I5LX 4BY7H 4L5QA 4P74A 5GAEC 2IX0A 1Q86C 1KQSA 4GNXB 5K36G 5FLXc 2VQFL 4B3TL 1C7YA 2BH2A 2N8NA 1IXRA 1HH2P 1PH6A 4A3CH 3CXCA 5M3MH 1BBWA 1M1KC 1CUKA 2CWPA 2PMZE 3ZJYC 3PF4A 4LFCL 4X64Q 4DV5L 3UDXA 5IP9G 4LF9Q 1LM0A 1R9TH 1VQAA 4A3JG 2F3IA 5HY6A 4OWWB 1TWGH 3EBEA 5FJ8G 3DM3A 3M9BA 1CKOA 4RG1A 5LMUL 4A3FG 4JI3Q 4QY7A 3I4NG 2Q2IA 1HNWL 1JJ2A 2JQOA 4A3MG 3EN2A 2A19A 2I5MX 2F4VQ 1UEBA 1GKHA 1SE8A 1KD1C 4JBJA 1N36L 3BZKA 3MXNB 4JOIC 4HJAA 1D8LA 1MIUA 1HZCA 1B7YB 5J3BA 1IZ6A 2BA0A 4UPAA 4YY3Q 2I0QA 4A3IH 4OWXB 3S14H 1P8LA 2VL6A 2FXQA 2Z6KC 1KL9A 4X62Q 4FDBA 2YYZA 4LW1A 3ULPA 1XNQL 2A8VA 1X6OA 2IHFA 2IY5B 1SFOH 2R7ZG 2UXBQ 3K80C 1XPOA 2OTLA 1YITA 1KC8C 2B63G 2WP8J 1DGSA 4MTNA 2UU9L 5GAHC 4PG3A 1SRUA 2EQSA 4DR2L 3S16H 4Y52H 1W3SA 2AMCB 4LUZA 4IPGA 5GAGC 1NBWA 3Q8DA 4HJ5A 2UUBL 4BY7G 1AE3A 2HHHL 2VY3A 1N34Q 3HOVH 2D62A 4DK3C 1XMOQ 1SROA 4GS3A 3UE0A 1IBKQ 2KHJA 2CCZA 4LF7Q 4C3HH 2YTVA 4YCVA 1MJCA 4IPDA 3MEFA 3STBD 4LF4L 5C0XI 4NXNQ 2K14A 4DV6Q 4JI8Q 2PI2A 3TEHB 3NBHB 4DR3L 3GTOH 1G6PA 3CMAA 3PO3H 1LTLA 1SR3A 4DAMA 2R7DA 4LF5Q 1E22A 5C3EH 4LF6Q 3GTPH 3L0OA 5BR8L 2QEXA 1N33Q 2R93H 1ASZA 3F8TA 3TQYA 1UE6A 2MFIA 1VQJA 2K52A 3F2CA 1A62A 1OXUA 4NXML 5C4JH 4JI0Q 4QL5A 5C44H 5EAYA 4AQYQ 4A3IG 2WAQE 1RIPA 2EXDA 4TQUS 3U50C 3ERSX 1WFQA 2JEBI 1PH4A 4GKKL 4UP7A 1K0RA 5C0XJ 3OTOQ 2ZJRA 3AEVA 4LFBQ 4DUZQ 3CP0A 4JI2Q 2VW9A 1RL2A 1YHBA 1FL0A 1WJJA 2KENA 3PUZA 3SGIA 2C35B 5IE8A 3S2HH 1X54A 3H3VI 4IFDJ 4JI3L 3ER0A 1QZGA 2RCNA 2E2HH 1UE5A 2VQEQ 3IRBA 2F4VL 1BKBA 4DAYB 4A3DH 3OYYA 1U0LA 1EQQA 3HOVG 3PO2G 1IBMQ 1JE5A 5C0XG 4B3RL 1E7ZA 1U5KA 3KF6A 3K7UC 3NEMA 1N8RC 4GKJQ 4YY3L 4A3BH 2AHOB 2RHQB 2CFMA 1VQ4A 4X62L 1IYJB 1NMGA 3PSIA 4DR4L 1OXTA 1VQEA 2PQAA 4AYBG 4IPCA 4DR7Q 5IP9H 3HFZB 3CMEA 4B3SQ 3CCLA 1PV4A 5GQOA 4P71A 4DV7L 4BXXH 2AKWB 2E2IH 1FGUA 4JI5Q 5C3EG 3I4NH 5GROA 1FJGQ 1A63A 1YZ6A 1J5EL 2R93G 3VDYA 3ICEA 3I2ZA 3K8AA 1N34L 1VQNA 1KAWA 1VCIA 5H1SE 1X9NA 4ME3A 5IY0A 3J7A5 4EQ5A 3FKIH 4KHZA 2MO1A 1VQBA 1S3OA 4YHHL 3K81C 4NXNL 4OXPA 4OX9Q 3KFUA 2HQLA 2WAQG 3U4VA 4DR1L 1VQ9A 4JI8L 1Q46A 2ZM6Q 4OONA 4A75A 2JA9A 1HJPA 2HT1A 3RNUA 4L5SA 2E5LQ 4GLVB 1SN8A 2B63H 1HNZL 1PH1A 4DNIA 4L5RC 1YJWA 2JA6G 1Z47A 4IPHA 3ULLA 4BA1I 2ES2A 1I50H 2VS1A 1V9PA 5C4XG 1KXLA 3PIOA 4JI7Q 1YNXA 3CC7A 3RN2A 4DK6C 3UE1A 1NY4A 1EWIA 2XTIA 3KLWA 3M4QA 3J80i 3CC2A 4A3BG 1JJGA 1I94Q 3ULJA 3G6EA 5LMNQ 2UUCL 2UXDL 3HKSA 4ALPA 2JA8G 1I3QH 3OTOL 3B6YA 1XNRQ 4DPGA 4OWTB 1PYSB 3BZCA 3LGJA 4A3GH 1Q8KA 1BBUA 3GDEA 4O0AA 4R4OA 1FVIA 2Y0SG 4DUYQ 1IBLQ 4JI1Q 1E1TA 4BXXG 1K9MC 2F52A 3KOJA 1G291 4L5TA 2VQEL 2IHEA 4DV3Q 1JMCA 1C9OA 2DUDA 4K0KL 3T1YQ 3PF5A 4HIKA 1IBML 2ATWA 3CC4A 3FKIG 3I56A 2Q2UA 1NJIC 2NVXH 1YIJA 4IJLA 1HZAA 5M3FH 1GD7A 1QUQB 3W1GA 1EIYB 1BVSA 5IWAL 3HKZE 2JA7H 4OO1I 2AWNA 4LWCA 1X3FA 2ZTDA 1L1OA 3NENA 1UWVA 2K5NA 4XTCS 4X66Q 3STBC 1KIXA 2VUMG 3HOYH 4R4TA 3FP9A 1YVCA 2IX1A 3PIPA 3W5OA 2LXKA 5ELNA 1VQFA 2GVAA 3J80c 1HNXL 1K73C 4POGA 1FJGL 1K83H 4YWMA 3CAMA 4HJ7A 4DV0L 4JV5L 1VQ5A 5E7NA 3PO2H 5JJKA 1WI5A 1VQGA 4DV1L 1XMQQ 4X65Q 1PFSA 1HR0Q 2ASBA 3KJPA 2OTJA 1QVGA 3CD6A 4JYAL 3RLNA 1PH5A 4B3MQ 2WB1E 1X55A 5IP7H 4KHPQ 1M90C 2UXCL 2KCTA 1N32L 3PUXA 3M4OH 2OQ0A 1CKNB 3T1HQ 1Q1BA 3KDFA 3DLLA 4DR5Q 2K4KA 2UUAQ 3RN5A 1KRTA 4A3GG 1XJVA 2ZTEA 3AYHB 1S40A 1X65A 1N9WA 4DR6Q 1VQIA 4MZ9A 1KHIA 3CPWA 4GLXA 3G71A 3I4MG 2GVBA 3CCSA 2OWOA 3A0JA 2CQOA 1E1OA 1A8VA 4PZ6A 4R1JA 5LMNW 3S17H 3K7AH 5M3FG 1MKHA 5HGQA 4GOPA 1UE1A 3RR5A 1I94L 2NVTH 5LMNL 1PH7A 1MJEA 2JA7G 5ELOA 3J7ZC 3S1QH 2OCEA 4X64L 3OW2A 2PNHA
chains in the Genus database with same CATH superfamily
1I4QA 4LF9L 1PH2A 4A3FB 4K6LA 2AQ3B 5IYDG 4LF8Q 1YNJD 4TVAB 1F9PA 4UY8C 3SK4A 2RDHA 2ZXRA 2VQFQ 3HOWH 1V1QA 4RA8A 1F9SA 1QCBD 3K59A 5JJLA 1KABA 5M5YH 5IP7G 3J81j 2WINB 4CKBA 1QE6A 1LACA 2CWAA 4DV5Q 1BQQT 2K5WA 4J15A 2K04A 1VS0A 2NVYB 3Q23A 1YI2A 3S2DH 3AQQA 3KBXA 3MXGA 4L8JA 2PW7A 2B29A 4FF1A 2CKZB 2K05A 3F2BA 2JA5G 1IBKL 1Y1VH 1TS3A 3NWTA 4UP8A 4HSPA 5M3MB 1CSQA 5FOBB 2E2JH 3A55A 4DV6L 2B8GA 2LSSA 5CORA 3TP7A 2VUMH 4O2DA 2UUAL 5CV5A 3G48A 2F0KA 3BJUA 3MWYW 5FKAC 4BWGB 3F1ZA 1EEID 1N33L 1PVOA 5J1ZA 4CJ1B 2E74C 3G4SA 1SEBD 4GLAC 3HOWG 2MHVA 4AQYL 3S14B 2DY7A 3D6WA 3EQLC 2JJQA 4KN7C 1S5BD 1RDPD 1T9HA 3UI2A 1U4RA 3G7LA 3U58A 5IOCA 4LUVA 3E0EA 3M7NA 2DJFC 3I4MH 3F2DA 4RCNA 3VA7A 1Y1VG 1PH3A 1QZHA 4N8FA 1DXMA 4XYQA 1CA5A 3D6CA 3D0FA 4GKKQ 3QB3A 2Z6KA 2A5HA 2KQ3A 4K5WA 2XIWA 4A4IA 5E1FA 1Z7TA 5C3EB 3A8JE 3BDCA 5CMDA 2PI2E 4KI0A 2R93B 1O80A 3L7ZC 5G3LD 1I6VC 1PTOF 2LFNA 2DNEA 5C4JB 3GV6A 4B3RQ 1EU3A 1GJXA 4HMIA 4TKOB 5IIFA 4HCSA 1DONA 4IN3A 4OX9L 2F0QA 3RZOH 3CCVA 5M5XH 4RWSC 1KTKA 2H4OA 4FNFA 1D5MC 1EYCA 5J22A 4KHVA 2F0PA 2E2HB 2Q2HA 2RF4A 2L55A 2YV5A 1ONLA 4A3EH 3J7AF 1F9QA 1PTOD 1TWFH 1AE2A 1PH8A 4I7ZC 4CKCA 5M3MG 1BXTA 4YHHQ 1SYDA 1LTSD 2K33A 4ZQ3A 4CBVA 4XIGS 4DV4L 4G7HC 1SAPA 4IFDI 3I4NB 1SBBB 5IGDA 1YNNC 3CCUA 1EL0A 4UP9A 2K5HA 4JI4L 4PMBA 1RTNA 2E8GA 3FKIB 4KY6A 1CSPA 1CKMA 3LWEA 3RD4A 2NZOA 1LT5D 4YWLA 1SYBA 4WJ3M 5DNFA 2QGQA 2UUCQ 3NHHA 2EY5A 4A93H 3WWVA 3TN2A 1GUNA 1RTOA 1LTGD 1B2TA 3NWSA 3EA6A 3L2PA 4BY1H 5CYUA 4A3EG 1QUQA 3SK5A 1HR0L 2HCCA 2D0OA 3CQZH 1JJCB 3U4ZA 5IT9c 4KHPL 3E0JA 4IFDG 5IWAQ 1XNQQ 2PMZB 3RLOA 1VQLA 1S72A 3TS0A 3AFPA 4ID6A 4DR6L 4UDUC 4NMZA 2VXWA 1DM0B 3H3VC 2LXJA 4AH6A 4AIMA 1AEXA 3NK9A 2ICEC 2RCFA 2B3GA 1WTHA 4LUOA 2A69D 2QILA 1PZID 1XXGA 2BDNA 2V1CC 5DLQE 5FLXE 1AFPA 1QNKA 1CKNA 1HZBA 3I3CA 2KHSA 3JC66 2UXCQ 4B3SL 1PDQA 2R7ZH 4A93G 2RDFA 1GUTA 2ZJPA 1K8GA 4UHVA 4LF8L 5ELEA 1IKMA 1ZEQX 4BY1G 1MI2A 1QNUA 4A3DG 3S15H 4ZUIA 3BYYB 1KQSA 1Q86C 1U4LA 5I9PA 4CJ0B 4B3TL 2VQFL 4A3CH 1RJTA 4ZCKA 4RCOA 1M1KC 1S5FD 2CWPA 3PF4A 3TP6A 3CKIB 4DV5L 3UDXA 5IP9G 1LM0A 1VQAA 3I4LA 1TWGH 3EBEA 4RHRA 4DF7A 4JI3Q 3I4NG 1CFMA 2Q2IA 3QR8A 1II3A 3NBIA 1E2VA 2I5MX 1ILPA 3K6OA 3DMUA 4HJAA 1IZ6A 2NVTB 2I0QA 4A3IH 2WAQB 3BDOA 2Z6KC 3K58A 2YYZA 4LW1A 1LT6D 3MEHA 1FD7D 2A8VA 2R7ZG 3K80C 3TBIB 2O2LD 3E6ZX 4MTNA 4XDXA 1W6KA 5GAGC 1AE3A 1XMOQ 4H44C 3VA5A 3UE0A 2WIIB 4LF7Q 4YIJA 5KIXA 1MJCA 1RF2D 3MEFA 2KUMA 4NP5A 1NR2A 1EY5A 1QJOA 4NXNQ 2J4XA 3G6JB 3M3YB 3H09A 5JOBA 2RSNA 3TEHB 3NTHA 1G6PA 2DN8A 2IL8A 2Y0SB 3CMAA 1LTLA 5JPMC 1SR3A 2R7DA 1VMCA 4MN3A 5CV4A 1X32A 4DAPA 4K2KA 1EU4A 4FXGC 1A62A 1SDFA 2NUCA 4OEMB 5EAYA 4A3IG 2A74C 3CU7A 4GKKL 4HEDA 1MSGA 3CP0A 3H6MA 2VW9A 1YHBA 2M2LA 1FL0A 1QILA 1STAA 5IE8A 3S2HH 2DNCA 3H3VI 1KNAA 2L11A 1QZGA 2F4VL 3HOUB 2LMCB 5DEHA 3OMCA 3PO2G 1V8QA 3PIO3 2XN9C 1WCMB 2F3VA 4B3RL 3NEMA 1N8RC 4YY3L 5ELBA 1SXTA 2AHOB 2RHQB 1KDCA 1IYJB 4AYBG 4IPCA 1GHKA 1TT2A 3CCLA 1EQTA 5GROA 1A63A 1SSOA 5ELDA 1C48A 3ICEA 1N34L 1XWEA 5EGTA 1KAWA 3ND9A 1HPCA 1SMYC 4KHZA 1XYIA 3CRLC 4YHHL 4HAEA 1ENAA 2WAQG 3U4VA 4JI8L 1Q46A 2HDLA 2K6AA 1HQMC 4A75A 2HT1A 3RNUA 4L5SA 2E5LQ 4GLVB 1SN8A 4L5RC 3VYUA 4IURA 4IPHA 2ES2A 1DD2A 1KXLA 1YNXA 3CC7A 3AB9A 1I4RA 1PRTD 1NY4A 2XTIA 3KLWA 3GTKB 1JWMD 2F0IA 2UUCL 2B2TA 4A3KB 1EY7A 1XNRQ 2BOSA 1UNSA 2DJGC 2A68D 3W3AA 3QJYA 3GDEA 4O0AA 4R4OA 4B08A 2Y0SG 1E1TA 2IHEA 1JMCA 3QG1A 1C9OA 2N55A 3X3NA 5CV6A 2Q2UA 1VF7A 1YIJA 1TU2B 5M3FH 1GD7A 1QUQB 3J80L 1EIYB 5IWAL 4XTCS 1KIXA 4X66Q 4MIUA 2XSCA 4KY5A 3STBC 4XQJA 3HOYH 2G5DA 5KYLA 3NP8A 1YVCA 3PIPA 5M5WB 5EKLA 4WORA 5KNCA 4POGA 2PPBC 3OHXC 2F03A 2IPKD 3DWQA 4X65Q 2EJGC 2ZXPA 2C9OA 4C1NI 3I72A 4B3MQ 2WB1E 1X55A 1M90C 2UXCL 1CKNB 2TSSA 4DR5Q 2E76C 3L9AX 3RN5A 2K1BA 5EPLA 2UUAQ 4K8IA 5CV7A 1DOKA 1VQIA 1WVLA 3S9WA 3CCSA 3EJIA 4IUTA 1E1OA 1B3AA 4PZ6A 5M3FG 1MKHA 5HGQA 3J7AV 1MJEA 2OCEA 3OW2A 2PNHA 4FP5D 3ONAB 1WD0A 1TWHB 3HOYG 1LABA 5FLMH 2KA7A 4XT3B 4GNXA 4A3MB 5JJIA 2JA6H 1VQPA 1L2FA 4HMJA 5C4XH 3GTGH 4KD3A 3GTMB 1IYVA 3T1YL 2M00A 5F2DA 3E5SA 3K5LA 3PUVA 3TREA 3S1RH 3QOLA 3H91A 2FMMA 4FVMA 5LMUQ 4IOAA 4EX5A 1SLJA 4BY7B 4JC0A 1C8CA 2DY8A 2BE5D 3KJOA 2EY1A 4Q0FA 1N36Q 1XMOL 4LF7L 2N49A 4XYOA 2K7VA 5ELFA 1TVXA 4A3LG 3VR3A 2R3ZA 3WOEA 3RZDH 3TP8A 4ABNA 4POFA 1YHQA 4RGOS 1NMFA 2VZAA 1E24A 5BN5A 5FLMG 3R2TA 1BO0A 1A0IA 3GTQH 1G6ZA 1G51A 1OXXK 2B8FA 3V05A 4HIOA 2NN6I 4IO9A 2K5VA 4NDXA 3E9HA 3RLFA 4DV4Q 1GXDC 2Z0SA 1LTTD 4P72A 1A2UA 3BVMA 2F0HA 3CW2C 4KLKA 3FVQA 1EWCA 2OXPA 2KJXA 5BR8Q 1A3TA 3CCEA 4JI4Q 2CHBD 4R4QA 4C3HB 2F0NA 4CJ2C 3DWAA 4JOIA 1JOOA 2B2TC 4QIWE 4CGYB 3KYHC 1PFMA 1UUPA 1X3QA 5GADC 2MQHA 1SE3A 3JAML 4DKAC 3I73A 3PO3B 1XPRA 2R92G 5IYDH 5AJ3L 1Y14B 3R3OA 4WRDA 2E2DC 1NTGA 5KEEA 1QG7A 1CHPD 2NN6G 4RGMA 5C44B 5JPNC 1CA6A 1MGSA 3AFQA 1PTOC 3ITPA 3P20A 1Q7YC 1F2YA 4N9PA 4CDFC 1KDAA 1ESFA 2E5LL 1C0AA 1XTCD 2RDGA 1WOCA 1HTPA 3HS0C 1TWAH 3FHWA 5D14A 2JA5H 2YTXA 4WJ4A 1JWUD 2JN4A 1CZWA 4HSVA 4K14A 4AYBE 2RBMA 5CGKA 4TSSA 1Q82C 1XNRL 5IGGA 1EY4A 2M9VA 1FNUA 4Y7NH 1HNZQ 2MNAA 4FF3A 4C56C 4P75A 3MTSA 1WD1A 4X3KA 4B3TQ 2BCOA 3CRKC 1D1KA 4PMCA 5IT9E 2YU9H 3D4RA 4X66L 1QVCA 3OIPA 4GNXC 1M8AA 4LMQD 1I5FA 2B2WA 1ET6A 4TRDA 4OHJA 2X69A 2XNAC 1PTOB 1O78A 1I50B 3BDLA 5E3FA 3NSWA 4JVZA 1B53A 4X65L 1I6HH 3ZYYX 4C3HG 4PZ8A 3GD7A 1X3GA 3MXPA 2SOBA 2JSOA 5D65A 3J81L 3CCJA 4B3ML 2QCPX 2KHIA 2A69C 2RHSB 4A3GB 1QOHA 4ZUJA 2Y0SE 1EQRA 2HCIA 4DR5L 3PO3G 5FJ8H 2KCMA 4A3FH 4QGUA 1ET9A 4DV0Q 4JV5Q 4P73A 1Y8PB 4A76A 5C44G 3BVZA 4GZYC 3D4DA 1GM5A 2L0CA 3V96A 1EFID 5T1IA 2TMPA 3R8BA 1YJ9A 1N32Q 3UDGA 1EZ6A 1VQDA 2NZHA 3NTIA 4IZ8A 1ENFA 3NTKA 1K83B 2NVYH 1V43A 5D3IB 2IX0A 5G3LF 2FJ2A 4GNXB 1KDBA 4DXGA 1D2BA 1C7YA 3QIAA 1VDZA 1HH2P 4J8QA 5M3MH 1BBWA 3ZJYC 1SNDA 1LTRD 3A8IE 2F3IA 3EFXD 3MFYA 5FJ8G 4A3FG 3DWPA 3DM3A 3M9BA 5LMUL 3N52A 5EQ0A 1ENCA 4JPBW 4IALA 2F4VQ 5LL6S 1UEBA 1Q8IA 1GKHA 1KD1C 1N36L 3S17B 3BZKA 4JOIC 2NTSA 1UAPA 3K5OA 5J3BA 3PMFA 4UPAA 4YY3Q 4ZAIA 3TP5A 1RODA 3S14H 2G9HD 2VL6A 2XWBB 3HOZB 3ULPA 2IY5B 2IHFA 5IGCA 1EEFD 5I6YA 2UXBQ 4NW2A 1EY0A 1DGSA 4PNYA 1SNOA 4Y52H 4DA2A 2AMCB 4IPGA 4HJ5A 4C3IB 2HHHL 2VY3A 1N34Q 2D62A 1SROA 5C0XH 2HD3A 2KHJA 2B2VA 4YCVA 1G2TA 2JA8B 5C0XI 1H9SB 4IFDH 2RSOA 4JI8Q 4EQOA 2PI2A 4DR3L 1STYA 5A2QL 1HQRD 1WTOA 4CDEC 4LF5Q 5C3EH 5BR8L 2QEXA 2R93H 1IKLA 3E3XA 3F8TA 5EBDA 2MFIA 2K52A 3VR2A 5C4JH 4JI0Q 2EXDA 3U50C 2JEBI 5IGBA 4UP7A 4ZYSA 1BBXC 4K8JA 5C0XJ 3AEVA 4O42A 4JI2Q 2NTTA 1GUSA 1WJJA 2C35B 2WACA 1X54A 3NUCA 4IFDJ 2PZUA 2E2HH 1TS2A 4A3DH 5CR3A 3S1NB 1EQQA 5TSSA 3VYRA 5C0XG 1U5KA 2A6HD 1L0YB 2NBFA 1BOSA 2CFMA 4EQNA 5I2XA 4X62L 3PSIA 5FK9C 1HUMA 1OXTA 2PQAA 3N6RA 2B2WC 4JW0A 5IP9H 3H0GB 4BBSB 1TKWB 4X64L 3OIQA 1D5XC 4NKLA 4P71A 1V1PA 2AKWB 2QW7A 4JI5Q 1HHVA 5C3EG 4XQQA 4KKUA 3I4NH 2EYJA 1O7YA 1K28A 3OWEB 3NPPA 2R93G 1PXUA 2EYLA 3T56B 3I2ZA 1MHWC 4ME3A 3J7A5 3GTJB 3FKIH 1VQBA 2KECA 4LJZC 1KNEA 1PRTC 4OXPA 2RKSA 3VYTA 3HKZB 2F0MA 4BBRB 3QO2A 2ZM6Q 1TWGB 1HJPA 1QB5D 4C2MB 1HNZL 3SR1A 1RKNA 1PH1A 3R93A 3PIP3 5EPKA 2VS1A 4RAUC 4JI7Q 3HOXB 3UE1A 1E2WA 4ZRZA 1EWIA 3CC2A 2AQ2B 2EOTA 2PW5A 2QDLA 3ULJA 4QB4A 3TZUA 3HKSA 4ALPA 4OELB 2JA8G 1TY2A 2F0DA 3SEBA 3LGJA 1BBUA 4DUYQ 3KOJA 1G291 4DV3Q 3LNNA 1F9RA 3T1YQ 3PF5A 3A7AB 3T16A 3FKIG 4H7BA 4XXEA 5FO9B 3I56A 3W1GA 1TQOA 3T53B 2QF7A 4OO1I 4G4KA 2AWNA 1X3FA 3NENA 1L1OA 1UWVA 4DNRB 2KCNA 1GUGA 4CHTB 3J80c 1VQFA 2GVAA 4QMGA 1PRTB 1D1IA 1CQVA 2J0TD 4DV0L 4JV5L 5E7NA 3PO2H 2MJ8A 1VQGA 5IGFA 2ASBA 3KK7A 3KJPA 1QVGA 3KUPA 1SE4A 1ILQA 3GTLB 4F88A 2KCTA 1N32L 1NCVA 1E2ZA 4JK1C 3NXWA 2A6ED 3DLLA 3S1MB 1UEAB 2K4KA 1KRTA 2IX3A 1Y1WB 1X65A 3X3MA 1KHIA 1MBYA 1U4PA 4KJNA 2GVBA 2B2VC 5JEAH 2IJ0A 2NVQB 5LMNW 3K7AH 1PFNA 3RR5A 2NVTH 3D3RA 4G7OC 3S1QH 3HRZC 3J7ZC 3H3VH 2VNUD 3RUZA 4A3JB 1AZQA 4IQZA 1F2MA 4NPSA 3SE0A 5IYBG 2AUKA 4C3JB 1ZYRC 4IUPA 3W1BA 5BN4A 3H15A 2ALYB 2JYOA 4PQXA 3PGZA 3D31A 1HTLD 4GN3B 2BE5C 1JC7A 1HA6A 1YNND 4RKLA 4LFCQ 2OT2A 3M3YH 2UXBL 1SNCA 5C4ZA 1RCVD 5AJ3Q 1LT3D 1D7QA 4DN4M 1BF4A 1CQFA 2FHTA 3AU7A 2JK8A 5JEAG 1PRTF 2BH8A 1A3VA 1TY0A 2QDBA 3RMHA 1GUOA 1HUNA 4KKTA 4LF5L 1S5CD 1ASYA 2UUBQ 1WYDA 1SMXA 3HOUH 4YCUA 2F0VA 2ICIA 1RHPA 3IL8A 1EOTA 4JI0L 1WCMH 1P16A 1EUJA 2KCCA 5C5LA 1TWCH 1B70B 1SFOB 1UE7A 3AMUA 1ZKOA 3GO5A 4HN7A 2Q8IB 4JI2L 4GOPB 1Q1EA 1CTMA 3S16B 1E0BA 4L63B 1MSHA 3HOVB 1PZKD 3U9SA 2CW0D 1EWHA 3CCMA 3ERQA 1B8AA 1NR4A 3D8GA 2QA4A 3GTOB 4QJFA 1VQ7A 1SYFA 3W2DA 2PCFB 3GTPB 1TS5A 4JBMA 4JI5L 1EOVA 3BS1A 2PQAB 1YHAA 1L0XB 1FNWA 3J7YW 3JAMc 1VQOA 1EY9A 4K2LA 3Q22A 3NQIA 2QKIC 3HOUG 1V1PB 3IFDA 1YBYA 2KVMA 1WCMG 3GTKH 2I5HA 1L1OC 2R7FA 2ZM6L 4A3KH 5KNDA 4MNOA 4V190 2JA6B 4HIDA 2JEAI 2KOLA 4DU9A 1YJNA 4YCWA 1J5EQ 2KBNA 4JI7L 5I2YA 2DGYA 1YNJC 2OQKA 3TMEA 4A3BB 1BCPF 2F0JA 4QQBX 4A3LH 2GN5A 4HJ9A 4GN4B 4DR1Q 2E2IB 5HGTA 1EY8A 4DUYL 1PYBA 1MD2D 5M5WH 4DV3L 1VQMA 3NE5B 1DOLA 2IT1A 4DV2L 1U9RA 1BCPD 2F0FA 5CV9A 2ID0A 3CHBD 4R4IA 2H5XA 3RZDB 4XT1B 3KBGA 3CCQA 4A3KG 1VQ6A 1W2BA 2B63B 3PUYA 2CQAA 1SJED 1K3RA 1SYEA 1L1OB 1K8AC 2F0EA 1GUWA 4K0KQ 1S5DD 2Z4IA 2F0SA 4QUCA 1PHJA 1DZ1A 4RGTA 1I3QB 1JB7A 3FMCA 5NUCA 4H0LC 3T13A 1J9OA 2R92H 1IW7D 3EROA 1TWHH 3J81c 4JI6L 5EKKA 2PQEA 4A3MH 3SK8A 3I70A 2HHHQ 2A1AA 3GTMH 2NN6H 4DV1Q 2NVXB 1H9SA 4JYAQ 1OTCA 2JA7B 2ZXOA 1L0WA 3E9IA 3K0YA 3GV3A 2NWGA 4V0BA 4JCVE 2O4XA 4R4CA 4EQPA 4DR3Q 1JT8A 5FLXL 1Y8NB 1KRSA 2JE6I 1J6QA 3H94A 4RHSA 3I4OA 3DUZA 4LNQA 1I4GA 3UDIA 3CF5A 4BY7H 4L5QA 5GAEC 2Z4HA 4DK0A 1R4QB 2D5DA 2BH2A 3HP3A 2L1BA 1PH6A 5KYIA 1WTQA 3TDQA 1CUKA 3T4AC 2PMZE 2F0LA 3M4OB 4LFCL 1KLGD 2L4NA 3C1EA 1R9TH 2EY2A 4RG1A 1CKOA 1HNWL 2JQOA 4A3MG 2A19A 4WJWA 4QUFA 2N88A 1LTID 1NUCA 1SE8A 2MP1A 4JBJA 3MXNB 2B2YA 1FNVA 2FMCA 1HZCA 1B7YB 2BA0A 4OWXB 1KL9A 3LWUA 3T51B 4KY7A 4X62Q 3LX0A 1B3QA 1O7ZA 1XPOA 1BR9A 4N8X1 2OTLA 1YITA 2RA4A 1KC8C 3QOJA 2B63G 2EYPA 4KV6A 3Q6SA 2UU9L 2SDFA 4DR2L 3EVQA 1W3SA 4LUZA 4BY7G 1NBWA 1LTBD 4XQNA 2UUBL 3HOWB 1M4VA 1H9MA 1STNA 3OWFA 4DK3C 1B4OA 4C3HH 5M5YB 1KAAA 2EYOA 1SE2A 4IPDA 3STBD 2K14A 3MXUA 2K03A 4O1NA 4DNTB 3PO3H 3S2DB 2EYFA 4LF6Q 1E22A 1B9NA 3L0OA 1ASZA 3TQYA 1I6HB 1Y1VB 4U673 1VQJA 1Q3LA 3F2CA 4QL5A 5C44H 2E2JB 2WAQE 1RIPA 4TQUS 3ERSX 1WFQA 3VR5A 3I8ZA 3C46A 1K0RA 2VUMB 2D2CC 4LFBQ 4DUZQ 2PZTA 2LKVA 1RL2A 4M8AA 5C5MA 5T1GA 3PUZA 2KENA 3SGIA 1BUVT 3R2IA 5K5PA 3ER0A 2RCNA 4DAYB 1U0LA 1AZPA 3DEPA 1JE5A 3M4YA 5JVG3 3P7JA 1E7ZA 3KF6A 1PMRA 3K7UC 4GKJQ 1ICFB 1VQ4A 1EQVA 1VQEA 2EJFC 4DR7Q 4Z9CB 3CMEA 4B3SQ 2WKDA 1FGUA 1NSNS 3A7LA 2GA4B 5FO7B 1LV9A 4F87A 4G7ZC 3KF8A 3I4MB 1J5EL 1K3BC 1VQNA 4DXFA 1VCIA 1X9NA 2PZWA 4EVOA 5IY0A 4EQ5A 4BS9A 1S3OA 3K5NA 2HQLA 4DR1L 1WTWA 4OONA 2HQEA 2R61A 4B9XA 2JXMB 1K8MA 1YJWA 1PTOH 5IODA 1OO9B 4LK1C 2XRSD 4BA1I 2IW3A 1I50H 1IYUA 1CHQD 2K32A 4KJOA 5M9OA 3M4QA 1VF5C 3J80i 5BN3A 1HFNA 3RZOB 1A2TA 1H9KA 2EY6A 3G6EA 5M5XB 2WB1B 2Z8LA 2MUYA 2PYKA 3OTOL 3B6YA 1A15A 2C5CA 4FXDA 1TIID 1EZ8A 2K5DA 4DGZA 4A3GH 1BDOA 1Q8KA 5I4DA 4JI1Q 1G2SA 4A3EB 4L5TA 2VQEL 3J80E 5JVH3 2DUDA 1TWFB 4I7AA 2QEJC 4FO2A 4K0KL 4HIKA 1IBML 4DAVA 1JR0D 1NJIC 1EYAA 4RGNA 2ENBA 4IUNA 1F77A 2Q8RE 4ME5A 1BVSA 4LWCA 2K5NA 2VUMG 1IHZA 2LXKA 1S5ED 1FJGL 1K73C 1K83H 5E4XA 4YWMA 2A6EC 1RD9D 3MA2B 2LS01 5ELCA 2B2YC 1VQ5A 1WI5A 4DV1L 1XMQQ 2OTJA 1PFSA 3A8KE 3CD6A 5DAUA 3TZDA 4JYAL 1STGA 3RLNA 1O7LA 1LTAD 4ZLTF 5CV8A 4A93B 3C3LA 1F2LA 2OQ0A 3T1HQ 1Q1BA 3GP7A 3SVMA 4A3GG 1PFBA 4BY1B 2XRQD 4A3DB 3HG9A 3MFGA 2EZVA 2F0WA 2K5QA 3D4WA 3I4MG 2B2UA 4I65A 2CQOA 1A8VA 1G8ZD 2L12A 3CQZB 4KN4C 4R1JA 3S17H 5ISRA 4GOPA 1UE1A 1I94L 3C2PA 5LMNL 2BDOA 1PH7A 5ELOA 3HOZH 2L15A 4MHEA 1IBLL 4QCLA 4H02A 4LFAQ 3BU2A 4HIMA 1VMPA 1F2ZA 4IUQA 4RFBA 4C3IH 1LUZA 5DM63 1VQCA 2F0TA 3M85A 2I46A 1X3PA 4HTHA 3NELA 3P75A 2JA8H 1EIGA 2WB1G 3M4PA 2R7ZB 1G91A 2K01A 1ML0D 2N3SA 2XGTA 2K50A 3S15B 4F8MA 5CC4A 5LHY1 3PV0A 3VR6A 3HEJA 3I55A 1NAPA 2SNMA 2B39A 5DM73 1VQHA 5IYCH 4HJ8A 4QIWB 3PUWA 1HRJA 3HOZG 2F0OA 4OGQC 5C3XA 2I07B 3FRPB 4G57A 4X3SA 3P1HA 4CDDC 4CDCC 5C3WA 4LF6L 1JQYD 2XVSA 1IL2A 2Z6BA 2A68C 1TR5A 3KDFB 3S1NH 4C3IG 2Q2TA 2OF1A 4IJHA 3FPPA 4RMFA 4A3IB 3NBHA 4CKEA 4IUVA 3K0XA 1VQKA 3JAMi 4LF4Q 2CW0C 2R6GA 1AN8A 2PO4A 4LFBL 4DUZL 1JWSD 1GVPA 3H0GH 4E6IA 4BBSH 3DHQA 2HDMA 1B9MA 4FYDA 1Z6HA 3S24A 3CPFA 3PO2B 2CH4W 3JAME 1H9RA 4DV2Q 2E75C 2WV6D 1O7IA 1GHJA 2HIXA 2KEEA 1A6XA 4NXMQ 4R8IA 1KLUD 4BA2I 5IYCG 4OO1H 1WTRA 3GTJH 4GKJL 1HCZA 1STEA 4M1UB 4AYBB 4ZKCB 1SYCA 3VYSA 4DR7L 2ZT9C 3KF6B 2HUGA 1XPUA 1DOMA 4ZKBB 1Q12A 2EIFA 4BBRH 2SEBD 1AP0A 1X3EA 3V2TA 3SDZA 2K28A 4ILWA 2VB2X 5IYBH 4C2MH 1OXSC 2EPBA 4RKBA 3BVGA 3A74A 1JICA 3Q24A 3K7AB 2WFWA 3HOXH 1B50A 3KF8B 1HXYD 2EXZA 1QWYA 3S1QB 3I90A 4H13C 3A5ZB 1AW7A 1CM9A 1PZJD 2SNSA 3NQTA 4DR4Q 1U4MA 2BA1A 3S2HB 4KK7A 3H0GG 4BBSG 3IKJA 4DV7Q 3DEOA 3EIVA 2YTYA 3KLSX 5KRUA 1PH9A 1JCKB 4JI6Q 4FF4A 1DYQA 1CZGA 1B44D 3KLRA 4X6AH 2HIVA 1XTDA 4OO1G 2D0PA 4JBKA 4A3CG 1EYGA 2N78A 2P5ZX 2EYMA 1BCPC 3I7FA 1E3PA 4MTKA 3HKZG 4IOCA 4BBRG 5JJZA 2O5IC 4JG2A 4JI1L 2X6GA 2G9DA 4JBWA 3MC0B 4P2CB 3BZDB 2IWHA 1WTVA 3CCRA 2B2UC 1EY6A 4APVA 3SXHA 1SNQA 3PCOB 3OOCA 3MHBA 4U68A 3HOXG 1Y8OB 4YWKA 4GOPC 1IL8A 3A5UA 2L5TA 3J81i 2AWOA 2CVRA 4GN5A 2UXDQ 2F4IA 5JEAJ 3GTLH 1HZ9A 1STBA 3WDNA 5L37A 4KD4A 3S1MH 3MXNA 1HNWQ 4QF4A 3U9OA 5IT9L 3J81E 1Y1WH 1HR0W 4ULLA 1IW7C 4Q5VA 4F7XA 1XMQL 5K36H 1TWCB 3URYA 1LT4D 2NVQH 3Q0AA 1I4HA 1PA6A 1Z9FA 2K75A 4RH6A 1SNPA 3T1HL 4A3JH 1Q81C 1GO3E 1YEZA 3WOFA 3DXJC 1JOKA 3BG3A 3TRZA 1EIFA 1HNXQ 4PZ7A 4S3SA 1DCZA 2UU9Q 1D6EC 1LYLA 4DR2Q 1BCPB 4NB3A 3SK6A 4C3JH 1C4QA 5C6AA 1X56A 5M3FB 2ZJQA 1SNMA 3A56A 2ZTCA 1QVFA 1H95A 3K57A 2FFKB 1TS4A 2NB0A 3C1FA 2Q8TA 1VQ8A 3HOYB 1AH9A 3UDFA 4PMWA 1V1OA 1EFWA 2PNRC 3TS2A 1TXYA 2L9HA 1OXVA 1Y1WG 1NE3A 2MO0A 4OIJA 4LFAL 2I5LX 5C4HA 4P74A 3A54A 1W6JA 4DFAA 5K36G 5FLXc 3F2UA 2N8NA 1IXRA 2Z9HA 4J6HA 2MGSA 3CXCA 1T5EA 2EDGA 1JORA 4X64Q 4LF9Q 2WKCA 4DAYA 4A3JG 5HY6A 4OWWB 1I4PA 2H1EA 4QY7A 2VB3X 1JJ2A 3EN2A 4J1MA 3KLSA 4FXKC 4C3JG 1I4XA 5I9OA 1D8LA 3FEWX 1MIUA 4PV1C 5LL6X 1P8LA 2FXQA 1D5ZC 4FDBA 1XNQL 2MPMA 2CH4A 1X6OA 5CBAE 1SFOH 1A3UA 5D3DA 3M7GA 2WP8J 5GAHC 4PG3A 1SRUA 2EQSA 1NNXA 5EKIA 3GTGB 3OMGA 3S16H 2LY7A 5C4XB 3Q8DA 2F3WA 3HOVH 4L6TB 4N9TA 4GS3A 2CCZA 1IBKQ 5A2QE 3OPOA 2EYHA 2YTVA 1ICWA 3S1RB 4LF4L 1FGBD 4DV6Q 1ESRA 3GTOH 3NBHB 1SJHD 1LLRD 4DAMA 5J39A 3GTPH 1WTPA 1N33Q 2AQ1B 1PLFA 3OSOA 1UE6A 1OXUA 4NXML 4AQYQ 3FPUB 1PH4A 1FR3A 4OIKA 3OTOQ 2ZJRA 2R92B 3QWNA 1EYDA 2OEOA 3GTQB 1JOQA 4JI3L 1UE5A 2VQEQ 3IRBA 1BKBA 3PQIA 3OYYA 4KMUC 3HOVG 5A35A 1IBMQ 1SYGA 2O5JC 4A3BH 3O13A 1CK1A 1NMGA 1GOZA 4DR4L 5IGEA 4B9WA 3VR4A 3HFZB 2FINB 5EBCA 2NYZD 1Y69U 1PV4A 1ZYRD 5GQOA 4DV7L 2A73B 4BXXH 2E2IH 2Z1CA 1R4PB 1DJRD 1FJGQ 1YZ6A 3VDYA 4FF2A 3K8AA 1J8IA 5H1SE 4X3TA 1Q90A 1EIHA 2MO1A 3HGBA 2F0UA 4X3UA 3K81C 4NXNL 4OX9Q 3KFUA 1WTXA 1VQ9A 1R9TB 2J7ZA 1STHA 4OL7A 2JA9A 2EVBA 3BYTB 2B63H 4DNIA 2JA6G 1SMYD 1Z47A 1HFGA 4KKSA 3HZXA 4R8NA 3ULLA 4EGVA 1V9PA 5C4XG 3PIOA 2V4DA 3RN2A 4DK6C 1BNZA 4A3BG 1JJGA 5FO8B 4HR7B 1I94Q 4K6DA 3GQBA 3I91A 5LMNQ 2UXDL 1I3QH 4LAAA 5COYA 5E4WC 1LO5D 4DPGA 1S4ZA 2XWJB 4OWTB 4DK1A 1PYSB 3BZCA 1IBLQ 5EPJA 3ND8A 4BXXG 1FVIA 1K8OA 1K9MC 2F52A 5AFWA 1TWAB 4R9WA 2RVLA 1XX8A 3SHLA 2EE1A 2JA5B 3CC4A 3OW7A 2NVXH 1ZXTA 5HURA 3K5MA 4IJLA 1HZAA 4UAIA 1K0SA 2F1MA 2JA7H 2X6LA 3HKZE 3L3OC 4ZK9B 2AUJD 2F0GA 2ZTDA 4KTAA 1JE4A 4Y7NB 4R4TA 5JAVA 3FP9A 2IX1A 3IFTA 1HNXL 3W5OA 5ELNA 1CI3M 1JB3A 2D9UA 3CAMA 4HJ7A 1T5XD 2RQXA 3DM1A 4IUUA 5JJKA 1CT1D 1HR0Q 2KEDA 5CBEE 1PH5A 4WFN3 5EJWA 1B1ZA 2EJMA 4C1NK 3TSSA 5IP7H 5KNBA 2YU9B 4KHPQ 2JP1A 3PUXA 3MZ5A 3M4OH 3KDFA 1XJVA 2ZTEA 3AYHB 1S40A 1N9WA 4K5VA 1PYWD 4ODGA 4MZ9A 4DR6Q 3CPWA 4GLXA 3G71A 5KGUA 4HCEA 2OWOA 3A0JA 1H9JA 1HA5A 2NZ1D 3FDTA 4K5XA 1FYCA 5I6WA 2JA7G 3MVVA 2A6HC 3MAQA 2ATWA 3IAYA
chains in the Genus database with same CATH topology
4LF9L 2L15A 3HOZH 1PH2A 3HOYG 1IBLL 5IYDG 5FLMH 4NPSA 4GNXA 4LF8Q 5IYBG 4TVAB 5JJIA 2JA6H 1VQPA 4UY8C 4H02A 1L2FA 4LFAQ 3BU2A 4HIMA 5C4XH 3W1BA 3GTGH 3H15A 3T1YL 2ALYB 4C3IH 3PGZA 1LUZA 2VQFQ 3HOWH 3D31A 3PUVA 1V1QA 1VQCA 5JJLA 3M85A 4GN3B 3TREA 5M5YH 3NELA 5IP7G 3J81j 3S1RH 2JA8H 2WB1G 3M4PA 4LFCQ 2VNUD 2CWAA 3M3YH 4DV5Q 2UXBL 4J15A 1VS0A 1YI2A 5LMUQ 4IOAA 4EX5A 1SLJA 2XGTA 2N3SA 5AJ3Q 2K50A 3AQQA 3S2DH 1D7QA 3PV0A 4JC0A 3I55A 2B29A 3KJOA 2CKZB 2JK8A 3F2BA 1N36Q 5JEAG 1XMOL 2JA5G 1IBKL 1Y1VH 4LF7L 1VQHA 2N49A 2BH8A 4UP8A 5IYCH 1CSQA 4HJ8A 2E2JH 4A3LG 3PUWA 4DV6L 3RZDH 2LSSA 3HOZG 4POFA 1YHQA 2VUMH 4O2DA 1NMFA 2VZAA 1E24A 5FLMG 3G48A 2UUAL 4LF5L 4LF6L 3BJUA 1A0IA 3GTQH 1IL2A 3F1ZA 1ASYA 1N33L 1PVOA 3KDFB 2UUBQ 1WYDA 1SMXA 3HOUH 1G51A 3G4SA 3S1NH 1OXXK 4GLAC 4IJHA 4YCUA 2Q2TA 4RMFA 3HOWG 4JI0L 1WCMH 1P16A 1EUJA 4HIOA 4AQYL 1TWCH 2NN6I 1VQKA 3K0XA 3JAMi 4LF4Q 2R6GA 4IO9A 2K5VA 3E9HA 1B70B 2JJQA 1UE7A 3RLFA 4DV4Q 3GO5A 2Z0SA 1T9HA 4DUZL 4LFBL 4P72A 4JI2L 4GOPB 1GVPA 1Q1EA 3CW2C 3H0GH 4BBSH 3U58A 4KLKA 4LUVA 3S24A 3E0EA 3H3VH 5BR8Q 3M7NA 3CPFA 3CCEA 3F2DA 4DV2Q 4JI4Q 3I4MH 4R4QA 1O7IA 2HIXA 3CCMA 1Y1VG 4NXMQ 1PH3A 1QZHA 5IYCG 4BA2I 4GKJL 3GTJH 1B8AA 4JOIA 4QIWE 3KYHC 3D0FA 4GKKQ 5GADC 2MQHA 2QA4A 4QJFA 1VQ7A 4DKAC 3KF6B 1XPUA 4DR7L 2Z6KA 1Q12A 2EIFA 4BBRH 4A4IA 1XPRA 1X3EA 2R92G 5IYDH 4JBMA 4JI5L 1EOVA 5IYBH 5AJ3L 2PQAB 4C2MH 2PI2E 1OXSC 1Y14B 4KI0A 3L7ZC 1YHAA 3JAMc 1VQOA 1NTGA 3A74A 3HOUG 2NN6G 2WFWA 3HOXH 4B3RQ 1YBYA 1WCMG 3KF8B 3AFQA 3GTKH 4OX9L 2I5HA 3RZOH 1L1OC 3CCVA 2R7FA 5M5XH 3A5ZB 1Q7YC 4DR4Q 2ZM6L 4A3KH 2BA1A 4MNOA 3H0GG 2E5LL 4BBSG 4DV7Q 4HIDA 2JEAI 3EIVA 2YTYA 1C0AA 1PH9A 1YJNA 1WOCA 2Q2HA 2RF4A 4JI6Q 4YCWA 2YV5A 1J5EQ 2KBNA 4A3EH 4JI7L 1TWAH 2DGYA 2OQKA 1TWFH 3FHWA 2JA5H 2HIVA 4X6AH 1XTDA 4OO1G 2D0PA 4JBKA 4A3CG 1EYGA 1AE2A 1PH8A 2YTXA 5M3MG 2N78A 4AYBE 4YHHQ 4QQBX 4WJ4A 4A3LH 2GN5A 4HJ9A 3PO3G 3I7FA 1Q82C 1E3PA 4GN4B 4XIGS 4DV4L 4DR1Q 1XNRL 3HKZG 4IOCA 4BBRG 4IFDI 4JG2A 4DUYL 4Y7NH 1PYBA 4JI1L 3CCUA 2MNAA 1HNZQ 4JBWA 4DV3L 5M5WH 1VQMA 4UP9A 2K5HA 3CCRA 4JI4L 2IT1A 4APVA 4DV2L 3PCOB 4P75A 2E8GA 3HOXG 4B3TQ 4YWKA 4GOPC 3A5UA 1CSPA 2ID0A 3J81i 1CKMA 2AWOA 2NZOA 4YWLA 4WJ3M 4GN5A 4R4IA 2H5XA 2QGQA 2UUCQ 3CCQA 5JEAJ 3GTLH 1HZ9A 2YU9H 2UXDQ 4X66L 3WWVA 1QVCA 4A3KG 4A93H 4GNXC 1VQ6A 1W2BA 1I5FA 3PUYA 3S1MH 3L2PA 1K3RA 1K8AC 1L1OB 4BY1H 1HNWQ 1Y1WH 1HR0W 4A3EG 1QUQA 4K0KQ 1XMQL 4X65L 1HR0L 1I6HH 4PZ8A 2NVQH 2D0OA 1X3GA 1JJCB 3CQZH 3GD7A 1PHJA 3CCJA 3U4ZA 4B3ML 5IT9c 1PA6A 1JB7A 4KHPL 4IFDG 2KHIA 5IWAQ 1XNQQ 1Z9FA 2RHSB 2K75A 3RLOA 3T1HL 1VQLA 2Y0SE 1EQRA 4A3JH 4DR5L 1GO3E 3TS0A 1S72A 1YEZA 1Q81C 5FJ8H 2KCMA 4A3FH 1TWHH 3AFPA 1EIFA 4QGUA 4PZ7A 1HNXQ 3TRZA 3J81c 2UU9Q 4JI6L 4DR6L 1LYLA 4DR2Q 4A3MH 4DV0Q 4NB3A 2LXJA 4AH6A 4AIMA 4C3JH 4JV5Q 2HHHQ 2A1AA 3GTMH 4DV1Q 2B3GA 4LUOA 1X56A 2V1CC 2ZJQA 5DLQE 4P73A 4A76A 4JYAQ 5C44G 1CKNA 1OTCA 2ZTCA 1QVFA 1L0WA 2R92H 1H95A 1HZBA 3E9IA 1GM5A 3JC66 1YJ9A 2UXCQ 4B3SL 4JCVE 1N32Q 3UDGA 1VQ8A 1VQDA 2NZHA 4R4CA 4DR3Q 3UDFA 2R7ZH 4A93G 1AH9A 1JT8A 2JE6I 1KRSA 1J6QA 4PMWA 2ZJPA 1K8GA 1EFWA 4LF8L 3TS2A 1TXYA 2NVYH 1V43A 3I4OA 4LNQA 4BY1G 1OXVA 3UDIA 3CF5A 1Y1WG 1NE3A 2MO0A 3S15H 4LFAL 4A3DG 2I5LX 4BY7H 4L5QA 4P74A 5GAEC 2IX0A 1Q86C 1KQSA 4GNXB 5K36G 5FLXc 2VQFL 4B3TL 1C7YA 2BH2A 2N8NA 1IXRA 1HH2P 1PH6A 4A3CH 3CXCA 5M3MH 1BBWA 1M1KC 1CUKA 2CWPA 2PMZE 3ZJYC 3PF4A 4LFCL 4X64Q 4DV5L 3UDXA 5IP9G 4LF9Q 1LM0A 1R9TH 1VQAA 4A3JG 2F3IA 5HY6A 4OWWB 1TWGH 3EBEA 5FJ8G 3DM3A 3M9BA 1CKOA 4RG1A 5LMUL 4A3FG 4JI3Q 4QY7A 3I4NG 2Q2IA 1HNWL 1JJ2A 2JQOA 4A3MG 3EN2A 2A19A 2I5MX 2F4VQ 1UEBA 1GKHA 1SE8A 1KD1C 4JBJA 1N36L 3BZKA 3MXNB 4JOIC 4HJAA 1D8LA 1MIUA 1HZCA 1B7YB 5J3BA 1IZ6A 2BA0A 4UPAA 4YY3Q 2I0QA 4A3IH 4OWXB 3S14H 1P8LA 2VL6A 2FXQA 2Z6KC 1KL9A 4X62Q 4FDBA 2YYZA 4LW1A 3ULPA 1XNQL 2A8VA 1X6OA 2IHFA 2IY5B 1SFOH 2R7ZG 2UXBQ 3K80C 1XPOA 2OTLA 1YITA 1KC8C 2B63G 2WP8J 1DGSA 4MTNA 2UU9L 5GAHC 4PG3A 1SRUA 2EQSA 4DR2L 3S16H 4Y52H 1W3SA 2AMCB 4LUZA 4IPGA 5GAGC 1NBWA 3Q8DA 4HJ5A 2UUBL 4BY7G 1AE3A 2HHHL 2VY3A 1N34Q 3HOVH 2D62A 4DK3C 1XMOQ 1SROA 4GS3A 3UE0A 1IBKQ 2KHJA 2CCZA 4LF7Q 4C3HH 2YTVA 4YCVA 1MJCA 4IPDA 3MEFA 3STBD 4LF4L 5C0XI 4NXNQ 2K14A 4DV6Q 4JI8Q 2PI2A 3TEHB 3NBHB 4DR3L 3GTOH 1G6PA 3CMAA 3PO3H 1LTLA 1SR3A 4DAMA 2R7DA 4LF5Q 1E22A 5C3EH 4LF6Q 3GTPH 3L0OA 5BR8L 2QEXA 1N33Q 2R93H 1ASZA 3F8TA 3TQYA 1UE6A 2MFIA 1VQJA 2K52A 3F2CA 1A62A 1OXUA 4NXML 5C4JH 4JI0Q 4QL5A 5C44H 5EAYA 4AQYQ 4A3IG 2WAQE 1RIPA 2EXDA 4TQUS 3U50C 3ERSX 1WFQA 2JEBI 1PH4A 4GKKL 4UP7A 1K0RA 5C0XJ 3OTOQ 2ZJRA 3AEVA 4LFBQ 4DUZQ 3CP0A 4JI2Q 2VW9A 1RL2A 1YHBA 1FL0A 1WJJA 2KENA 3PUZA 3SGIA 2C35B 5IE8A 3S2HH 1X54A 3H3VI 4IFDJ 4JI3L 3ER0A 1QZGA 2RCNA 2E2HH 1UE5A 2VQEQ 3IRBA 2F4VL 1BKBA 4DAYB 4A3DH 3OYYA 1U0LA 1EQQA 3HOVG 3PO2G 1IBMQ 1JE5A 5C0XG 4B3RL 1E7ZA 1U5KA 3KF6A 3K7UC 3NEMA 1N8RC 4GKJQ 4YY3L 4A3BH 2AHOB 2RHQB 2CFMA 1VQ4A 4X62L 1IYJB 1NMGA 3PSIA 4DR4L 1OXTA 1VQEA 2PQAA 4AYBG 4IPCA 4DR7Q 5IP9H 3HFZB 3CMEA 4B3SQ 3CCLA 1PV4A 5GQOA 4P71A 4DV7L 4BXXH 2AKWB 2E2IH 1FGUA 4JI5Q 5C3EG 3I4NH 5GROA 1FJGQ 1A63A 1YZ6A 1J5EL 2R93G 3VDYA 3ICEA 3I2ZA 3K8AA 1N34L 1VQNA 1KAWA 1VCIA 5H1SE 1X9NA 4ME3A 5IY0A 3J7A5 4EQ5A 3FKIH 4KHZA 2MO1A 1VQBA 1S3OA 4YHHL 3K81C 4NXNL 4OXPA 4OX9Q 3KFUA 2HQLA 2WAQG 3U4VA 4DR1L 1VQ9A 4JI8L 1Q46A 2ZM6Q 4OONA 4A75A 2JA9A 1HJPA 2HT1A 3RNUA 4L5SA 2E5LQ 4GLVB 1SN8A 2B63H 1HNZL 1PH1A 4DNIA 4L5RC 1YJWA 2JA6G 1Z47A 4IPHA 3ULLA 4BA1I 2ES2A 1I50H 2VS1A 1V9PA 5C4XG 1KXLA 3PIOA 4JI7Q 1YNXA 3CC7A 3RN2A 4DK6C 3UE1A 1NY4A 1EWIA 2XTIA 3KLWA 3M4QA 3J80i 3CC2A 4A3BG 1JJGA 1I94Q 3ULJA 3G6EA 5LMNQ 2UUCL 2UXDL 3HKSA 4ALPA 2JA8G 1I3QH 3OTOL 3B6YA 1XNRQ 4DPGA 4OWTB 1PYSB 3BZCA 3LGJA 4A3GH 1Q8KA 1BBUA 3GDEA 4O0AA 4R4OA 1FVIA 2Y0SG 4DUYQ 1IBLQ 4JI1Q 1E1TA 4BXXG 1K9MC 2F52A 3KOJA 1G291 4L5TA 2VQEL 2IHEA 4DV3Q 1JMCA 1C9OA 2DUDA 4K0KL 3T1YQ 3PF5A 4HIKA 1IBML 2ATWA 3CC4A 3FKIG 3I56A 2Q2UA 1NJIC 2NVXH 1YIJA 4IJLA 1HZAA 5M3FH 1GD7A 1QUQB 3W1GA 1EIYB 1BVSA 5IWAL 3HKZE 2JA7H 4OO1I 2AWNA 4LWCA 1X3FA 2ZTDA 1L1OA 3NENA 1UWVA 2K5NA 4XTCS 4X66Q 3STBC 1KIXA 2VUMG 3HOYH 4R4TA 3FP9A 1YVCA 2IX1A 3PIPA 3W5OA 2LXKA 5ELNA 1VQFA 2GVAA 3J80c 1HNXL 1K73C 4POGA 1FJGL 1K83H 4YWMA 3CAMA 4HJ7A 4DV0L 4JV5L 1VQ5A 5E7NA 3PO2H 5JJKA 1WI5A 1VQGA 4DV1L 1XMQQ 4X65Q 1PFSA 1HR0Q 2ASBA 3KJPA 2OTJA 1QVGA 3CD6A 4JYAL 3RLNA 1PH5A 4B3MQ 2WB1E 1X55A 5IP7H 4KHPQ 1M90C 2UXCL 2KCTA 1N32L 3PUXA 3M4OH 2OQ0A 1CKNB 3T1HQ 1Q1BA 3KDFA 3DLLA 4DR5Q 2K4KA 2UUAQ 3RN5A 1KRTA 4A3GG 1XJVA 2ZTEA 3AYHB 1S40A 1X65A 1N9WA 4DR6Q 1VQIA 4MZ9A 1KHIA 3CPWA 4GLXA 3G71A 3I4MG 2GVBA 3CCSA 2OWOA 3A0JA 2CQOA 1E1OA 1A8VA 4PZ6A 4R1JA 5LMNW 3S17H 3K7AH 5M3FG 1MKHA 5HGQA 4GOPA 1UE1A 3RR5A 1I94L 2NVTH 5LMNL 1PH7A 1MJEA 2JA7G 5ELOA 3J7ZC 3S1QH 2OCEA 4X64L 3OW2A 2PNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 L;  2L15 A;  3HOZ H;  1PH2 A;  3HOY G;  1IBL L;  5IYD G;  5FLM H;  4NPS A;  4GNX A;  4LF8 Q;  5IYB G;  4TVA B;  5JJI A;  2JA6 H;  1VQP A;  4UY8 C;  4H02 A;  1L2F A;  4LFA Q;  3BU2 A;  4HIM A;  5C4X H;  3W1B A;  3GTG H;  3H15 A;  3T1Y L;  2ALY B;  4C3I H;  3PGZ A;  1LUZ A;  2VQF Q;  3HOW H;  3D31 A;  3PUV A;  1V1Q A;  1VQC A;  5JJL A;  3M85 A;  4GN3 B;  3TRE A;  5M5Y H;  3NEL A;  5IP7 G;  3J81 j;  3S1R H;  2JA8 H;  2WB1 G;  3M4P A;  4LFC Q;  2VNU D;  2CWA A;  3M3Y H;  4DV5 Q;  2UXB L;  4J15 A;  1VS0 A;  1YI2 A;  5LMU Q;  4IOA A;  4EX5 A;  1SLJ A;  2XGT A;  2N3S A;  5AJ3 Q;  2K50 A;  3AQQ A;  3S2D H;  1D7Q A;  3PV0 A;  4JC0 A;  3I55 A;  2B29 A;  3KJO A;  2CKZ B;  2JK8 A;  3F2B A;  1N36 Q;  5JEA G;  1XMO L;  2JA5 G;  1IBK L;  1Y1V H;  4LF7 L;  1VQH A;  2N49 A;  2BH8 A;  4UP8 A;  5IYC H;  1CSQ A;  4HJ8 A;  2E2J H;  4A3L G;  3PUW A;  4DV6 L;  3RZD H;  2LSS A;  3HOZ G;  4POF A;  1YHQ A;  2VUM H;  4O2D A;  1NMF A;  2VZA A;  1E24 A;  5FLM G;  3G48 A;  2UUA L;  4LF5 L;  4LF6 L;  3BJU A;  1A0I A;  3GTQ H;  1IL2 A;  3F1Z A;  1ASY A;  1N33 L;  1PVO A;  3KDF B;  2UUB Q;  1WYD A;  1SMX A;  3HOU H;  1G51 A;  3G4S A;  3S1N H;  1OXX K;  4GLA C;  4IJH A;  4YCU A;  2Q2T A;  4RMF A;  3HOW G;  4JI0 L;  1WCM H;  1P16 A;  1EUJ A;  4HIO A;  4AQY L;  1TWC H;  2NN6 I;  1VQK A;  3K0X A;  3JAM i;  4LF4 Q;  2R6G A;  4IO9 A;  2K5V A;  3E9H A;  1B70 B;  2JJQ A;  1UE7 A;  3RLF A;  4DV4 Q;  3GO5 A;  2Z0S A;  1T9H A;  4DUZ L;  4LFB L;  4P72 A;  4JI2 L;  4GOP B;  1GVP A;  1Q1E A;  3CW2 C;  3H0G H;  4BBS H;  3U58 A;  4KLK A;  4LUV A;  3S24 A;  3E0E A;  3H3V H;  5BR8 Q;  3M7N A;  3CPF A;  3CCE A;  3F2D A;  4DV2 Q;  4JI4 Q;  3I4M H;  4R4Q A;  1O7I A;  2HIX A;  3CCM A;  1Y1V G;  4NXM Q;  1PH3 A;  1QZH A;  5IYC G;  4BA2 I;  4GKJ L;  3GTJ H;  1B8A A;  4JOI A;  4QIW E;  3KYH C;  3D0F A;  4GKK Q;  5GAD C;  2MQH A;  2QA4 A;  4QJF A;  1VQ7 A;  4DKA C;  3KF6 B;  1XPU A;  4DR7 L;  2Z6K A;  1Q12 A;  2EIF A;  4BBR H;  4A4I A;  1XPR A;  1X3E A;  2R92 G;  5IYD H;  4JBM A;  4JI5 L;  1EOV A;  5IYB H;  5AJ3 L;  2PQA B;  4C2M H;  2PI2 E;  1OXS C;  1Y14 B;  4KI0 A;  3L7Z C;  1YHA A;  3JAM c;  1VQO A;  1NTG A;  3A74 A;  3HOU G;  2NN6 G;  2WFW A;  3HOX H;  4B3R Q;  1YBY A;  1WCM G;  3KF8 B;  3AFQ A;  3GTK H;  4OX9 L;  2I5H A;  3RZO H;  1L1O C;  3CCV A;  2R7F A;  5M5X H;  3A5Z B;  1Q7Y C;  4DR4 Q;  2ZM6 L;  4A3K H;  2BA1 A;  4MNO A;  3H0G G;  2E5L L;  4BBS G;  4DV7 Q;  4HID A;  2JEA I;  3EIV A;  2YTY A;  1C0A A;  1PH9 A;  1YJN A;  1WOC A;  2Q2H A;  2RF4 A;  4JI6 Q;  4YCW A;  2YV5 A;  1J5E Q;  2KBN A;  4A3E H;  4JI7 L;  1TWA H;  2DGY A;  2OQK A;  1TWF H;  3FHW A;  2JA5 H;  2HIV A;  4X6A H;  1XTD A;  4OO1 G;  2D0P A;  4JBK A;  4A3C G;  1EYG A;  1AE2 A;  1PH8 A;  2YTX A;  5M3M G;  2N78 A;  4AYB E;  4YHH Q;  4QQB X;  4WJ4 A;  4A3L H;  2GN5 A;  4HJ9 A;  3PO3 G;  3I7F A;  1Q82 C;  1E3P A;  4GN4 B;  4XIG S;  4DV4 L;  4DR1 Q;  1XNR L;  3HKZ G;  4IOC A;  4BBR G;  4IFD I;  4JG2 A;  4DUY L;  4Y7N H;  1PYB A;  4JI1 L;  3CCU A;  2MNA A;  1HNZ Q;  4JBW A;  4DV3 L;  5M5W H;  1VQM A;  4UP9 A;  2K5H A;  3CCR A;  4JI4 L;  2IT1 A;  4APV A;  4DV2 L;  3PCO B;  4P75 A;  2E8G A;  3HOX G;  4B3T Q;  4YWK A;  4GOP C;  3A5U A;  1CSP A;  2ID0 A;  3J81 i;  1CKM A;  2AWO A;  2NZO A;  4YWL A;  4WJ3 M;  4GN5 A;  4R4I A;  2H5X A;  2QGQ A;  2UUC Q;  3CCQ A;  5JEA J;  3GTL H;  1HZ9 A;  2YU9 H;  2UXD Q;  4X66 L;  3WWV A;  1QVC A;  4A3K G;  4A93 H;  4GNX C;  1VQ6 A;  1W2B A;  1I5F A;  3PUY A;  3S1M H;  3L2P A;  1K3R A;  1K8A C;  1L1O B;  4BY1 H;  1HNW Q;  1Y1W H;  1HR0 W;  4A3E G;  1QUQ A;  4K0K Q;  1XMQ L;  4X65 L;  1HR0 L;  1I6H H;  4PZ8 A;  2NVQ H;  2D0O A;  1X3G A;  1JJC B;  3CQZ H;  3GD7 A;  1PHJ A;  3CCJ A;  3U4Z A;  4B3M L;  5IT9 c;  1PA6 A;  1JB7 A;  4KHP L;  4IFD G;  2KHI A;  5IWA Q;  1XNQ Q;  1Z9F A;  2RHS B;  2K75 A;  3RLO A;  3T1H L;  1VQL A;  2Y0S E;  1EQR A;  4A3J H;  4DR5 L;  1GO3 E;  3TS0 A;  1S72 A;  1YEZ A;  1Q81 C;  5FJ8 H;  2KCM A;  4A3F H;  1TWH H;  3AFP A;  1EIF A;  4QGU A;  4PZ7 A;  1HNX Q;  3TRZ A;  3J81 c;  2UU9 Q;  4JI6 L;  4DR6 L;  1LYL A;  4DR2 Q;  4A3M H;  4DV0 Q;  4NB3 A;  2LXJ A;  4AH6 A;  4AIM A;  4C3J H;  4JV5 Q;  2HHH Q;  2A1A A;  3GTM H;  4DV1 Q;  2B3G A;  4LUO A;  1X56 A;  2V1C C;  2ZJQ A;  5DLQ E;  4P73 A;  4A76 A;  4JYA Q;  5C44 G;  1CKN A;  1OTC A;  2ZTC A;  1QVF A;  1L0W A;  2R92 H;  1H95 A;  1HZB A;  3E9I A;  1GM5 A;  3JC6 6;  1YJ9 A;  2UXC Q;  4B3S L;  4JCV E;  1N32 Q;  3UDG A;  1VQ8 A;  1VQD A;  2NZH A;  4R4C A;  4DR3 Q;  3UDF A;  2R7Z H;  4A93 G;  1AH9 A;  1JT8 A;  2JE6 I;  1KRS A;  1J6Q A;  4PMW A;  2ZJP A;  1K8G A;  1EFW A;  4LF8 L;  3TS2 A;  1TXY A;  2NVY H;  1V43 A;  3I4O A;  4LNQ A;  4BY1 G;  1OXV A;  3UDI A;  3CF5 A;  1Y1W G;  1NE3 A;  2MO0 A;  3S15 H;  4LFA L;  4A3D G;  2I5L X;  4BY7 H;  4L5Q A;  4P74 A;  5GAE C;  2IX0 A;  1Q86 C;  1KQS A;  4GNX B;  5K36 G;  5FLX c;  2VQF L;  4B3T L;  1C7Y A;  2BH2 A;  2N8N A;  1IXR A;  1HH2 P;  1PH6 A;  4A3C H;  3CXC A;  5M3M H;  1BBW A;  1M1K C;  1CUK A;  2CWP A;  2PMZ E;  3ZJY C;  3PF4 A;  4LFC L;  4X64 Q;  4DV5 L;  3UDX A;  5IP9 G;  4LF9 Q;  1LM0 A;  1R9T H;  1VQA A;  4A3J G;  2F3I A;  5HY6 A;  4OWW B;  1TWG H;  3EBE A;  5FJ8 G;  3DM3 A;  3M9B A;  1CKO A;  4RG1 A;  5LMU L;  4A3F G;  4JI3 Q;  4QY7 A;  3I4N G;  2Q2I A;  1HNW L;  1JJ2 A;  2JQO A;  4A3M G;  3EN2 A;  2A19 A;  2I5M X;  2F4V Q;  1UEB A;  1GKH A;  1SE8 A;  1KD1 C;  4JBJ A;  1N36 L;  3BZK A;  3MXN B;  4JOI C;  4HJA A;  1D8L A;  1MIU A;  1HZC A;  1B7Y B;  5J3B A;  1IZ6 A;  2BA0 A;  4UPA A;  4YY3 Q;  2I0Q A;  4A3I H;  4OWX B;  3S14 H;  1P8L A;  2VL6 A;  2FXQ A;  2Z6K C;  1KL9 A;  4X62 Q;  4FDB A;  2YYZ A;  4LW1 A;  3ULP A;  1XNQ L;  2A8V A;  1X6O A;  2IHF A;  2IY5 B;  1SFO H;  2R7Z G;  2UXB Q;  3K80 C;  1XPO A;  2OTL A;  1YIT A;  1KC8 C;  2B63 G;  2WP8 J;  1DGS A;  4MTN A;  2UU9 L;  5GAH C;  4PG3 A;  1SRU A;  2EQS A;  4DR2 L;  3S16 H;  4Y52 H;  1W3S A;  2AMC B;  4LUZ A;  4IPG A;  5GAG C;  1NBW A;  3Q8D A;  4HJ5 A;  2UUB L;  4BY7 G;  1AE3 A;  2HHH L;  2VY3 A;  1N34 Q;  3HOV H;  2D62 A;  4DK3 C;  1XMO Q;  1SRO A;  4GS3 A;  3UE0 A;  1IBK Q;  2KHJ A;  2CCZ A;  4LF7 Q;  4C3H H;  2YTV A;  4YCV A;  1MJC A;  4IPD A;  3MEF A;  3STB D;  4LF4 L;  5C0X I;  4NXN Q;  2K14 A;  4DV6 Q;  4JI8 Q;  2PI2 A;  3TEH B;  3NBH B;  4DR3 L;  3GTO H;  1G6P A;  3CMA A;  3PO3 H;  1LTL A;  1SR3 A;  4DAM A;  2R7D A;  4LF5 Q;  1E22 A;  5C3E H;  4LF6 Q;  3GTP H;  3L0O A;  5BR8 L;  2QEX A;  1N33 Q;  2R93 H;  1ASZ A;  3F8T A;  3TQY A;  1UE6 A;  2MFI A;  1VQJ A;  2K52 A;  3F2C A;  1A62 A;  1OXU A;  4NXM L;  5C4J H;  4JI0 Q;  4QL5 A;  5C44 H;  5EAY A;  4AQY Q;  4A3I G;  2WAQ E;  1RIP A;  2EXD A;  4TQU S;  3U50 C;  3ERS X;  1WFQ A;  2JEB I;  1PH4 A;  4GKK L;  4UP7 A;  1K0R A;  5C0X J;  3OTO Q;  2ZJR A;  3AEV A;  4LFB Q;  4DUZ Q;  3CP0 A;  4JI2 Q;  2VW9 A;  1RL2 A;  1YHB A;  1FL0 A;  1WJJ A;  2KEN A;  3PUZ A;  3SGI A;  2C35 B;  5IE8 A;  3S2H H;  1X54 A;  3H3V I;  4IFD J;  4JI3 L;  3ER0 A;  1QZG A;  2RCN A;  2E2H H;  1UE5 A;  2VQE Q;  3IRB A;  2F4V L;  1BKB A;  4DAY B;  4A3D H;  3OYY A;  1U0L A;  1EQQ A;  3HOV G;  3PO2 G;  1IBM Q;  1JE5 A;  5C0X G;  4B3R L;  1E7Z A;  1U5K A;  3KF6 A;  3K7U C;  3NEM A;  1N8R C;  4GKJ Q;  4YY3 L;  4A3B H;  2AHO B;  2RHQ B;  2CFM A;  1VQ4 A;  4X62 L;  1IYJ B;  1NMG A;  3PSI A;  4DR4 L;  1OXT A;  1VQE A;  2PQA A;  4AYB G;  4IPC A;  4DR7 Q;  5IP9 H;  3HFZ B;  3CME A;  4B3S Q;  3CCL A;  1PV4 A;  5GQO A;  4P71 A;  4DV7 L;  4BXX H;  2AKW B;  2E2I H;  1FGU A;  4JI5 Q;  5C3E G;  3I4N H;  5GRO A;  1FJG Q;  1A63 A;  1YZ6 A;  1J5E L;  2R93 G;  3VDY A;  3ICE A;  3I2Z A;  3K8A A;  1N34 L;  1VQN A;  1KAW A;  1VCI A;  5H1S E;  1X9N A;  4ME3 A;  5IY0 A;  3J7A 5;  4EQ5 A;  3FKI H;  4KHZ A;  2MO1 A;  1VQB A;  1S3O A;  4YHH L;  3K81 C;  4NXN L;  4OXP A;  4OX9 Q;  3KFU A;  2HQL A;  2WAQ G;  3U4V A;  4DR1 L;  1VQ9 A;  4JI8 L;  1Q46 A;  2ZM6 Q;  4OON A;  4A75 A;  2JA9 A;  1HJP A;  2HT1 A;  3RNU A;  4L5S A;  2E5L Q;  4GLV B;  1SN8 A;  2B63 H;  1HNZ L;  1PH1 A;  4DNI A;  4L5R C;  1YJW A;  2JA6 G;  1Z47 A;  4IPH A;  3ULL A;  4BA1 I;  2ES2 A;  1I50 H;  2VS1 A;  1V9P A;  5C4X G;  1KXL A;  3PIO A;  4JI7 Q;  1YNX A;  3CC7 A;  3RN2 A;  4DK6 C;  3UE1 A;  1NY4 A;  1EWI A;  2XTI A;  3KLW A;  3M4Q A;  3J80 i;  3CC2 A;  4A3B G;  1JJG A;  1I94 Q;  3ULJ A;  3G6E A;  5LMN Q;  2UUC L;  2UXD L;  3HKS A;  4ALP A;  2JA8 G;  1I3Q H;  3OTO L;  3B6Y A;  1XNR Q;  4DPG A;  4OWT B;  1PYS B;  3BZC A;  3LGJ A;  4A3G H;  1Q8K A;  1BBU A;  3GDE A;  4O0A A;  4R4O A;  1FVI A;  2Y0S G;  4DUY Q;  1IBL Q;  4JI1 Q;  1E1T A;  4BXX G;  1K9M C;  2F52 A;  3KOJ A;  1G29 1;  4L5T A;  2VQE L;  2IHE A;  4DV3 Q;  1JMC A;  1C9O A;  2DUD A;  4K0K L;  3T1Y Q;  3PF5 A;  4HIK A;  1IBM L;  2ATW A;  3CC4 A;  3FKI G;  3I56 A;  2Q2U A;  1NJI C;  2NVX H;  1YIJ A;  4IJL A;  1HZA A;  5M3F H;  1GD7 A;  1QUQ B;  3W1G A;  1EIY B;  1BVS A;  5IWA L;  3HKZ E;  2JA7 H;  4OO1 I;  2AWN A;  4LWC A;  1X3F A;  2ZTD A;  1L1O A;  3NEN A;  1UWV A;  2K5N A;  4XTC S;  4X66 Q;  3STB C;  1KIX A;  2VUM G;  3HOY H;  4R4T A;  3FP9 A;  1YVC A;  2IX1 A;  3PIP A;  3W5O A;  2LXK A;  5ELN A;  1VQF A;  2GVA A;  3J80 c;  1HNX L;  1K73 C;  4POG A;  1FJG L;  1K83 H;  4YWM A;  3CAM A;  4HJ7 A;  4DV0 L;  4JV5 L;  1VQ5 A;  5E7N A;  3PO2 H;  5JJK A;  1WI5 A;  1VQG A;  4DV1 L;  1XMQ Q;  4X65 Q;  1PFS A;  1HR0 Q;  2ASB A;  3KJP A;  2OTJ A;  1QVG A;  3CD6 A;  4JYA L;  3RLN A;  1PH5 A;  4B3M Q;  2WB1 E;  1X55 A;  5IP7 H;  4KHP Q;  1M90 C;  2UXC L;  2KCT A;  1N32 L;  3PUX A;  3M4O H;  2OQ0 A;  1CKN B;  3T1H Q;  1Q1B A;  3KDF A;  3DLL A;  4DR5 Q;  2K4K A;  2UUA Q;  3RN5 A;  1KRT A;  4A3G G;  1XJV A;  2ZTE A;  3AYH B;  1S40 A;  1X65 A;  1N9W A;  4DR6 Q;  1VQI A;  4MZ9 A;  1KHI A;  3CPW A;  4GLX A;  3G71 A;  3I4M G;  2GVB A;  3CCS A;  2OWO A;  3A0J A;  2CQO A;  1E1O A;  1A8V A;  4PZ6 A;  4R1J A;  5LMN W;  3S17 H;  3K7A H;  5M3F G;  1MKH A;  5HGQ A;  4GOP A;  1UE1 A;  3RR5 A;  1I94 L;  2NVT H;  5LMN L;  1PH7 A;  1MJE A;  2JA7 G;  5ELO A;  3J7Z C;  3S1Q H;  2OCE A;  4X64 L;  3OW2 A;  2PNH A; 
#chains in the Genus database with same CATH topology
 1I4Q A;  4LF9 L;  1PH2 A;  4A3F B;  4K6L A;  2AQ3 B;  5IYD G;  4LF8 Q;  1YNJ D;  4TVA B;  1F9P A;  4UY8 C;  3SK4 A;  2RDH A;  2ZXR A;  2VQF Q;  3HOW H;  1V1Q A;  4RA8 A;  1F9S A;  1QCB D;  3K59 A;  5JJL A;  1KAB A;  5M5Y H;  5IP7 G;  3J81 j;  2WIN B;  4CKB A;  1QE6 A;  1LAC A;  2CWA A;  4DV5 Q;  1BQQ T;  2K5W A;  4J15 A;  2K04 A;  1VS0 A;  2NVY B;  3Q23 A;  1YI2 A;  3S2D H;  3AQQ A;  3KBX A;  3MXG A;  4L8J A;  2PW7 A;  2B29 A;  4FF1 A;  2CKZ B;  2K05 A;  3F2B A;  2JA5 G;  1IBK L;  1Y1V H;  1TS3 A;  3NWT A;  4UP8 A;  4HSP A;  5M3M B;  1CSQ A;  5FOB B;  2E2J H;  3A55 A;  4DV6 L;  2B8G A;  2LSS A;  5COR A;  3TP7 A;  2VUM H;  4O2D A;  2UUA L;  5CV5 A;  3G48 A;  2F0K A;  3BJU A;  3MWY W;  5FKA C;  4BWG B;  3F1Z A;  1EEI D;  1N33 L;  1PVO A;  5J1Z A;  4CJ1 B;  2E74 C;  3G4S A;  1SEB D;  4GLA C;  3HOW G;  2MHV A;  4AQY L;  3S14 B;  2DY7 A;  3D6W A;  3EQL C;  2JJQ A;  4KN7 C;  1S5B D;  1RDP D;  1T9H A;  3UI2 A;  1U4R A;  3G7L A;  3U58 A;  5IOC A;  4LUV A;  3E0E A;  3M7N A;  2DJF C;  3I4M H;  3F2D A;  4RCN A;  3VA7 A;  1Y1V G;  1PH3 A;  1QZH A;  4N8F A;  1DXM A;  4XYQ A;  1CA5 A;  3D6C A;  3D0F A;  4GKK Q;  3QB3 A;  2Z6K A;  2A5H A;  2KQ3 A;  4K5W A;  2XIW A;  4A4I A;  5E1F A;  1Z7T A;  5C3E B;  3A8J E;  3BDC A;  5CMD A;  2PI2 E;  4KI0 A;  2R93 B;  1O80 A;  3L7Z C;  5G3L D;  1I6V C;  1PTO F;  2LFN A;  2DNE A;  5C4J B;  3GV6 A;  4B3R Q;  1EU3 A;  1GJX A;  4HMI A;  4TKO B;  5IIF A;  4HCS A;  1DON A;  4IN3 A;  4OX9 L;  2F0Q A;  3RZO H;  3CCV A;  5M5X H;  4RWS C;  1KTK A;  2H4O A;  4FNF A;  1D5M C;  1EYC A;  5J22 A;  4KHV A;  2F0P A;  2E2H B;  2Q2H A;  2RF4 A;  2L55 A;  2YV5 A;  1ONL A;  4A3E H;  3J7A F;  1F9Q A;  1PTO D;  1TWF H;  1AE2 A;  1PH8 A;  4I7Z C;  4CKC A;  5M3M G;  1BXT A;  4YHH Q;  1SYD A;  1LTS D;  2K33 A;  4ZQ3 A;  4CBV A;  4XIG S;  4DV4 L;  4G7H C;  1SAP A;  4IFD I;  3I4N B;  1SBB B;  5IGD A;  1YNN C;  3CCU A;  1EL0 A;  4UP9 A;  2K5H A;  4JI4 L;  4PMB A;  1RTN A;  2E8G A;  3FKI B;  4KY6 A;  1CSP A;  1CKM A;  3LWE A;  3RD4 A;  2NZO A;  1LT5 D;  4YWL A;  1SYB A;  4WJ3 M;  5DNF A;  2QGQ A;  2UUC Q;  3NHH A;  2EY5 A;  4A93 H;  3WWV A;  3TN2 A;  1GUN A;  1RTO A;  1LTG D;  1B2T A;  3NWS A;  3EA6 A;  3L2P A;  4BY1 H;  5CYU A;  4A3E G;  1QUQ A;  3SK5 A;  1HR0 L;  2HCC A;  2D0O A;  3CQZ H;  1JJC B;  3U4Z A;  5IT9 c;  4KHP L;  3E0J A;  4IFD G;  5IWA Q;  1XNQ Q;  2PMZ B;  3RLO A;  1VQL A;  1S72 A;  3TS0 A;  3AFP A;  4ID6 A;  4DR6 L;  4UDU C;  4NMZ A;  2VXW A;  1DM0 B;  3H3V C;  2LXJ A;  4AH6 A;  4AIM A;  1AEX A;  3NK9 A;  2ICE C;  2RCF A;  2B3G A;  1WTH A;  4LUO A;  2A69 D;  2QIL A;  1PZI D;  1XXG A;  2BDN A;  2V1C C;  5DLQ E;  5FLX E;  1AFP A;  1QNK A;  1CKN A;  1HZB A;  3I3C A;  2KHS A;  3JC6 6;  2UXC Q;  4B3S L;  1PDQ A;  2R7Z H;  4A93 G;  2RDF A;  1GUT A;  2ZJP A;  1K8G A;  4UHV A;  4LF8 L;  5ELE A;  1IKM A;  1ZEQ X;  4BY1 G;  1MI2 A;  1QNU A;  4A3D G;  3S15 H;  4ZUI A;  3BYY B;  1KQS A;  1Q86 C;  1U4L A;  5I9P A;  4CJ0 B;  4B3T L;  2VQF L;  4A3C H;  1RJT A;  4ZCK A;  4RCO A;  1M1K C;  1S5F D;  2CWP A;  3PF4 A;  3TP6 A;  3CKI B;  4DV5 L;  3UDX A;  5IP9 G;  1LM0 A;  1VQA A;  3I4L A;  1TWG H;  3EBE A;  4RHR A;  4DF7 A;  4JI3 Q;  3I4N G;  1CFM A;  2Q2I A;  3QR8 A;  1II3 A;  3NBI A;  1E2V A;  2I5M X;  1ILP A;  3K6O A;  3DMU A;  4HJA A;  1IZ6 A;  2NVT B;  2I0Q A;  4A3I H;  2WAQ B;  3BDO A;  2Z6K C;  3K58 A;  2YYZ A;  4LW1 A;  1LT6 D;  3MEH A;  1FD7 D;  2A8V A;  2R7Z G;  3K80 C;  3TBI B;  2O2L D;  3E6Z X;  4MTN A;  4XDX A;  1W6K A;  5GAG C;  1AE3 A;  1XMO Q;  4H44 C;  3VA5 A;  3UE0 A;  2WII B;  4LF7 Q;  4YIJ A;  5KIX A;  1MJC A;  1RF2 D;  3MEF A;  2KUM A;  4NP5 A;  1NR2 A;  1EY5 A;  1QJO A;  4NXN Q;  2J4X A;  3G6J B;  3M3Y B;  3H09 A;  5JOB A;  2RSN A;  3TEH B;  3NTH A;  1G6P A;  2DN8 A;  2IL8 A;  2Y0S B;  3CMA A;  1LTL A;  5JPM C;  1SR3 A;  2R7D A;  1VMC A;  4MN3 A;  5CV4 A;  1X32 A;  4DAP A;  4K2K A;  1EU4 A;  4FXG C;  1A62 A;  1SDF A;  2NUC A;  4OEM B;  5EAY A;  4A3I G;  2A74 C;  3CU7 A;  4GKK L;  4HED A;  1MSG A;  3CP0 A;  3H6M A;  2VW9 A;  1YHB A;  2M2L A;  1FL0 A;  1QIL A;  1STA A;  5IE8 A;  3S2H H;  2DNC A;  3H3V I;  1KNA A;  2L11 A;  1QZG A;  2F4V L;  3HOU B;  2LMC B;  5DEH A;  3OMC A;  3PO2 G;  1V8Q A;  3PIO 3;  2XN9 C;  1WCM B;  2F3V A;  4B3R L;  3NEM A;  1N8R C;  4YY3 L;  5ELB A;  1SXT A;  2AHO B;  2RHQ B;  1KDC A;  1IYJ B;  4AYB G;  4IPC A;  1GHK A;  1TT2 A;  3CCL A;  1EQT A;  5GRO A;  1A63 A;  1SSO A;  5ELD A;  1C48 A;  3ICE A;  1N34 L;  1XWE A;  5EGT A;  1KAW A;  3ND9 A;  1HPC A;  1SMY C;  4KHZ A;  1XYI A;  3CRL C;  4YHH L;  4HAE A;  1ENA A;  2WAQ G;  3U4V A;  4JI8 L;  1Q46 A;  2HDL A;  2K6A A;  1HQM C;  4A75 A;  2HT1 A;  3RNU A;  4L5S A;  2E5L Q;  4GLV B;  1SN8 A;  4L5R C;  3VYU A;  4IUR A;  4IPH A;  2ES2 A;  1DD2 A;  1KXL A;  1YNX A;  3CC7 A;  3AB9 A;  1I4R A;  1PRT D;  1NY4 A;  2XTI A;  3KLW A;  3GTK B;  1JWM D;  2F0I A;  2UUC L;  2B2T A;  4A3K B;  1EY7 A;  1XNR Q;  2BOS A;  1UNS A;  2DJG C;  2A68 D;  3W3A A;  3QJY A;  3GDE A;  4O0A A;  4R4O A;  4B08 A;  2Y0S G;  1E1T A;  2IHE A;  1JMC A;  3QG1 A;  1C9O A;  2N55 A;  3X3N A;  5CV6 A;  2Q2U A;  1VF7 A;  1YIJ A;  1TU2 B;  5M3F H;  1GD7 A;  1QUQ B;  3J80 L;  1EIY B;  5IWA L;  4XTC S;  1KIX A;  4X66 Q;  4MIU A;  2XSC A;  4KY5 A;  3STB C;  4XQJ A;  3HOY H;  2G5D A;  5KYL A;  3NP8 A;  1YVC A;  3PIP A;  5M5W B;  5EKL A;  4WOR A;  5KNC A;  4POG A;  2PPB C;  3OHX C;  2F03 A;  2IPK D;  3DWQ A;  4X65 Q;  2EJG C;  2ZXP A;  2C9O A;  4C1N I;  3I72 A;  4B3M Q;  2WB1 E;  1X55 A;  1M90 C;  2UXC L;  1CKN B;  2TSS A;  4DR5 Q;  2E76 C;  3L9A X;  3RN5 A;  2K1B A;  5EPL A;  2UUA Q;  4K8I A;  5CV7 A;  1DOK A;  1VQI A;  1WVL A;  3S9W A;  3CCS A;  3EJI A;  4IUT A;  1E1O A;  1B3A A;  4PZ6 A;  5M3F G;  1MKH A;  5HGQ A;  3J7A V;  1MJE A;  2OCE A;  3OW2 A;  2PNH A;  4FP5 D;  3ONA B;  1WD0 A;  1TWH B;  3HOY G;  1LAB A;  5FLM H;  2KA7 A;  4XT3 B;  4GNX A;  4A3M B;  5JJI A;  2JA6 H;  1VQP A;  1L2F A;  4HMJ A;  5C4X H;  3GTG H;  4KD3 A;  3GTM B;  1IYV A;  3T1Y L;  2M00 A;  5F2D A;  3E5S A;  3K5L A;  3PUV A;  3TRE A;  3S1R H;  3QOL A;  3H91 A;  2FMM A;  4FVM A;  5LMU Q;  4IOA A;  4EX5 A;  1SLJ A;  4BY7 B;  4JC0 A;  1C8C A;  2DY8 A;  2BE5 D;  3KJO A;  2EY1 A;  4Q0F A;  1N36 Q;  1XMO L;  4LF7 L;  2N49 A;  4XYO A;  2K7V A;  5ELF A;  1TVX A;  4A3L G;  3VR3 A;  2R3Z A;  3WOE A;  3RZD H;  3TP8 A;  4ABN A;  4POF A;  1YHQ A;  4RGO S;  1NMF A;  2VZA A;  1E24 A;  5BN5 A;  5FLM G;  3R2T A;  1BO0 A;  1A0I A;  3GTQ H;  1G6Z A;  1G51 A;  1OXX K;  2B8F A;  3V05 A;  4HIO A;  2NN6 I;  4IO9 A;  2K5V A;  4NDX A;  3E9H A;  3RLF A;  4DV4 Q;  1GXD C;  2Z0S A;  1LTT D;  4P72 A;  1A2U A;  3BVM A;  2F0H A;  3CW2 C;  4KLK A;  3FVQ A;  1EWC A;  2OXP A;  2KJX A;  5BR8 Q;  1A3T A;  3CCE A;  4JI4 Q;  2CHB D;  4R4Q A;  4C3H B;  2F0N A;  4CJ2 C;  3DWA A;  4JOI A;  1JOO A;  2B2T C;  4QIW E;  4CGY B;  3KYH C;  1PFM A;  1UUP A;  1X3Q A;  5GAD C;  2MQH A;  1SE3 A;  3JAM L;  4DKA C;  3I73 A;  3PO3 B;  1XPR A;  2R92 G;  5IYD H;  5AJ3 L;  1Y14 B;  3R3O A;  4WRD A;  2E2D C;  1NTG A;  5KEE A;  1QG7 A;  1CHP D;  2NN6 G;  4RGM A;  5C44 B;  5JPN C;  1CA6 A;  1MGS A;  3AFQ A;  1PTO C;  3ITP A;  3P20 A;  1Q7Y C;  1F2Y A;  4N9P A;  4CDF C;  1KDA A;  1ESF A;  2E5L L;  1C0A A;  1XTC D;  2RDG A;  1WOC A;  1HTP A;  3HS0 C;  1TWA H;  3FHW A;  5D14 A;  2JA5 H;  2YTX A;  4WJ4 A;  1JWU D;  2JN4 A;  1CZW A;  4HSV A;  4K14 A;  4AYB E;  2RBM A;  5CGK A;  4TSS A;  1Q82 C;  1XNR L;  5IGG A;  1EY4 A;  2M9V A;  1FNU A;  4Y7N H;  1HNZ Q;  2MNA A;  4FF3 A;  4C56 C;  4P75 A;  3MTS A;  1WD1 A;  4X3K A;  4B3T Q;  2BCO A;  3CRK C;  1D1K A;  4PMC A;  5IT9 E;  2YU9 H;  3D4R A;  4X66 L;  1QVC A;  3OIP A;  4GNX C;  1M8A A;  4LMQ D;  1I5F A;  2B2W A;  1ET6 A;  4TRD A;  4OHJ A;  2X69 A;  2XNA C;  1PTO B;  1O78 A;  1I50 B;  3BDL A;  5E3F A;  3NSW A;  4JVZ A;  1B53 A;  4X65 L;  1I6H H;  3ZYY X;  4C3H G;  4PZ8 A;  3GD7 A;  1X3G A;  3MXP A;  2SOB A;  2JSO A;  5D65 A;  3J81 L;  3CCJ A;  4B3M L;  2QCP X;  2KHI A;  2A69 C;  2RHS B;  4A3G B;  1QOH A;  4ZUJ A;  2Y0S E;  1EQR A;  2HCI A;  4DR5 L;  3PO3 G;  5FJ8 H;  2KCM A;  4A3F H;  4QGU A;  1ET9 A;  4DV0 Q;  4JV5 Q;  4P73 A;  1Y8P B;  4A76 A;  5C44 G;  3BVZ A;  4GZY C;  3D4D A;  1GM5 A;  2L0C A;  3V96 A;  1EFI D;  5T1I A;  2TMP A;  3R8B A;  1YJ9 A;  1N32 Q;  3UDG A;  1EZ6 A;  1VQD A;  2NZH A;  3NTI A;  4IZ8 A;  1ENF A;  3NTK A;  1K83 B;  2NVY H;  1V43 A;  5D3I B;  2IX0 A;  5G3L F;  2FJ2 A;  4GNX B;  1KDB A;  4DXG A;  1D2B A;  1C7Y A;  3QIA A;  1VDZ A;  1HH2 P;  4J8Q A;  5M3M H;  1BBW A;  3ZJY C;  1SND A;  1LTR D;  3A8I E;  2F3I A;  3EFX D;  3MFY A;  5FJ8 G;  4A3F G;  3DWP A;  3DM3 A;  3M9B A;  5LMU L;  3N52 A;  5EQ0 A;  1ENC A;  4JPB W;  4IAL A;  2F4V Q;  5LL6 S;  1UEB A;  1Q8I A;  1GKH A;  1KD1 C;  1N36 L;  3S17 B;  3BZK A;  4JOI C;  2NTS A;  1UAP A;  3K5O A;  5J3B A;  3PMF A;  4UPA A;  4YY3 Q;  4ZAI A;  3TP5 A;  1ROD A;  3S14 H;  2G9H D;  2VL6 A;  2XWB B;  3HOZ B;  3ULP A;  2IY5 B;  2IHF A;  5IGC A;  1EEF D;  5I6Y A;  2UXB Q;  4NW2 A;  1EY0 A;  1DGS A;  4PNY A;  1SNO A;  4Y52 H;  4DA2 A;  2AMC B;  4IPG A;  4HJ5 A;  4C3I B;  2HHH L;  2VY3 A;  1N34 Q;  2D62 A;  1SRO A;  5C0X H;  2HD3 A;  2KHJ A;  2B2V A;  4YCV A;  1G2T A;  2JA8 B;  5C0X I;  1H9S B;  4IFD H;  2RSO A;  4JI8 Q;  4EQO A;  2PI2 A;  4DR3 L;  1STY A;  5A2Q L;  1HQR D;  1WTO A;  4CDE C;  4LF5 Q;  5C3E H;  5BR8 L;  2QEX A;  2R93 H;  1IKL A;  3E3X A;  3F8T A;  5EBD A;  2MFI A;  2K52 A;  3VR2 A;  5C4J H;  4JI0 Q;  2EXD A;  3U50 C;  2JEB I;  5IGB A;  4UP7 A;  4ZYS A;  1BBX C;  4K8J A;  5C0X J;  3AEV A;  4O42 A;  4JI2 Q;  2NTT A;  1GUS A;  1WJJ A;  2C35 B;  2WAC A;  1X54 A;  3NUC A;  4IFD J;  2PZU A;  2E2H H;  1TS2 A;  4A3D H;  5CR3 A;  3S1N B;  1EQQ A;  5TSS A;  3VYR A;  5C0X G;  1U5K A;  2A6H D;  1L0Y B;  2NBF A;  1BOS A;  2CFM A;  4EQN A;  5I2X A;  4X62 L;  3PSI A;  5FK9 C;  1HUM A;  1OXT A;  2PQA A;  3N6R A;  2B2W C;  4JW0 A;  5IP9 H;  3H0G B;  4BBS B;  1TKW B;  4X64 L;  3OIQ A;  1D5X C;  4NKL A;  4P71 A;  1V1P A;  2AKW B;  2QW7 A;  4JI5 Q;  1HHV A;  5C3E G;  4XQQ A;  4KKU A;  3I4N H;  2EYJ A;  1O7Y A;  1K28 A;  3OWE B;  3NPP A;  2R93 G;  1PXU A;  2EYL A;  3T56 B;  3I2Z A;  1MHW C;  4ME3 A;  3J7A 5;  3GTJ B;  3FKI H;  1VQB A;  2KEC A;  4LJZ C;  1KNE A;  1PRT C;  4OXP A;  2RKS A;  3VYT A;  3HKZ B;  2F0M A;  4BBR B;  3QO2 A;  2ZM6 Q;  1TWG B;  1HJP A;  1QB5 D;  4C2M B;  1HNZ L;  3SR1 A;  1RKN A;  1PH1 A;  3R93 A;  3PIP 3;  5EPK A;  2VS1 A;  4RAU C;  4JI7 Q;  3HOX B;  3UE1 A;  1E2W A;  4ZRZ A;  1EWI A;  3CC2 A;  2AQ2 B;  2EOT A;  2PW5 A;  2QDL A;  3ULJ A;  4QB4 A;  3TZU A;  3HKS A;  4ALP A;  4OEL B;  2JA8 G;  1TY2 A;  2F0D A;  3SEB A;  3LGJ A;  1BBU A;  4DUY Q;  3KOJ A;  1G29 1;  4DV3 Q;  3LNN A;  1F9R A;  3T1Y Q;  3PF5 A;  3A7A B;  3T16 A;  3FKI G;  4H7B A;  4XXE A;  5FO9 B;  3I56 A;  3W1G A;  1TQO A;  3T53 B;  2QF7 A;  4OO1 I;  4G4K A;  2AWN A;  1X3F A;  3NEN A;  1L1O A;  1UWV A;  4DNR B;  2KCN A;  1GUG A;  4CHT B;  3J80 c;  1VQF A;  2GVA A;  4QMG A;  1PRT B;  1D1I A;  1CQV A;  2J0T D;  4DV0 L;  4JV5 L;  5E7N A;  3PO2 H;  2MJ8 A;  1VQG A;  5IGF A;  2ASB A;  3KK7 A;  3KJP A;  1QVG A;  3KUP A;  1SE4 A;  1ILQ A;  3GTL B;  4F88 A;  2KCT A;  1N32 L;  1NCV A;  1E2Z A;  4JK1 C;  3NXW A;  2A6E D;  3DLL A;  3S1M B;  1UEA B;  2K4K A;  1KRT A;  2IX3 A;  1Y1W B;  1X65 A;  3X3M A;  1KHI A;  1MBY A;  1U4P A;  4KJN A;  2GVB A;  2B2V C;  5JEA H;  2IJ0 A;  2NVQ B;  5LMN W;  3K7A H;  1PFN A;  3RR5 A;  2NVT H;  3D3R A;  4G7O C;  3S1Q H;  3HRZ C;  3J7Z C;  3H3V H;  2VNU D;  3RUZ A;  4A3J B;  1AZQ A;  4IQZ A;  1F2M A;  4NPS A;  3SE0 A;  5IYB G;  2AUK A;  4C3J B;  1ZYR C;  4IUP A;  3W1B A;  5BN4 A;  3H15 A;  2ALY B;  2JYO A;  4PQX A;  3PGZ A;  3D31 A;  1HTL D;  4GN3 B;  2BE5 C;  1JC7 A;  1HA6 A;  1YNN D;  4RKL A;  4LFC Q;  2OT2 A;  3M3Y H;  2UXB L;  1SNC A;  5C4Z A;  1RCV D;  5AJ3 Q;  1LT3 D;  1D7Q A;  4DN4 M;  1BF4 A;  1CQF A;  2FHT A;  3AU7 A;  2JK8 A;  5JEA G;  1PRT F;  2BH8 A;  1A3V A;  1TY0 A;  2QDB A;  3RMH A;  1GUO A;  1HUN A;  4KKT A;  4LF5 L;  1S5C D;  1ASY A;  2UUB Q;  1WYD A;  1SMX A;  3HOU H;  4YCU A;  2F0V A;  2ICI A;  1RHP A;  3IL8 A;  1EOT A;  4JI0 L;  1WCM H;  1P16 A;  1EUJ A;  2KCC A;  5C5L A;  1TWC H;  1B70 B;  1SFO B;  1UE7 A;  3AMU A;  1ZKO A;  3GO5 A;  4HN7 A;  2Q8I B;  4JI2 L;  4GOP B;  1Q1E A;  1CTM A;  3S16 B;  1E0B A;  4L63 B;  1MSH A;  3HOV B;  1PZK D;  3U9S A;  2CW0 D;  1EWH A;  3CCM A;  3ERQ A;  1B8A A;  1NR4 A;  3D8G A;  2QA4 A;  3GTO B;  4QJF A;  1VQ7 A;  1SYF A;  3W2D A;  2PCF B;  3GTP B;  1TS5 A;  4JBM A;  4JI5 L;  1EOV A;  3BS1 A;  2PQA B;  1YHA A;  1L0X B;  1FNW A;  3J7Y W;  3JAM c;  1VQO A;  1EY9 A;  4K2L A;  3Q22 A;  3NQI A;  2QKI C;  3HOU G;  1V1P B;  3IFD A;  1YBY A;  2KVM A;  1WCM G;  3GTK H;  2I5H A;  1L1O C;  2R7F A;  2ZM6 L;  4A3K H;  5KND A;  4MNO A;  4V19 0;  2JA6 B;  4HID A;  2JEA I;  2KOL A;  4DU9 A;  1YJN A;  4YCW A;  1J5E Q;  2KBN A;  4JI7 L;  5I2Y A;  2DGY A;  1YNJ C;  2OQK A;  3TME A;  4A3B B;  1BCP F;  2F0J A;  4QQB X;  4A3L H;  2GN5 A;  4HJ9 A;  4GN4 B;  4DR1 Q;  2E2I B;  5HGT A;  1EY8 A;  4DUY L;  1PYB A;  1MD2 D;  5M5W H;  4DV3 L;  1VQM A;  3NE5 B;  1DOL A;  2IT1 A;  4DV2 L;  1U9R A;  1BCP D;  2F0F A;  5CV9 A;  2ID0 A;  3CHB D;  4R4I A;  2H5X A;  3RZD B;  4XT1 B;  3KBG A;  3CCQ A;  4A3K G;  1VQ6 A;  1W2B A;  2B63 B;  3PUY A;  2CQA A;  1SJE D;  1K3R A;  1SYE A;  1L1O B;  1K8A C;  2F0E A;  1GUW A;  4K0K Q;  1S5D D;  2Z4I A;  2F0S A;  4QUC A;  1PHJ A;  1DZ1 A;  4RGT A;  1I3Q B;  1JB7 A;  3FMC A;  5NUC A;  4H0L C;  3T13 A;  1J9O A;  2R92 H;  1IW7 D;  3ERO A;  1TWH H;  3J81 c;  4JI6 L;  5EKK A;  2PQE A;  4A3M H;  3SK8 A;  3I70 A;  2HHH Q;  2A1A A;  3GTM H;  2NN6 H;  4DV1 Q;  2NVX B;  1H9S A;  4JYA Q;  1OTC A;  2JA7 B;  2ZXO A;  1L0W A;  3E9I A;  3K0Y A;  3GV3 A;  2NWG A;  4V0B A;  4JCV E;  2O4X A;  4R4C A;  4EQP A;  4DR3 Q;  1JT8 A;  5FLX L;  1Y8N B;  1KRS A;  2JE6 I;  1J6Q A;  3H94 A;  4RHS A;  3I4O A;  3DUZ A;  4LNQ A;  1I4G A;  3UDI A;  3CF5 A;  4BY7 H;  4L5Q A;  5GAE C;  2Z4H A;  4DK0 A;  1R4Q B;  2D5D A;  2BH2 A;  3HP3 A;  2L1B A;  1PH6 A;  5KYI A;  1WTQ A;  3TDQ A;  1CUK A;  3T4A C;  2PMZ E;  2F0L A;  3M4O B;  4LFC L;  1KLG D;  2L4N A;  3C1E A;  1R9T H;  2EY2 A;  4RG1 A;  1CKO A;  1HNW L;  2JQO A;  4A3M G;  2A19 A;  4WJW A;  4QUF A;  2N88 A;  1LTI D;  1NUC A;  1SE8 A;  2MP1 A;  4JBJ A;  3MXN B;  2B2Y A;  1FNV A;  2FMC A;  1HZC A;  1B7Y B;  2BA0 A;  4OWX B;  1KL9 A;  3LWU A;  3T51 B;  4KY7 A;  4X62 Q;  3LX0 A;  1B3Q A;  1O7Z A;  1XPO A;  1BR9 A;  4N8X 1;  2OTL A;  1YIT A;  2RA4 A;  1KC8 C;  3QOJ A;  2B63 G;  2EYP A;  4KV6 A;  3Q6S A;  2UU9 L;  2SDF A;  4DR2 L;  3EVQ A;  1W3S A;  4LUZ A;  4BY7 G;  1NBW A;  1LTB D;  4XQN A;  2UUB L;  3HOW B;  1M4V A;  1H9M A;  1STN A;  3OWF A;  4DK3 C;  1B4O A;  4C3H H;  5M5Y B;  1KAA A;  2EYO A;  1SE2 A;  4IPD A;  3STB D;  2K14 A;  3MXU A;  2K03 A;  4O1N A;  4DNT B;  3PO3 H;  3S2D B;  2EYF A;  4LF6 Q;  1E22 A;  1B9N A;  3L0O A;  1ASZ A;  3TQY A;  1I6H B;  1Y1V B;  4U67 3;  1VQJ A;  1Q3L A;  3F2C A;  4QL5 A;  5C44 H;  2E2J B;  2WAQ E;  1RIP A;  4TQU S;  3ERS X;  1WFQ A;  3VR5 A;  3I8Z A;  3C46 A;  1K0R A;  2VUM B;  2D2C C;  4LFB Q;  4DUZ Q;  2PZT A;  2LKV A;  1RL2 A;  4M8A A;  5C5M A;  5T1G A;  3PUZ A;  2KEN A;  3SGI A;  1BUV T;  3R2I A;  5K5P A;  3ER0 A;  2RCN A;  4DAY B;  1U0L A;  1AZP A;  3DEP A;  1JE5 A;  3M4Y A;  5JVG 3;  3P7J A;  1E7Z A;  3KF6 A;  1PMR A;  3K7U C;  4GKJ Q;  1ICF B;  1VQ4 A;  1EQV A;  1VQE A;  2EJF C;  4DR7 Q;  4Z9C B;  3CME A;  4B3S Q;  2WKD A;  1FGU A;  1NSN S;  3A7L A;  2GA4 B;  5FO7 B;  1LV9 A;  4F87 A;  4G7Z C;  3KF8 A;  3I4M B;  1J5E L;  1K3B C;  1VQN A;  4DXF A;  1VCI A;  1X9N A;  2PZW A;  4EVO A;  5IY0 A;  4EQ5 A;  4BS9 A;  1S3O A;  3K5N A;  2HQL A;  4DR1 L;  1WTW A;  4OON A;  2HQE A;  2R61 A;  4B9X A;  2JXM B;  1K8M A;  1YJW A;  1PTO H;  5IOD A;  1OO9 B;  4LK1 C;  2XRS D;  4BA1 I;  2IW3 A;  1I50 H;  1IYU A;  1CHQ D;  2K32 A;  4KJO A;  5M9O A;  3M4Q A;  1VF5 C;  3J80 i;  5BN3 A;  1HFN A;  3RZO B;  1A2T A;  1H9K A;  2EY6 A;  3G6E A;  5M5X B;  2WB1 B;  2Z8L A;  2MUY A;  2PYK A;  3OTO L;  3B6Y A;  1A15 A;  2C5C A;  4FXD A;  1TII D;  1EZ8 A;  2K5D A;  4DGZ A;  4A3G H;  1BDO A;  1Q8K A;  5I4D A;  4JI1 Q;  1G2S A;  4A3E B;  4L5T A;  2VQE L;  3J80 E;  5JVH 3;  2DUD A;  1TWF B;  4I7A A;  2QEJ C;  4FO2 A;  4K0K L;  4HIK A;  1IBM L;  4DAV A;  1JR0 D;  1NJI C;  1EYA A;  4RGN A;  2ENB A;  4IUN A;  1F77 A;  2Q8R E;  4ME5 A;  1BVS A;  4LWC A;  2K5N A;  2VUM G;  1IHZ A;  2LXK A;  1S5E D;  1FJG L;  1K73 C;  1K83 H;  5E4X A;  4YWM A;  2A6E C;  1RD9 D;  3MA2 B;  2LS0 1;  5ELC A;  2B2Y C;  1VQ5 A;  1WI5 A;  4DV1 L;  1XMQ Q;  2OTJ A;  1PFS A;  3A8K E;  3CD6 A;  5DAU A;  3TZD A;  4JYA L;  1STG A;  3RLN A;  1O7L A;  1LTA D;  4ZLT F;  5CV8 A;  4A93 B;  3C3L A;  1F2L A;  2OQ0 A;  3T1H Q;  1Q1B A;  3GP7 A;  3SVM A;  4A3G G;  1PFB A;  4BY1 B;  2XRQ D;  4A3D B;  3HG9 A;  3MFG A;  2EZV A;  2F0W A;  2K5Q A;  3D4W A;  3I4M G;  2B2U A;  4I65 A;  2CQO A;  1A8V A;  1G8Z D;  2L12 A;  3CQZ B;  4KN4 C;  4R1J A;  3S17 H;  5ISR A;  4GOP A;  1UE1 A;  1I94 L;  3C2P A;  5LMN L;  2BDO A;  1PH7 A;  5ELO A;  3HOZ H;  2L15 A;  4MHE A;  1IBL L;  4QCL A;  4H02 A;  4LFA Q;  3BU2 A;  4HIM A;  1VMP A;  1F2Z A;  4IUQ A;  4RFB A;  4C3I H;  1LUZ A;  5DM6 3;  1VQC A;  2F0T A;  3M85 A;  2I46 A;  1X3P A;  4HTH A;  3NEL A;  3P75 A;  2JA8 H;  1EIG A;  2WB1 G;  3M4P A;  2R7Z B;  1G91 A;  2K01 A;  1ML0 D;  2N3S A;  2XGT A;  2K50 A;  3S15 B;  4F8M A;  5CC4 A;  5LHY 1;  3PV0 A;  3VR6 A;  3HEJ A;  3I55 A;  1NAP A;  2SNM A;  2B39 A;  5DM7 3;  1VQH A;  5IYC H;  4HJ8 A;  4QIW B;  3PUW A;  1HRJ A;  3HOZ G;  2F0O A;  4OGQ C;  5C3X A;  2I07 B;  3FRP B;  4G57 A;  4X3S A;  3P1H A;  4CDD C;  4CDC C;  5C3W A;  4LF6 L;  1JQY D;  2XVS A;  1IL2 A;  2Z6B A;  2A68 C;  1TR5 A;  3KDF B;  3S1N H;  4C3I G;  2Q2T A;  2OF1 A;  4IJH A;  3FPP A;  4RMF A;  4A3I B;  3NBH A;  4CKE A;  4IUV A;  3K0X A;  1VQK A;  3JAM i;  4LF4 Q;  2CW0 C;  2R6G A;  1AN8 A;  2PO4 A;  4LFB L;  4DUZ L;  1JWS D;  1GVP A;  3H0G H;  4E6I A;  4BBS H;  3DHQ A;  2HDM A;  1B9M A;  4FYD A;  1Z6H A;  3S24 A;  3CPF A;  3PO2 B;  2CH4 W;  3JAM E;  1H9R A;  4DV2 Q;  2E75 C;  2WV6 D;  1O7I A;  1GHJ A;  2HIX A;  2KEE A;  1A6X A;  4NXM Q;  4R8I A;  1KLU D;  4BA2 I;  5IYC G;  4OO1 H;  1WTR A;  3GTJ H;  4GKJ L;  1HCZ A;  1STE A;  4M1U B;  4AYB B;  4ZKC B;  1SYC A;  3VYS A;  4DR7 L;  2ZT9 C;  3KF6 B;  2HUG A;  1XPU A;  1DOM A;  4ZKB B;  1Q12 A;  2EIF A;  4BBR H;  2SEB D;  1AP0 A;  1X3E A;  3V2T A;  3SDZ A;  2K28 A;  4ILW A;  2VB2 X;  5IYB H;  4C2M H;  1OXS C;  2EPB A;  4RKB A;  3BVG A;  3A74 A;  1JIC A;  3Q24 A;  3K7A B;  2WFW A;  3HOX H;  1B50 A;  3KF8 B;  1HXY D;  2EXZ A;  1QWY A;  3S1Q B;  3I90 A;  4H13 C;  3A5Z B;  1AW7 A;  1CM9 A;  1PZJ D;  2SNS A;  3NQT A;  4DR4 Q;  1U4M A;  2BA1 A;  3S2H B;  4KK7 A;  3H0G G;  4BBS G;  3IKJ A;  4DV7 Q;  3DEO A;  3EIV A;  2YTY A;  3KLS X;  5KRU A;  1PH9 A;  1JCK B;  4JI6 Q;  4FF4 A;  1DYQ A;  1CZG A;  1B44 D;  3KLR A;  4X6A H;  2HIV A;  1XTD A;  4OO1 G;  2D0P A;  4JBK A;  4A3C G;  1EYG A;  2N78 A;  2P5Z X;  2EYM A;  1BCP C;  3I7F A;  1E3P A;  4MTK A;  3HKZ G;  4IOC A;  4BBR G;  5JJZ A;  2O5I C;  4JG2 A;  4JI1 L;  2X6G A;  2G9D A;  4JBW A;  3MC0 B;  4P2C B;  3BZD B;  2IWH A;  1WTV A;  3CCR A;  2B2U C;  1EY6 A;  4APV A;  3SXH A;  1SNQ A;  3PCO B;  3OOC A;  3MHB A;  4U68 A;  3HOX G;  1Y8O B;  4YWK A;  4GOP C;  1IL8 A;  3A5U A;  2L5T A;  3J81 i;  2AWO A;  2CVR A;  4GN5 A;  2UXD Q;  2F4I A;  5JEA J;  3GTL H;  1HZ9 A;  1STB A;  3WDN A;  5L37 A;  4KD4 A;  3S1M H;  3MXN A;  1HNW Q;  4QF4 A;  3U9O A;  5IT9 L;  3J81 E;  1Y1W H;  1HR0 W;  4ULL A;  1IW7 C;  4Q5V A;  4F7X A;  1XMQ L;  5K36 H;  1TWC B;  3URY A;  1LT4 D;  2NVQ H;  3Q0A A;  1I4H A;  1PA6 A;  1Z9F A;  2K75 A;  4RH6 A;  1SNP A;  3T1H L;  4A3J H;  1Q81 C;  1GO3 E;  1YEZ A;  3WOF A;  3DXJ C;  1JOK A;  3BG3 A;  3TRZ A;  1EIF A;  1HNX Q;  4PZ7 A;  4S3S A;  1DCZ A;  2UU9 Q;  1D6E C;  1LYL A;  4DR2 Q;  1BCP B;  4NB3 A;  3SK6 A;  4C3J H;  1C4Q A;  5C6A A;  1X56 A;  5M3F B;  2ZJQ A;  1SNM A;  3A56 A;  2ZTC A;  1QVF A;  1H95 A;  3K57 A;  2FFK B;  1TS4 A;  2NB0 A;  3C1F A;  2Q8T A;  1VQ8 A;  3HOY B;  1AH9 A;  3UDF A;  4PMW A;  1V1O A;  1EFW A;  2PNR C;  3TS2 A;  1TXY A;  2L9H A;  1OXV A;  1Y1W G;  1NE3 A;  2MO0 A;  4OIJ A;  4LFA L;  2I5L X;  5C4H A;  4P74 A;  3A54 A;  1W6J A;  4DFA A;  5K36 G;  5FLX c;  3F2U A;  2N8N A;  1IXR A;  2Z9H A;  4J6H A;  2MGS A;  3CXC A;  1T5E A;  2EDG A;  1JOR A;  4X64 Q;  4LF9 Q;  2WKC A;  4DAY A;  4A3J G;  5HY6 A;  4OWW B;  1I4P A;  2H1E A;  4QY7 A;  2VB3 X;  1JJ2 A;  3EN2 A;  4J1M A;  3KLS A;  4FXK C;  4C3J G;  1I4X A;  5I9O A;  1D8L A;  3FEW X;  1MIU A;  4PV1 C;  5LL6 X;  1P8L A;  2FXQ A;  1D5Z C;  4FDB A;  1XNQ L;  2MPM A;  2CH4 A;  1X6O A;  5CBA E;  1SFO H;  1A3U A;  5D3D A;  3M7G A;  2WP8 J;  5GAH C;  4PG3 A;  1SRU A;  2EQS A;  1NNX A;  5EKI A;  3GTG B;  3OMG A;  3S16 H;  2LY7 A;  5C4X B;  3Q8D A;  2F3W A;  3HOV H;  4L6T B;  4N9T A;  4GS3 A;  2CCZ A;  1IBK Q;  5A2Q E;  3OPO A;  2EYH A;  2YTV A;  1ICW A;  3S1R B;  4LF4 L;  1FGB D;  4DV6 Q;  1ESR A;  3GTO H;  3NBH B;  1SJH D;  1LLR D;  4DAM A;  5J39 A;  3GTP H;  1WTP A;  1N33 Q;  2AQ1 B;  1PLF A;  3OSO A;  1UE6 A;  1OXU A;  4NXM L;  4AQY Q;  3FPU B;  1PH4 A;  1FR3 A;  4OIK A;  3OTO Q;  2ZJR A;  2R92 B;  3QWN A;  1EYD A;  2OEO A;  3GTQ B;  1JOQ A;  4JI3 L;  1UE5 A;  2VQE Q;  3IRB A;  1BKB A;  3PQI A;  3OYY A;  4KMU C;  3HOV G;  5A35 A;  1IBM Q;  1SYG A;  2O5J C;  4A3B H;  3O13 A;  1CK1 A;  1NMG A;  1GOZ A;  4DR4 L;  5IGE A;  4B9W A;  3VR4 A;  3HFZ B;  2FIN B;  5EBC A;  2NYZ D;  1Y69 U;  1PV4 A;  1ZYR D;  5GQO A;  4DV7 L;  2A73 B;  4BXX H;  2E2I H;  2Z1C A;  1R4P B;  1DJR D;  1FJG Q;  1YZ6 A;  3VDY A;  4FF2 A;  3K8A A;  1J8I A;  5H1S E;  4X3T A;  1Q90 A;  1EIH A;  2MO1 A;  3HGB A;  2F0U A;  4X3U A;  3K81 C;  4NXN L;  4OX9 Q;  3KFU A;  1WTX A;  1VQ9 A;  1R9T B;  2J7Z A;  1STH A;  4OL7 A;  2JA9 A;  2EVB A;  3BYT B;  2B63 H;  4DNI A;  2JA6 G;  1SMY D;  1Z47 A;  1HFG A;  4KKS A;  3HZX A;  4R8N A;  3ULL A;  4EGV A;  1V9P A;  5C4X G;  3PIO A;  2V4D A;  3RN2 A;  4DK6 C;  1BNZ A;  4A3B G;  1JJG A;  5FO8 B;  4HR7 B;  1I94 Q;  4K6D A;  3GQB A;  3I91 A;  5LMN Q;  2UXD L;  1I3Q H;  4LAA A;  5COY A;  5E4W C;  1LO5 D;  4DPG A;  1S4Z A;  2XWJ B;  4OWT B;  4DK1 A;  1PYS B;  3BZC A;  1IBL Q;  5EPJ A;  3ND8 A;  4BXX G;  1FVI A;  1K8O A;  1K9M C;  2F52 A;  5AFW A;  1TWA B;  4R9W A;  2RVL A;  1XX8 A;  3SHL A;  2EE1 A;  2JA5 B;  3CC4 A;  3OW7 A;  2NVX H;  1ZXT A;  5HUR A;  3K5M A;  4IJL A;  1HZA A;  4UAI A;  1K0S A;  2F1M A;  2JA7 H;  2X6L A;  3HKZ E;  3L3O C;  4ZK9 B;  2AUJ D;  2F0G A;  2ZTD A;  4KTA A;  1JE4 A;  4Y7N B;  4R4T A;  5JAV A;  3FP9 A;  2IX1 A;  3IFT A;  1HNX L;  3W5O A;  5ELN A;  1CI3 M;  1JB3 A;  2D9U A;  3CAM A;  4HJ7 A;  1T5X D;  2RQX A;  3DM1 A;  4IUU A;  5JJK A;  1CT1 D;  1HR0 Q;  2KED A;  5CBE E;  1PH5 A;  4WFN 3;  5EJW A;  1B1Z A;  2EJM A;  4C1N K;  3TSS A;  5IP7 H;  5KNB A;  2YU9 B;  4KHP Q;  2JP1 A;  3PUX A;  3MZ5 A;  3M4O H;  3KDF A;  1XJV A;  2ZTE A;  3AYH B;  1S40 A;  1N9W A;  4K5V A;  1PYW D;  4ODG A;  4MZ9 A;  4DR6 Q;  3CPW A;  4GLX A;  3G71 A;  5KGU A;  4HCE A;  2OWO A;  3A0J A;  1H9J A;  1HA5 A;  2NZ1 D;  3FDT A;  4K5X A;  1FYC A;  5I6W A;  2JA7 G;  3MVV A;  2A6H C;  3MAQ A;  2ATW A;  3IAY A; 
#chains in the Genus database with same CATH homology
 4LF9 L;  2L15 A;  3HOZ H;  1PH2 A;  3HOY G;  1IBL L;  5IYD G;  5FLM H;  4NPS A;  4GNX A;  4LF8 Q;  5IYB G;  4TVA B;  5JJI A;  2JA6 H;  1VQP A;  4UY8 C;  4H02 A;  1L2F A;  4LFA Q;  3BU2 A;  4HIM A;  5C4X H;  3W1B A;  3GTG H;  3H15 A;  3T1Y L;  2ALY B;  4C3I H;  3PGZ A;  1LUZ A;  2VQF Q;  3HOW H;  3D31 A;  3PUV A;  1V1Q A;  1VQC A;  5JJL A;  3M85 A;  4GN3 B;  3TRE A;  5M5Y H;  3NEL A;  5IP7 G;  3J81 j;  3S1R H;  2JA8 H;  2WB1 G;  3M4P A;  4LFC Q;  2VNU D;  2CWA A;  3M3Y H;  4DV5 Q;  2UXB L;  4J15 A;  1VS0 A;  1YI2 A;  5LMU Q;  4IOA A;  4EX5 A;  1SLJ A;  2XGT A;  2N3S A;  5AJ3 Q;  2K50 A;  3AQQ A;  3S2D H;  1D7Q A;  3PV0 A;  4JC0 A;  3I55 A;  2B29 A;  3KJO A;  2CKZ B;  2JK8 A;  3F2B A;  1N36 Q;  5JEA G;  1XMO L;  2JA5 G;  1IBK L;  1Y1V H;  4LF7 L;  1VQH A;  2N49 A;  2BH8 A;  4UP8 A;  5IYC H;  1CSQ A;  4HJ8 A;  2E2J H;  4A3L G;  3PUW A;  4DV6 L;  3RZD H;  2LSS A;  3HOZ G;  4POF A;  1YHQ A;  2VUM H;  4O2D A;  1NMF A;  2VZA A;  1E24 A;  5FLM G;  3G48 A;  2UUA L;  4LF5 L;  4LF6 L;  3BJU A;  1A0I A;  3GTQ H;  1IL2 A;  3F1Z A;  1ASY A;  1N33 L;  1PVO A;  3KDF B;  2UUB Q;  1WYD A;  1SMX A;  3HOU H;  1G51 A;  3G4S A;  3S1N H;  1OXX K;  4GLA C;  4IJH A;  4YCU A;  2Q2T A;  4RMF A;  3HOW G;  4JI0 L;  1WCM H;  1P16 A;  1EUJ A;  4HIO A;  4AQY L;  1TWC H;  2NN6 I;  1VQK A;  3K0X A;  3JAM i;  4LF4 Q;  2R6G A;  4IO9 A;  2K5V A;  3E9H A;  1B70 B;  2JJQ A;  1UE7 A;  3RLF A;  4DV4 Q;  3GO5 A;  2Z0S A;  1T9H A;  4DUZ L;  4LFB L;  4P72 A;  4JI2 L;  4GOP B;  1GVP A;  1Q1E A;  3CW2 C;  3H0G H;  4BBS H;  3U58 A;  4KLK A;  4LUV A;  3S24 A;  3E0E A;  3H3V H;  5BR8 Q;  3M7N A;  3CPF A;  3CCE A;  3F2D A;  4DV2 Q;  4JI4 Q;  3I4M H;  4R4Q A;  1O7I A;  2HIX A;  3CCM A;  1Y1V G;  4NXM Q;  1PH3 A;  1QZH A;  5IYC G;  4BA2 I;  4GKJ L;  3GTJ H;  1B8A A;  4JOI A;  4QIW E;  3KYH C;  3D0F A;  4GKK Q;  5GAD C;  2MQH A;  2QA4 A;  4QJF A;  1VQ7 A;  4DKA C;  3KF6 B;  1XPU A;  4DR7 L;  2Z6K A;  1Q12 A;  2EIF A;  4BBR H;  4A4I A;  1XPR A;  1X3E A;  2R92 G;  5IYD H;  4JBM A;  4JI5 L;  1EOV A;  5IYB H;  5AJ3 L;  2PQA B;  4C2M H;  2PI2 E;  1OXS C;  1Y14 B;  4KI0 A;  3L7Z C;  1YHA A;  3JAM c;  1VQO A;  1NTG A;  3A74 A;  3HOU G;  2NN6 G;  2WFW A;  3HOX H;  4B3R Q;  1YBY A;  1WCM G;  3KF8 B;  3AFQ A;  3GTK H;  4OX9 L;  2I5H A;  3RZO H;  1L1O C;  3CCV A;  2R7F A;  5M5X H;  3A5Z B;  1Q7Y C;  4DR4 Q;  2ZM6 L;  4A3K H;  2BA1 A;  4MNO A;  3H0G G;  2E5L L;  4BBS G;  4DV7 Q;  4HID A;  2JEA I;  3EIV A;  2YTY A;  1C0A A;  1PH9 A;  1YJN A;  1WOC A;  2Q2H A;  2RF4 A;  4JI6 Q;  4YCW A;  2YV5 A;  1J5E Q;  2KBN A;  4A3E H;  4JI7 L;  1TWA H;  2DGY A;  2OQK A;  1TWF H;  3FHW A;  2JA5 H;  2HIV A;  4X6A H;  1XTD A;  4OO1 G;  2D0P A;  4JBK A;  4A3C G;  1EYG A;  1AE2 A;  1PH8 A;  2YTX A;  5M3M G;  2N78 A;  4AYB E;  4YHH Q;  4QQB X;  4WJ4 A;  4A3L H;  2GN5 A;  4HJ9 A;  3PO3 G;  3I7F A;  1Q82 C;  1E3P A;  4GN4 B;  4XIG S;  4DV4 L;  4DR1 Q;  1XNR L;  3HKZ G;  4IOC A;  4BBR G;  4IFD I;  4JG2 A;  4DUY L;  4Y7N H;  1PYB A;  4JI1 L;  3CCU A;  2MNA A;  1HNZ Q;  4JBW A;  4DV3 L;  5M5W H;  1VQM A;  4UP9 A;  2K5H A;  3CCR A;  4JI4 L;  2IT1 A;  4APV A;  4DV2 L;  3PCO B;  4P75 A;  2E8G A;  3HOX G;  4B3T Q;  4YWK A;  4GOP C;  3A5U A;  1CSP A;  2ID0 A;  3J81 i;  1CKM A;  2AWO A;  2NZO A;  4YWL A;  4WJ3 M;  4GN5 A;  4R4I A;  2H5X A;  2QGQ A;  2UUC Q;  3CCQ A;  5JEA J;  3GTL H;  1HZ9 A;  2YU9 H;  2UXD Q;  4X66 L;  3WWV A;  1QVC A;  4A3K G;  4A93 H;  4GNX C;  1VQ6 A;  1W2B A;  1I5F A;  3PUY A;  3S1M H;  3L2P A;  1K3R A;  1K8A C;  1L1O B;  4BY1 H;  1HNW Q;  1Y1W H;  1HR0 W;  4A3E G;  1QUQ A;  4K0K Q;  1XMQ L;  4X65 L;  1HR0 L;  1I6H H;  4PZ8 A;  2NVQ H;  2D0O A;  1X3G A;  1JJC B;  3CQZ H;  3GD7 A;  1PHJ A;  3CCJ A;  3U4Z A;  4B3M L;  5IT9 c;  1PA6 A;  1JB7 A;  4KHP L;  4IFD G;  2KHI A;  5IWA Q;  1XNQ Q;  1Z9F A;  2RHS B;  2K75 A;  3RLO A;  3T1H L;  1VQL A;  2Y0S E;  1EQR A;  4A3J H;  4DR5 L;  1GO3 E;  3TS0 A;  1S72 A;  1YEZ A;  1Q81 C;  5FJ8 H;  2KCM A;  4A3F H;  1TWH H;  3AFP A;  1EIF A;  4QGU A;  4PZ7 A;  1HNX Q;  3TRZ A;  3J81 c;  2UU9 Q;  4JI6 L;  4DR6 L;  1LYL A;  4DR2 Q;  4A3M H;  4DV0 Q;  4NB3 A;  2LXJ A;  4AH6 A;  4AIM A;  4C3J H;  4JV5 Q;  2HHH Q;  2A1A A;  3GTM H;  4DV1 Q;  2B3G A;  4LUO A;  1X56 A;  2V1C C;  2ZJQ A;  5DLQ E;  4P73 A;  4A76 A;  4JYA Q;  5C44 G;  1CKN A;  1OTC A;  2ZTC A;  1QVF A;  1L0W A;  2R92 H;  1H95 A;  1HZB A;  3E9I A;  1GM5 A;  3JC6 6;  1YJ9 A;  2UXC Q;  4B3S L;  4JCV E;  1N32 Q;  3UDG A;  1VQ8 A;  1VQD A;  2NZH A;  4R4C A;  4DR3 Q;  3UDF A;  2R7Z H;  4A93 G;  1AH9 A;  1JT8 A;  2JE6 I;  1KRS A;  1J6Q A;  4PMW A;  2ZJP A;  1K8G A;  1EFW A;  4LF8 L;  3TS2 A;  1TXY A;  2NVY H;  1V43 A;  3I4O A;  4LNQ A;  4BY1 G;  1OXV A;  3UDI A;  3CF5 A;  1Y1W G;  1NE3 A;  2MO0 A;  3S15 H;  4LFA L;  4A3D G;  2I5L X;  4BY7 H;  4L5Q A;  4P74 A;  5GAE C;  2IX0 A;  1Q86 C;  1KQS A;  4GNX B;  5K36 G;  5FLX c;  2VQF L;  4B3T L;  1C7Y A;  2BH2 A;  2N8N A;  1IXR A;  1HH2 P;  1PH6 A;  4A3C H;  3CXC A;  5M3M H;  1BBW A;  1M1K C;  1CUK A;  2CWP A;  2PMZ E;  3ZJY C;  3PF4 A;  4LFC L;  4X64 Q;  4DV5 L;  3UDX A;  5IP9 G;  4LF9 Q;  1LM0 A;  1R9T H;  1VQA A;  4A3J G;  2F3I A;  5HY6 A;  4OWW B;  1TWG H;  3EBE A;  5FJ8 G;  3DM3 A;  3M9B A;  1CKO A;  4RG1 A;  5LMU L;  4A3F G;  4JI3 Q;  4QY7 A;  3I4N G;  2Q2I A;  1HNW L;  1JJ2 A;  2JQO A;  4A3M G;  3EN2 A;  2A19 A;  2I5M X;  2F4V Q;  1UEB A;  1GKH A;  1SE8 A;  1KD1 C;  4JBJ A;  1N36 L;  3BZK A;  3MXN B;  4JOI C;  4HJA A;  1D8L A;  1MIU A;  1HZC A;  1B7Y B;  5J3B A;  1IZ6 A;  2BA0 A;  4UPA A;  4YY3 Q;  2I0Q A;  4A3I H;  4OWX B;  3S14 H;  1P8L A;  2VL6 A;  2FXQ A;  2Z6K C;  1KL9 A;  4X62 Q;  4FDB A;  2YYZ A;  4LW1 A;  3ULP A;  1XNQ L;  2A8V A;  1X6O A;  2IHF A;  2IY5 B;  1SFO H;  2R7Z G;  2UXB Q;  3K80 C;  1XPO A;  2OTL A;  1YIT A;  1KC8 C;  2B63 G;  2WP8 J;  1DGS A;  4MTN A;  2UU9 L;  5GAH C;  4PG3 A;  1SRU A;  2EQS A;  4DR2 L;  3S16 H;  4Y52 H;  1W3S A;  2AMC B;  4LUZ A;  4IPG A;  5GAG C;  1NBW A;  3Q8D A;  4HJ5 A;  2UUB L;  4BY7 G;  1AE3 A;  2HHH L;  2VY3 A;  1N34 Q;  3HOV H;  2D62 A;  4DK3 C;  1XMO Q;  1SRO A;  4GS3 A;  3UE0 A;  1IBK Q;  2KHJ A;  2CCZ A;  4LF7 Q;  4C3H H;  2YTV A;  4YCV A;  1MJC A;  4IPD A;  3MEF A;  3STB D;  4LF4 L;  5C0X I;  4NXN Q;  2K14 A;  4DV6 Q;  4JI8 Q;  2PI2 A;  3TEH B;  3NBH B;  4DR3 L;  3GTO H;  1G6P A;  3CMA A;  3PO3 H;  1LTL A;  1SR3 A;  4DAM A;  2R7D A;  4LF5 Q;  1E22 A;  5C3E H;  4LF6 Q;  3GTP H;  3L0O A;  5BR8 L;  2QEX A;  1N33 Q;  2R93 H;  1ASZ A;  3F8T A;  3TQY A;  1UE6 A;  2MFI A;  1VQJ A;  2K52 A;  3F2C A;  1A62 A;  1OXU A;  4NXM L;  5C4J H;  4JI0 Q;  4QL5 A;  5C44 H;  5EAY A;  4AQY Q;  4A3I G;  2WAQ E;  1RIP A;  2EXD A;  4TQU S;  3U50 C;  3ERS X;  1WFQ A;  2JEB I;  1PH4 A;  4GKK L;  4UP7 A;  1K0R A;  5C0X J;  3OTO Q;  2ZJR A;  3AEV A;  4LFB Q;  4DUZ Q;  3CP0 A;  4JI2 Q;  2VW9 A;  1RL2 A;  1YHB A;  1FL0 A;  1WJJ A;  2KEN A;  3PUZ A;  3SGI A;  2C35 B;  5IE8 A;  3S2H H;  1X54 A;  3H3V I;  4IFD J;  4JI3 L;  3ER0 A;  1QZG A;  2RCN A;  2E2H H;  1UE5 A;  2VQE Q;  3IRB A;  2F4V L;  1BKB A;  4DAY B;  4A3D H;  3OYY A;  1U0L A;  1EQQ A;  3HOV G;  3PO2 G;  1IBM Q;  1JE5 A;  5C0X G;  4B3R L;  1E7Z A;  1U5K A;  3KF6 A;  3K7U C;  3NEM A;  1N8R C;  4GKJ Q;  4YY3 L;  4A3B H;  2AHO B;  2RHQ B;  2CFM A;  1VQ4 A;  4X62 L;  1IYJ B;  1NMG A;  3PSI A;  4DR4 L;  1OXT A;  1VQE A;  2PQA A;  4AYB G;  4IPC A;  4DR7 Q;  5IP9 H;  3HFZ B;  3CME A;  4B3S Q;  3CCL A;  1PV4 A;  5GQO A;  4P71 A;  4DV7 L;  4BXX H;  2AKW B;  2E2I H;  1FGU A;  4JI5 Q;  5C3E G;  3I4N H;  5GRO A;  1FJG Q;  1A63 A;  1YZ6 A;  1J5E L;  2R93 G;  3VDY A;  3ICE A;  3I2Z A;  3K8A A;  1N34 L;  1VQN A;  1KAW A;  1VCI A;  5H1S E;  1X9N A;  4ME3 A;  5IY0 A;  3J7A 5;  4EQ5 A;  3FKI H;  4KHZ A;  2MO1 A;  1VQB A;  1S3O A;  4YHH L;  3K81 C;  4NXN L;  4OXP A;  4OX9 Q;  3KFU A;  2HQL A;  2WAQ G;  3U4V A;  4DR1 L;  1VQ9 A;  4JI8 L;  1Q46 A;  2ZM6 Q;  4OON A;  4A75 A;  2JA9 A;  1HJP A;  2HT1 A;  3RNU A;  4L5S A;  2E5L Q;  4GLV B;  1SN8 A;  2B63 H;  1HNZ L;  1PH1 A;  4DNI A;  4L5R C;  1YJW A;  2JA6 G;  1Z47 A;  4IPH A;  3ULL A;  4BA1 I;  2ES2 A;  1I50 H;  2VS1 A;  1V9P A;  5C4X G;  1KXL A;  3PIO A;  4JI7 Q;  1YNX A;  3CC7 A;  3RN2 A;  4DK6 C;  3UE1 A;  1NY4 A;  1EWI A;  2XTI A;  3KLW A;  3M4Q A;  3J80 i;  3CC2 A;  4A3B G;  1JJG A;  1I94 Q;  3ULJ A;  3G6E A;  5LMN Q;  2UUC L;  2UXD L;  3HKS A;  4ALP A;  2JA8 G;  1I3Q H;  3OTO L;  3B6Y A;  1XNR Q;  4DPG A;  4OWT B;  1PYS B;  3BZC A;  3LGJ A;  4A3G H;  1Q8K A;  1BBU A;  3GDE A;  4O0A A;  4R4O A;  1FVI A;  2Y0S G;  4DUY Q;  1IBL Q;  4JI1 Q;  1E1T A;  4BXX G;  1K9M C;  2F52 A;  3KOJ A;  1G29 1;  4L5T A;  2VQE L;  2IHE A;  4DV3 Q;  1JMC A;  1C9O A;  2DUD A;  4K0K L;  3T1Y Q;  3PF5 A;  4HIK A;  1IBM L;  2ATW A;  3CC4 A;  3FKI G;  3I56 A;  2Q2U A;  1NJI C;  2NVX H;  1YIJ A;  4IJL A;  1HZA A;  5M3F H;  1GD7 A;  1QUQ B;  3W1G A;  1EIY B;  1BVS A;  5IWA L;  3HKZ E;  2JA7 H;  4OO1 I;  2AWN A;  4LWC A;  1X3F A;  2ZTD A;  1L1O A;  3NEN A;  1UWV A;  2K5N A;  4XTC S;  4X66 Q;  3STB C;  1KIX A;  2VUM G;  3HOY H;  4R4T A;  3FP9 A;  1YVC A;  2IX1 A;  3PIP A;  3W5O A;  2LXK A;  5ELN A;  1VQF A;  2GVA A;  3J80 c;  1HNX L;  1K73 C;  4POG A;  1FJG L;  1K83 H;  4YWM A;  3CAM A;  4HJ7 A;  4DV0 L;  4JV5 L;  1VQ5 A;  5E7N A;  3PO2 H;  5JJK A;  1WI5 A;  1VQG A;  4DV1 L;  1XMQ Q;  4X65 Q;  1PFS A;  1HR0 Q;  2ASB A;  3KJP A;  2OTJ A;  1QVG A;  3CD6 A;  4JYA L;  3RLN A;  1PH5 A;  4B3M Q;  2WB1 E;  1X55 A;  5IP7 H;  4KHP Q;  1M90 C;  2UXC L;  2KCT A;  1N32 L;  3PUX A;  3M4O H;  2OQ0 A;  1CKN B;  3T1H Q;  1Q1B A;  3KDF A;  3DLL A;  4DR5 Q;  2K4K A;  2UUA Q;  3RN5 A;  1KRT A;  4A3G G;  1XJV A;  2ZTE A;  3AYH B;  1S40 A;  1X65 A;  1N9W A;  4DR6 Q;  1VQI A;  4MZ9 A;  1KHI A;  3CPW A;  4GLX A;  3G71 A;  3I4M G;  2GVB A;  3CCS A;  2OWO A;  3A0J A;  2CQO A;  1E1O A;  1A8V A;  4PZ6 A;  4R1J A;  5LMN W;  3S17 H;  3K7A H;  5M3F G;  1MKH A;  5HGQ A;  4GOP A;  1UE1 A;  3RR5 A;  1I94 L;  2NVT H;  5LMN L;  1PH7 A;  1MJE A;  2JA7 G;  5ELO A;  3J7Z C;  3S1Q H;  2OCE A;  4X64 L;  3OW2 A;  2PNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...