3S1RJ

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s1rJ00
1H88C 5E3NA 3ZQLA 4M3BA 2XSDC 2XGDA 2EH3A 3RQIA 3BR1A 4A3CJ 2M8GX 3OSFA 2Y9ZA 5EGOB 1AKHA 1APLC 3A01A 2E1OA 2MW8A 3HBLA 2X48A 3FKIJ 3LSPA 2CQQA 1W0TA 1BA5A 4C2MJ 4M3FA 2R5YA 5C44J 1LE8B 2K9SA 1A6IA 4BKXA 3SJMA 5EZGA 3JRCA 3L1PA 3BTIA 4AYBN 3JRDA 4QIWN 3FIWA 4S0HB 5C3EJ 2FQ4A 1JKPC 3S2DJ 2PMZN 4UUTA 1HCRA 4FE7A 2DA2A 4IHXA 4BY7J 1RETA 4A3DJ 4JP0A 2DA7A 4D5CA 4XIDA 2XRLA 3G1OA 2E2JJ 5JLWA 1TWGJ 4X1EA 4DYCA 1U78A 3HGGA 2IAIA 1D5YA 5IOYA 1SFOJ 1YRNA 2JN6A 3HOZJ 1JUPA 2LR8A 2Y31A 3BG9A 3F0CA 5F0CA 5FKMA 4JX5A 1IJWC 1MSFC 4MIMA 3TP0A 3WHCA 4J19A 3I4MJ 1Z0XA 4MFEA 3JREA 2O9LA 3S16J 1JGGA 3D1NI 1U8BA 9ANTA 4RBOA 1IV6A 1R9TJ 2WB1N 5M3MJ 1VF9A 4DYQA 1JJ8C 1MBEA 3I4NJ 3TEDA 1TWFJ 3BQYA 1JUMA 2FJ1A 2COBA 4UUSB 2CU7A 1MBJA 2QCOA 4JX6A 1ETYA 3PO3J 3NAUA 3DCFA 3UKGA 1T33A 1JT6A 1JTXA 5K7ZA 2DTZA 4DZJA 3LSRA 3C2BA 1U9OA 2L0KA 3RKQA 2VI6A 1FEXA 2HOSA 1XC5A 1MBHA 1UMQA 3GTQJ 2R5ZB 3K2AA 1ZQ3P 2RAEA 3GTOJ 2N8GA 2M2EA 1UG2A 4ABZA 4HNVA 3BTLA 3S14J 1GVDA 1VI0A 2R5ZA 3CDLA 2R0QC 1BL0A 3IH3A 3BR2A 4C3HJ 5M3FJ 2O8KA 1AKHB 2CQXA 3A01B 4IHWA 2W48A 1JKOC 5J3LA 1TWHJ 3LOCA 5IP9J 2JA7J 2DMPA 3ZQIA 2Y9YA 3IH4A 4EEFG 3S1QJ 2R5YB 3HOUJ 1HOMA 3MN2A 1OCPA 1GV2A 4G12A 1U9NA 3A02A 1E3OC 1ETWA 5J1UA 2Y0SN 1MBKA 5FKLA 4V2FA 1H89C 1VNDA 1VFCA 1MBGA 3M4OJ 3GBGA 3BR3A 2NVXJ 3FK7A 4A3GJ 5C4XJ 3G1MA 4I76A 1RKTA 4AUXA 1O4XA 4D7NA 2ELKA 1ZGWA 1X58A 2LKXA 1JKRC 4BBSJ 5EYRA 1TWCJ 2DMQA 1XS9A 2JA6J 1EF4A 3JRGA 1I50J 2DMUA 5IOZA 3VPRA 1XG1A 2I10A 2AO9A 1GT0C 4LOCA 2XGCA 5FLVA 2X6OA 2ECBA 1YRNB 3HOYJ 2CUEA 1A5JA 2NVQJ 2XPWA 1NK3P 1PUFA 3OOUA 5FJ8J 3S1NJ 2XPVA 3H0GJ 3RZOJ 2IBDA 5F0HA 4FISA 1FIAA 5M5XJ 4IHYA 2GBYA 2R93J 3S2HJ 3SFIA 1ITYA 3H3VK 4A93J 5F08A 5M5WJ 2VKVA 3GTLJ 2LTPA 1JT0A 4A3MJ 2GM4A 2LFBA 2XGEA 3ZQFA 4A69C 4QSHA 2GLOA 3Q3SA 1BW6A 2HXOA 4XICA 4A3EJ 2NOGA 1SANA 4MLOA 1IC8A 2XB0X 5FKNA 3LNQA 2K9NA 2NVYJ 4B3AA 2YUSA 3BTJA 1NTCA 1I3QJ 2Y30A 1WCMJ 5DS9A 2MSYA 2H1KA 1LFBA 4W97A 1W0UA 2DA1A 4RDUA 2HOTA 2HQ5A 2ID3A 2MGQA 1ENHA 2M34A 1B8IA 3GTGJ 3BR0A 2ECCA 3GTPJ 3MVPA 3HGYA 3MKLA 3K7AJ 4BXXJ 4JYKA 5FLMJ 3B6AA 4A3JJ 2DA6A 1QVUA 3JRBA 1BJZA 3QPLA 3TW6A 2LD5A 1IDZA 3LSGA 1Y1VJ 3BR5A 3Q0WA 2M9HA 2YU9J 3S1RJ 3W6VA 4DYRA 4CYCA 3S15J 1TWAJ 2FD5A 1FIPA 2TCTA 2ME0A 2MG4A 3HOXJ 1HLVA 3BQZA 4M6VA 3JRIA 2DN0A 4AC0A 2XB5A 1I6HJ 5JLXA 4FE4A 1POGA 5GP9A 3ZOBA 1MSEC 5E3MA 1MNMC 3HEFA 3JRHA 2LY9A 3HOVJ 2VUMJ 2D5VA 2OF7A 3HOWJ 4B1RA 2JWTA 1T56A 3A03A 3O8HA 1ORKA 5F1JA 1IDYA 5EG0A 3ZQGA 5J1YA 4BBRJ 3CCYA 3RZDJ 2EZIA 1H8AC 2WAQN 1K61A 4C3JJ 4JX4A 2HXIA 1Y1WJ 2R7ZJ 3S1MJ 1GV5A 1PUFB 3FISA 5J1RA 2NS8A 1DU6A 3BG5A 4C3IJ 1ETOA 1ZTRA 3IV5A 2EZLA 3E7LA 4GFBA 1NK2P 1IUFA 2M0CA 3ZQHA 2VPRA 1BW5A 2H8RA 2XPUA 4XK4A 2EZHA 4A3LJ 2K40A 5EZHA 2VKEA 1B72A 2DA3A 2JA8J 1F43A 1F36A 2Y2ZA 1QVTA 3GTMJ 5EF6A 3BT9A 2X9DA 1MBFA 1X2MA 4A3FJ 1ETQA 2FX0A 2ME6A 3HDDA 5IYCJ 3NARA 1ZR2A 1S7EA 5IYDJ 4M3DA 2HI3A 1K83J 5FKOA 1WI3A 1RESA 4M3EA 3IH2A 1RR7A 1MH4A 2CUFA 5IP7J 3HM5A 5DTDA 1Q1VA 1FTTA 3JRAA 4A3BJ 2R92J 2CRGA 1AU7A 1ETVA 3M3YJ 1B8IB 1JKQC 3JR9A 3G1LA 3CQZJ 5F27A 3B6CA 2HOAA 1ZR4A 2OPTA 1OCTC 1WGXA 2LP0A 1RKWA 4M3GA 3GTJJ 1OFCX 1P7JA 4XRSG 5EGOA 5M5YJ 1JTYA 5K7HA 3BG3A 1FJLA 4DZPA 1P7IA 1LE8A 3LSJA 1HF0A 4D5FA 1ETKA 5BNGA 2DJNA 4CYCB 2L9RA 1ETXA 2EZKA 4B4CA 3QQAA 3DEWA 1QRYA 3JRFA 1Z77A 1X2NA 4A3KJ 3TP3A 1JJ6C 4A3IJ 2B63J 2LVSA 2AHQA 3OSGA 1WH5A 3S17J 1ZK8A 2ZB9A 3HKZN 1G2HA 4L5EA 5K7FA 4XRSA 2QF7A 5GPCA 1AHDP 5F04A 3ZQCA 2NS7A 2JA5J 5E3LA 2G0EA 4DW6A 2EQRA 3BTCA 2HDDA 2JMWA 5EDNA 3HB9A 4Y7NJ 1WPKA 3O8GA 2L7ZA 3OIOA 5IP6A 5IPAA 2LK2A 4FCYA 1QPIA 4Y52J 4XRMA 1MH3A 5EG0B 3Q0UA 2DA5A 2E19A 2P81A 2YS9A 3Q0VA 3BR6A 2DMNA 1OJLA 2IEKA 4MO7A 3GTKJ 2O7OA 1LFUP 2EBIA 3PM1A 4I6ZA 1GDTA 2E2IJ 4BY1J 3SDGA 1GUUA 2JJ7A 3WHBA 5EEAA 4QTRA 1IG7A 2NVTJ 1DU0A 2LLKA 1JUSA 2L7FP 1TC3C 2ID6A 2CJJA 4D7MA 5E3OA 4V2GA 1B72B 2JK3A 3TW7A 5IYBJ 3PO2J 1UHSA 2WV1A 2DMTA 4W1UA 4UUSA 2KT0A 2E2HJ 1IGNA 4IEJA 1FTZA 2K9QA 5GPAA 1WH7A 4NDLA 4IHVA 1CQTA 1RPWA 4MFDA 2KDZA 5HODA 5FKKA 2DA4A 2TRTA 1ZKGA 1HDDC 1HDPA 3CMYA 3FK6A 4FTHA 1IRZA 2HYJA 5F0FA 3QPSA 5C4JJ 4X6AJ 2L7MP
chains in the Genus database with same CATH superfamily
3G71I 4LIUA 1XMKA 5E3NA 3EUHA 3ZQLA 5FRNA 2HNHA 2XGDA 3L2CA 1BJAA 3R0JA 3OR1C 3RQIA 3OSFA 1FX7A 1BI2A 4OAZA 4OU0A 5E1XA 1AKHA 4JBAA 1OYIA 3HBLA 1UCRA 3FKIJ 4NNJA 5TRDA 2CQQA 4XKVA 1BA5A 2XGXA 3H5NA 3SYTA 5C44J 2K9SA 1A6IA 4BKXA 2LF8A 3SJMA 3GZNB 3I71A 3QPTA 4BUPA 3ASOH 4HDVA 3JRCA 4ZDLA 2OD5A 1O3QA 3QOPA 2BY3A 1MMDA 2VQCA 3ONQA 2Q0OA 1ZLKA 3FIWA 3GMEA 1G6NA 1LQ1A 3ZXSA 3N05A 2WTEA 2CW0F 4F93B 3VB2A 1FSEA 4E7LA 1Y6IA 4FE7A 2DA2A 2DPUA 4NB5A 4PFPA 2EIKH 1JXSA 1J0RA 2BEOA 4OAYA 4A3DJ 3GEZA 4XIDA 1LNWA 1SAUA 2E2JJ 2QYOA 1XMXA 3CUOA 2JN6A 3J7YJ 4PGGA 4KA4A 1TP4A 4BEHA 4XMYA 2K5CA 3MAJA 1BC7C 3BG9A 4QWQA 3LA3A 1R5GA 3FMSA 5FKMA 1BI3A 2B9SA 1T6SA 4JX5A 1IJWC 4NHJA 3K1MA 1RR8C 2DK5A 3WHCA 1LVKA 2ZJ2A 5CVIA 1FNNA 4BL0B 3HZJA 1Z0XA 4MEXF 1FOWA 3LA7A 2BVLA 1R71A 1FYKA 1U5TB 9ANTA 2JVGA 3T8RA 2RQPA 2WAQA 3DTKA 4RBOA 2WB1N 3RTRA 2FRHA 4DYQA 3HC7A 1U3EM 2W4SA 4EJOA 2ZNZA 4HNUA 4MQ9F 4UUSB 4HSTA 2E7XA 1MDMA 2CU7A 2QCOA 4UNOA 1MJAA 5JVGF 4XLNF 4ENKA 1U6GA 1ETYA 4CO8A 5DYMA 1ONVA 2KJBA 2L9NA 3NAUA 4WXHA 4PUSA 4ZTFA 2XF6A 3DLLF 1JTXA 1IZ1A 2A07F 4DZJA 3DPLC 1U9OA 2BYVE 3I4PA 4I09A 2LF7A 4F3QA 1P4AA 2HOSA 1XC5A 1O7LA 3GVAA 2GOXB 3E6MA 2MABA 1PP7U 3G73A 1MD0A 2IPQX 4YRVA 1ZQ3P 5DM6F 2MA3A 4ENNA 4BHPA 4RS8A 1MNDA 3QYFA 1VQOI 3ERED 2W85A 3BTLA 2R0QC 3BR2A 3WE2A 4C3HJ 1K6OA 5DCMA 2CQXA 4E4HA 2DAOA 5J3LA 2CS3A 1NH3A 3LOCA 1XSDA 2PFBA 5D4SA 2JA7J 3VWBA 5DD8A 3HOUJ 1OCPA 1XSXA 4G12A 3ABTA 3REOA 1ZRFA 3EETA 4V2FA 2VIXA 3VOEA 3I59A 1VFCA 1WHUA 1HKQA 1Z3YA 1OCRH 1HW2A 2RREA 1ON2A 3G1MA 4PCQA 4I76A 1P4XA 3G4SI 2M45A 1ZGWA 5IT9Z 4M74A 1QO0D 1XS9A 2DMQA 2FNPA 1QPMA 4L9NA 1JHFA 4BXUA 3MKYB 1XG1A 1X3UA 2I10A 2Y69H 3BP8A 2PJPA 4E7IA 3HOYJ 1A5JA 2CUEA 4BDZA 1WJFA 4EQQA 1HC8A 3WGGA 4ZYAA 4U0YA 5CQGA 3RZOJ 2A3SA 5F0HA 4ZH4F 2ICWG 3HSRA 1FIAA 2V79A 2R93J 2GBYA 4GGGA 1A36A 5M5WJ 2A68F 1D3YA 3OYDA 2XV4S 3GTLJ 2LG4A 4GDFA 3F6VA 4II3A 4RAGA 5IT9K 3OYGA 2VOOA 4N9HA 1KQ0A 2ZKZA 4QSHA 4Y13A 5DDGA 3AG3H 4GO1A 1IC8A 4II2A 5D4RA 3QU3A 1G4DA 1R5ID 4G6DA 2XB0X 5FKNA 3LNQA 4EATA 4DIQA 1WI9A 4B3AA 1NTCA 2D1VA 4YFXF 2R7SA 1OLTA 2L54A 1HQCA 2W1OA 3D0SA 1N77A 4W97A 3CTAA 1RIOH 1EH6A 4UUVA 2HOTA 1BI0A 2ID3A 1UZCA 1CF7B 2A05A 3BZKA 4RGUA 5J47A 1DP7P 2K27A 3HGYA 3PIOF 4HF1A 4BQQA 4F7ZA 3S32A 3DU6A 3K7AJ 2E1MC 2DA6A 1QVUA 5J40A 2F5EA 2L9VA 2LD5A 1XDSA 3LSGA 3VYSB 3DBLB 1E3PA 2PBIA 4G7OF 3A0BC 2OQGA 3BPVA 4CYCA 2LSOA 1TWAJ 4Q48A 2TCTA 4GRIA 2O6GE 3PNTA 4M6VA 3P9IA 3SZPA 1KONA 4YIRX 5ICEA 2CSOA 5L3EA 4AC0A 4ASNA 3MQ0A 1W7PA 4HLXA 4CA0A 3KFWX 3PFYA 1POGA 2AS5F 3LSKA 4OWRB 3K4CA 3HEFA 1IUYA 2W84A 3OL3A 4XR6A 3KPHA 3SZTA 1R4MB 1BI1A 2DOAA 3MKZA 2OF7A 2QKLB 1XD7A 2JWTA 1FOYA 2DI3A 1W36C 3WTZA 2LYCA 1ZREA 1T2KA 1B59A 1H9TA 1IDYA 2P6SA 3ZQGA 5J1YA 3T5XA 4XSXF 4AYBA 2Z3YA 2KZVA 1WJCA 1FC3A 4AU7A 1Y1WJ 4BE1A 1HBXG 3CC7I 2FNAA 1PUFB 2X6XA 4FHTA 4EJWA 5KHDA 1ETOA 3IV5A 4E7JA 4P9UA 1YJWI 2XUBA 4GFBA 1NK2P 4BH9A 3OS1A 2NS0A 1E2XA 3H36A 2RGVA 2LKPA 2Y48A 1BW5A 2XPUA 1XCBA 2DFEA 3PUBA 2BV6A 2F5VA 1OYWA 5EZHA 3PNYA 1B72A 1F36A 1NG6A 3H3ZA 3ZMZA 1T98A 2NXNB 2K86A 3I0TA 1HA8A 3GTMJ 5ED4A 1MKMA 3DKXA 1ETQA 1XGMA 2DO7A 3FMQA 1ZR2A 1S7EA 2IXSA 2X6YA 3H5RA 2Q1ZB 5KAFC 5HNHA 1K83J 1XDUA 3E6DA 4XOPA 2YX7A 3NQOA 1RESA 4S05A 2PJRB 1LDKB 1LUJB 5GAHJ 3E1SA 2R7TA 5DTDA 1XB4A 4P1WA 2HEOA 2V9VA 2FU4A 5D6EA 4R79A 2CRGA 4CH7A 2BOLA 1ETVA 2HKXA 4YG2F 3DTEA 5LEKA 1S7OA 3JR9A 2RVCA 5CVRA 5CQEA 3FDYA 2RNGA 1OCTC 3KP4A 1WGXA 4LG0A 3GTJJ 4XKCA 3V7CA 3IL2A 2V9PA 5EGOA 4OIOF 3AL0B 4HQEA 3P9CA 4M71A 5K7HA 3BG3A 4XNFA 3GO5A 4XORA 3HPHA 1YQAA 2V26A 3EYYA 1YX5A 3TO6A 1IRFA 1HF0A 4B3XA 3ESWB 3A0HC 4BGDA 5H6RA 4B4CA 1P6RA 1QRYA 1Z77A 4HF0A 3S3MA 2OCCH 1EV7A 1JJ6C 4QPQA 4LK0F 3OSGA 1WH5A 2V4JC 2L4AA 4UY8I 3GWZA 5GPCA 3ECOA 3LL7A 4BQOA 2DOFA 3WG7H 3UNGC 4MGRA 5L3FA 4IL6C 1J09A 1AHDP 3K4LA 2NS7A 4IPAA 4BU2A 3PJRA 4NC7A 4UB6C 5FFZA 2EQRA 1D1CA 2M3AA 3AFHA 2DJIA 1V3FA 3HB9A 4IOCF 5IP6A 5IPAA 2Y0SA 1UHWA 2RKHA 1MH3A 4BE2A 2QSFX 3Q0UA 4CDGA 4E7KA 2E19A 3FXUA 2PG4A 2YS9A 3K4JA 3Q0VA 2F4MB 2DMNA 4MO7A 3F72A 4HG2A 3PUFA 3CMEI 3TDZC 2JSPA 3HXLA 2EA4A 3RPUA 4KN4X 3F21A 2Y75A 2ZXHA 4HQMA 1GDTA 2YSRA 1GUUA 1Z6TA 3DV8A 3LQQA 2JJ7A 4HW0A 1BN5A 1BR4A 1QU3A 3IRRA 4XBFA 2NVTJ 1T38A 3CF2A 4KYWA 4A12A 4EM0B 2L7FP 1YTYA 2CJJA 2NAZA 3HSEA 4V2GA 2Q8KA 1HSTA 1OCCH 1IAWA 1UHSA 5L3GA 2WV1A 2DMTA 2DDBA 4G9YA 3DFGA 2J5OA 2DQLA 3MD2A 4W1UA 3M07A 2KT0A 2E2HJ 3KEQA 4HYEA 3KZZA 4IEJA 2M8EA 1OCZH 3FM3A 3ROUA 3N4MA 5CVUA 5FO5A 5GPAA 3R6SA 3CD6I 3IAM2 2G7HA 1YW9A 1P2FA 3F8CA 2HDWA 2VLAA 2MC4A 1HDDC 1I1SA 2BW3A 3FK6A 2PMHA 4HDUA 2E71A 1TNSA 3COAC 2R5ZA 1KU2A 5K5OA 2BY2A 1AA7A 3RDIA 4KT5C 4RGSA 4AM3A 4AWXB 3QPHA 4M3BA 2XSDC 2C6YA 4IJAA 1BIBA 1YS7A 1J9IA 3A2KA 3M8EA 4A3CJ 1TZLA 5IT3A 2M8GX 1APLC 1HSJA 2EV6A 5F6FA 3CUQB 4BJ6C 5J4VA 2DTRA 1W0TA 3I64A 4C2MJ 4Y4RA 4M3FA 2R5YA 3C3WA 1LE8B 4I02A 3WTXC 3PSIA 3ZMTA 3C2GA 1X3ZB 2HQRA 3ABLH 2ELHA 4HV5A 4JOMA 3KP7A 3OYNA 3OS2A 3JRDA 1K79A 1HW1A 2XRNA 3CCUI 4S0HB 1DGWY 2HQNA 1JKPC 4Y17A 3S2DJ 1PVEA 1VQ7I 4NQWA 2XAUA 2LMDA 1ERDA 2O8XA 1RETA 3C1DA 1W5CC 2F4OB 5CJ9A 3VEPA 5BMZA 2P5KA 1EH7A 2STWA 1OISA 3G1OA 1KU9A 5JLWA 2R7XA 2ZNYA 4X1EA 4DYCA 1U78A 3MWMA 1D5YA 2IAIA 4U7BA 5IOYA 3CCRI 3DLAA 4P55A 3MZHA 3AKZA 3CC2I 2E60A 1UFMA 4XLCA 4UV8A 4R1HA 5FRMA 3VDXA 1MDMB 2DYSH 3F0CA 5F0CA 1XX5A 2IGNA 2ZJPF 3QP6A 3EQLF 4MIMA 1C0WA 2VBXA 4WX9A 3I4MJ 4XOTA 2GA2A 3FXJA 4MFEA 4ZYHA 1O3RA 2H6BA 3VSLA 4L9VA 2OTLI 2UWMA 1G59A 3F9KA 1JGGA 3E97A 1IV6A 4EGZA 2DT6A 3TO7A 4UXNA 2LDUA 1VF9A 5M3MJ 1FBSA 3W3CA 1JJ8C 3D5LA 1WJ5A 2FJ1A 4M6XA 4A6EA 2ZSHB 5HDNA 4A5MA 1YJ9I 2IA0A 2WY7Q 5DEQA 5H2FC 2QM3A 2ETHA 1JT6A 5HS7A 5K7ZA 4CCKA 5LD2C 2DK8A 2M0MA 1WRJA 1YW8A 4E7ZA 3J81Z 4I01A 3RQ4A 2IJLA 3RKQA 2VI6A 3HOSA 3Q5FA 4A0XA 1MBHA 5HOOA 1G3WA 4UHTA 2NVUB 1WZ2A 3DEEA 1ACIA 1G3SA 3NEUA 4Z6YA 3GX4X 2HPMA 2RAEA 3MMYB 2L02A 2N8GA 1UG2A 1IF1A 2QZ8A 3S93A 4WXCA 5LHHA 4PJMA 1TQPA 1VI0A 4IRGA 2HOEA 4HX8A 1BL0A 3IH3A 5M3FJ 3T1BA 4F55A 3A01B 4BHCA 3ABMH 4IHWA 4A5NA 1RI7A 1TWHJ 1TL8A 5IP9J 3DKYA 2DMPA 2MYSA 3TL4X 4LD5A 5KNLA 3CCQI 1KQ8A 3KEOA 3A02A 1E3OC 4L18B 1ETWA 1SC7A 3K4KA 1LB2A 2QGUA 2P5LC 2COMA 3J81K 2D45A 5HS8A 3CF5F 2EFOA 2H8WA 3KZIC 5CVJA 1K4TA 2NVXJ 1W7PD 4YFKF 1UAAA 3OMYA 3ZMUA 4AUXA 4G6TB 4D7NA 1LDDA 4MQVA 1U5TC 1FMVA 3HHGA 1X58A 1Q1HA 2LKXA 3KCCA 2KIUA 1TWCJ 5EYRA 1HXDA 4I0AA 2JA6J 2KRFA 4B47A 1I50J 2DMUA 3OYMA 3JSOA 3BY6A 1V5FA 2JPCA 5JVTA 3DKWA 1GT0C 1ODDA 3WGHA 3FMRA 4LOCA 2X6OA 4EGYA 1YRNB 4HV6A 2FEZA 3KZYA 2NVQJ 3IHUA 1BOAA 5D8KB 6PAXA 3S1NJ 2XPVA 2LNBA 2A69F 5E1WA 3CMAI 1PUEE 4PSWA 2G9WA 3CO6C 1J59A 2DFIA 2OV7A 5D6FA 4Z2YA 1DUXC 3EDPA 5F08A 3E3VA 1MNEA 4ESBA 3VYUB 1IN7A 2FOWA 1IN4A 2VKVA 2XAJA 3KIOA 2QVOA 4QPOA 1A31A 1HKTA 4BAYA 2GM4A 3IKVA 2LBFB 4P5OA 4LFUA 1FWZA 3RSNA 3W6KB 2OTJI 4I0BA 4XICA 4A3EJ 1VQKI 2ZBKA 5CLSA 5K5QA 1SVLA 1QHGA 1U2WA 3D5RC 4OIPF 3P9KA 4M72A 2K9NA 2NVYJ 2YUSA 2FSWA 2AQEA 4M9ZA 3TGNA 2Y30A 2RN7A 3F22A 3GFMA 2CQNA 1ZLJA 4CCNA 2PQ8A 1MIJA 1W0UA 4OOIA 4RDUA 2G7UA 1NHAA 5D5XB 5E1ZB 4L9JA 2MGQA 2VPLA 1DP3A 4EM1A 3WGIA 2EFQA 1W1WE 3QU6A 1B8IA 3P7NA 2MH2A 3GTPJ 1B9NA 3GFJA 4N9IA 1R58A 1SD5A 4HX4A 2FBHA 1K4SA 2HR3A 3I58A 4CZZA 3ISPA 2PX9A 4XKWA 4AIHA 4CCJA 3TW6A 2PMUA 1S9HA 1REPC 3S3NA 3E6CC 1Z7UA 2FA5A 2UV1A 1R7JA 3KYLA 3VODA 3H3UA 3W6VA 1OCOH 3NWSA 2H27A 3S17J 1EH8A 2FD5A 3LA2A 4ZJZA 2EPFA 2MG4A 3IUOA 3V8JA 1N78A 1LDJA 1R00A 2QUFA 2HZDA 4O3MA 3F23A 2LY2A 2JA2A 5AIQA 1ZN2A 4FE4A 3BOQA 3BROA 3ZOBA 4P96A 3I3LA 5E3MA 1R1UA 2QQBA 2Z5UA 3JRHA 1MSEC 2GIVA 4DNCA 2IP2A 1SMYF 3DXJF 4IF4A 2P4WA 3HOVJ 3AG4H 2D5VA 4KUMA 1YS6A 1A35A 1S6LA 1YG2A 2GZWA 3ABKH 3CLQA 3MKWB 3A03A 4DJAA 2EWNA 3CO7C 2VC0A 4XN3A 2EV0A 4KMFA 2OQRA 2HFHA 5EG0A 3LFKA 4L5IA 1H8AC 1K61A 3E5XA 4C3JJ 3R61A 4LIVA 5HDGA 1WJEA 2R7ZJ 5KCMA 1MJ9A 1UJ8A 4ENJA 5E17F 2XKOA 3MEXA 4Q47A 2O0YA 4C30A 2EZLA 3E7LA 3RPUD 4N0BA 2JRMA 3LSTA 2MLGA 3K4NA 5L3BA 3L00A 3BPXA 1IUFA 4HOBA 2QBYB 3FHNA 4ZDPA 1U0JA 1XSVA 2EZHA 5CKTA 1X4OA 3IC7A 4M73A 4A3LJ 3RPQA 3L9FA 2JA8J 2DA3A 1IN5A 4CGZA 2Y2ZA 4F91B 1FOXA 2FX0A 4WXDA 1WJDA 2CV0A 3HDDA 1FZPB 2QWWA 5IYDJ 1R1VA 1FLIA 1WI3A 4EJTA 3V8LA 1XCVA 2HVSA 4M3EA 3SXYA 3H9JA 2IVMA 1S72I 5IP7J 1FSHA 2IA2A 5LFAA 2QLZA 3HG9A 3KLOA 1FTTA 2WB1A 1SEUA 4A3BJ 4L5JA 4C2TA 3FZVA 4TV7A 2BGCA 3M3YJ 3OS0A 3HRTA 1BR2A 1I3AA 5ICCA 1JKQC 4IHTA 3FF5A 3M1EA 4FX0A 3GFIA 5F27A 3B6CA 1ZR4A 1TT0A 3EPZA 2OPTA 3IKTA 3DU5A 2KPMA 1UB9A 4M6YA 3BCBA 1P7JA 2XF7A 3F6OA 2VKDA 3KP2A 3IWZA 2A5WA 1CGPA 1V54H 1FYLA 1LKXA 3I5UA 5DM7F 2DQRA 3ABUA 3HL2A 2XAGA 2L9RA 1ETXA 2AQFA 3BG6A 3DEWA 1Z3XA 4RGXA 3TQNA 5B66C 2LC2A 1OR7C 1X2NA 1TW2A 3TP3A 2B63J 4PGHA 5J6XA 2LREA 2AHQA 1K78B 1F1ZA 5B1BH 1S29A 1ZK8A 2F48A 1G8XA 1SD4A 3H35A 3HKZN 3ZGKA 3CZ6A 1Y39A 3L7WA 1ZGAA 4L5EA 2JPBA 3ZN1A 3QYBA 3CLOA 1KA8A 2ACJA 1IXSB 1KZHA 2JA5J 4ESJA 2IS4A 3LSIA 3WTTC 1T0FA 3RCOA 4LLGF 2MH9A 4Y7NJ 1WPKA 2L7ZA 4FCYA 2E5NA 2LK2A 2O5RA 4Y52J 4XRMA 5KAIC 3C18A 2P81A 1JE8A 2B7EA 2UXNA 4AIKA 3BR6A 2R3SA 2WAEA 2VXDA 4XL9A 1ZAOA 1W5SA 4Y3OA 5JHUA 1LFUP 3GLXA 2DCEA 2E2IJ 1ZG1A 3GYHX 5AONA 3WHBA 2M4GA 3HTUA 3V7RA 4ZDOA 2WBMA 3QRFF 3S2WA 2AXTC 2RNJA 2Q2EA 4ZYDA 2HTSA 1F4KA 2F5DA 2MFZA 1U5TA 2ZJQF 2Z2SB 2VBZA 2JK3A 3TW7A 5IYBJ 2VODA 5J8FA 4B44A 1Z9CA 1W36D 2MC3A 5KK1A 4UUSA 3AL0C 3FXQA 5TJJA 4D1QA 4XONA 3V8KA 2M4KA 2K9QA 2DOEA 5FFXA 3N97A 2K4BA 1VTNC 3Q9SA 1CQTA 4OMYA 3R0AA 4MFDA 2W25A 1R23A 2TRTA 3PFIA 1ZKGA 1IN6A 3QYEA 2X0LA 1QZEA 2K9MA 1HDPA 3CMYA 2HWVA 1VQ5I 3OYBA 1X1PA 2P7VB 5C4JJ 2QA4I 4X6AJ 2L7MP 4GYGA 3KYCB 5BQTA 1H88C 3LSHA 5FB2A 3E5UA 4IHSA 1SFEA 5GTIC 3GZ6A 3CC4I 4RAYA 5GADJ 2QQ9A 1WSUA 2OAZA 2V1NA 2JVHA 1T39A 2X1DA 2E1OA 1AWCA 2X48A 3QP5A 1VQ6I 1BBYA 2CMPA 5EEHA 5LHGA 4KN7X 2KLOA 2V1XA 2EFWA 4FQGA 2XIGA 4IKFA 1Y56A 2ZCWA 3U2RA 1IO2A 2ZXIA 3L2UA 1WQ2A 4MTEA 1MMGA 3HYIA 2OA4A 2VJ5A 3E6BA 1ULYA 3GF2A 4RB0A 5C3EJ 3ZMSA 1D0XA 5F1RA 2X85A 4HSRA 3G6EI 2PMZN 4V19K 3SDBA 4J00A 1H0MA 4UUTA 1F9NA 3GUDA 3IRQA 4IHXA 1XGNA 4BY7J 2ZMEB 2XAFA 2DA7A 4IVNA 2Z1DA 5FD5A 4BXFA 1XPXA 4CYDA 3QAHA 1DPRA 3EUKL 1GVJA 2VJIA 3W2AA 5HVQC 4NBQA 1WWXA 2DXIA 2HZTA 3HGGA 4AVZA 3HHHA 2CV1A 2D1HA 3HOZJ 1JUPA 4A0ZA 2LR8A 2W00A 5HLTA 2KKOA 2Y31A 4ESFA 2L7KA 4B09A 4YELA 3M8FA 3OYEA 3PQKA 3K4MA 1MSFC 1MMAA 3CP2A 3FM5A 3WU0A 4J19A 5LRRA 3W2VA 1USSA 4HA8A 4EJVA 2H1LA 1DGRM 2F6CA 1KU3A 4XLEA 3JREA 2K7LA 2V6EA 3S16J 3D1NI 3KLNA 4K2EA 3WTVC 4CCOA 2Y0MA 5HNFA 2L01A 4UVCA 2K4JA 2VC1A 3K70C 2EIMH 3QODA 2GQQA 3V42A 2KIFA 1SFKA 3CUQC 4JX6A 4BYYA 2YPRA 3AG2H 3K2ZA 1YFHA 3PO3J 1RUOA 3K10A 3DCFA 3UKGA 1IRGA 5H20A 1T33A 2HGCA 3DF8A 3S3OA 3RYPA 2HVQA 4RAFA 3C2BA 2LH9A 2E1CA 1BOBA 1TT5B 1HKSA 2L0KA 5DUIA 1USTA 1CF7A 4HAMA 3MCZA 1FEXA 1XGSA 5LGTA 1UMQA 1R1TA 1V55H 5D8LB 3K2AA 2CQ7A 1IXCA 1DQUA 5AIPA 2QQAA 3GTOJ 4E7HA 3ZQQA 4YIFA 1UHMA 4HNVA 4UVAA 2IS6A 3S14J 1T95A 3CDLA 1D1BA 2JQ7A 2O8KA 1D8JA 1AKHB 1OKRA 1LVAA 2BVMA 4KMUX 4PDKA 1JKOC 4LGWA 2OUMA 4BQNA 3ZQIA 2Y9YA 4EEFG 3S1QJ 2EINH 3VFZA 3MN2A 1GV2A 5E18F 4IXAA 3OYFA 1U9NA 2IW5A 2HVRA 2KL4A 2VOPA 2HQAA 5J1UA 1MJBA 3BG7A 5FKLA 1H89C 2XC7A 1FOKA 2KRHA 3BR3A 1B9MA 3FK7A 4ENMA 2E5ZA 4KT6A 1RKTA 1O4XA 2M30A 2M87A 2EA2A 2VJJA 1KYWA 2ELKA 1YE9A 4WCGA 4EMSA 1EF4A 2LY1A 3CP8A 1Z1DA 3A4CA 3PNVA 4RM2A 3JRGA 4I7HA 2WA0A 3BJAA 3VPRA 3GLLA 2GOMA 4IZZA 4S04A 4H4KC 2AO9A 1S5LC 3ZCOA 2KISA 1QHHD 2NOJB 5KVRA 3H0DA 4BEHB 3T0YA 5IY5H 2XPWA 4OIRF 1PUFA 1N75A 3M7GA 5FJ8J 5LRSA 3B02A 1N25A 1XGOA 2GAUA 1OR7A 3H0GJ 3E0JB 4E70A 4P9FA 1IV8A 2CV2A 3BWGA 3KX2A 3U1DA 3ASNH 4IHYA 4LG3A 3CCVI 1Z6RA 5TISC 5JR3A 2VT3A 3HUGA 2X1CA 1WVRA 1R49A 1FYMA 2XSJC 1TLHB 1JT0A 4FX4A 1QZZA 3DWLE 2VE8A 3KP6A 1Y8QB 2ADUA 2GLOA 1BW6A 1ZYRF 2HXOA 3Q3SA 2NOGA 2XROA 1SANA 2O61A 4FT8A 5FD6A 4PJ0C 2A6EF 4BDYA 5ICFA 4BACA 2ZO4A 1U8RA 3BTJA 1QNTA 2FF4A 1I3QJ 3X2QH 4AIJA 2PJRA 1T8IA 3J7AO 4XN0A 5EJCA 1WCMJ 4ZC3A 1LFBA 3OL4A 2M1BA 1R36A 3BC8A 2WAFA 2ESNA 2R7FA 2M34A 4HF2A 1RC9A 1WJBA 4U0VA 3OYCA 2LRDA 3GTGJ 1Z7LA 3F3XA 2JUCA 1X3WB 2LOOA 3MVPA 1YX3A 1ZHFA 3JAMZ 4BXXJ 3WG9A 5FLMJ 3B6AA 3JRBA 4PZJA 5E8IA 1BM9A 5GAGJ 5DCMB 4X0GA 1IDZA 2Z9OA 3BR5A 1J75A 3Q0WA 2M9HA 2YU9J 2GXBA 2HTJA 3S15J 1YI2I 1FIPA 4NC6A 2ISZA 3RKWA 2BE5F 4WF2A 3LSMA 1HLVA 1YIOA 3CCLI 4NUBA 2W82A 2ZFWA 4BE0A 3I59B 1WFXA 5K5RA 2XB5A 4MHGA 2XVCA 4UVBA 3RJPA 4IRHA 3MZYA 2K3PA 4EV0A 1T08B 3V7SA 4ZTJA 2LY9A 2XHKA 2BHZA 3R4KA 3HOWJ 4B1RA 4KICA 1KYZA 1G3YA 3K69A 3O8HA 5HDKA 3JAMK 2VONA 4CICA 2KDOA 1RUNA 1ORKA 3TKYA 1B6AA 4NC8A 4PFOA 2VXZA 1FT9A 3ZRGA 2RQQA 3FBNB 1SVOA 1RNLA 5DUKA 4BBRJ 3CCYA 2EZIA 2WAQN 4HX7A 2CFOA 4XRFA 1PP8F 4RAZA 3OYKA 2HXIA 3S1MJ 1GV5A 3FISA 2DBBA 5J1RA 2NS8A 1DU6A 3BG5A 3ZR8X 2KHMA 3CJQB 3BZCA 1WKMA 5DCFA 1V5EA 2E7WA 2ELJA 1QQIA 4FASD 3DEUA 1P92A 3ZQHA 2VQGA 2RDPA 2VPRA 2PLYA 5FGMA 4A2UA 2A6TA 1QZYA 1P4WA 2VKEA 2KJCA 1XN7A 3PIPF 1F43A 1LEAA 1ZG3A 1QVTA 4PJJA 4CCMA 2ME6A 3S8PA 3NARA 3SHFA 1W5TA 1KGSA 2F5FA 1SMTA 4A0YA 3SFZA 5E79C 3F8NA 5FKOA 2FBKA 3K9TA 3RIRA 2NRAC 1R5HA 1AOYA 2H6CA 4UV9A 1OMIA 1XMAA 3IH2A 4B48A 3OYAA 1Z21A 3HM5A 1ZELA 3CJNA 2ISYA 3ECHA 5DV5A 4PSXA 2V1UA 3K1PA 4HRIA 2PI0A 4KJZA 5BPDA 1R4NB 2L4MA 4I98B 1O3TA 1BC8C 1FPQA 1B1BA 4XLPF 4EJUA 1Y0NA 1YLFA 2EV5A 2IT0A 2FUG2 3CQZJ 2CG4A 1D5VA 1WJAA 2HOAA 2V1DA 5HLHA 2PEXA 4RMNA 2VB6A 2V7FA 3A1YA 4Q4ZF 3CMMA 3BCAA 1RKWA 4M3GA 1OFCX 3I53A 4XRSG 2RV8A 5M5YJ 3CUQA 4F92B 1TQIA 1FJLA 2OBPA 3B73A 4HNTA 1YHQI 4AD9A 1LE8A 3H92A 4CYCB 2DJNA 3L09A 5L3CA 3CJRB 4YFNF 2IGKA 3QQAA 5H6QA 3WTYC 2CQKA 2X6WA 2CUZA 2HS5A 4A3IJ 2YU3A 1W7PB 3DPUA 2CW8A 2ZB9A 3O2PE 2WWYA 5B1AH 4XRSA 2QF7A 3WODF 4Q5SF 4GCVA 5HLIA 1M1EB 3ZQCA 2Q2EB 2A6HF 5E3LA 2VASA 2G0EA 2HDDA 3BTCA 3KEYA 2X4HA 2BZTA 1R6RA 5EDNA 3O8GA 3OIOA 2BY1A 4DGWB 2R7UA 2VJ4A 2DA5A 2K3FA 3LQRA 2VL8A 5D5WB 4UB8C 2CYYA 1GLNA 2D2WA 2E36A 5JHFA 2L5QA 5LBQA 1OJLA 3GTKJ 2O7OA 2NNYA 1TNTA 5EEGA 2KZGA 2I8DA 2WY8Q 3D5SC 3U9GA 2EBIA 3SDGA 1YO5C 1S3JA 4BNCA 3NWTA 4QTRA 1IG7A 1DDNA 2CGPA 3BJOA 4ITVA 3DBRB 2P0WA 1TC3C 2ID6A 3AG1H 3G2BA 4D7MA 5E3OA 4WWCA 1IRXA 3GCMA 1B72B 3KYDB 4IOAF 3DQVC 4N4NB 4L0ZB 3FXKA 4ON0A 4DOZA 1Y0UA 2CO5A 4IO9F 2DYRH 1IW7F 2KQRA 4RB3C 1O57A 1JHHA 1SFXA 2DW4A 3MZ8A 4OMZA 1IGNA 3RKXA 5K1YA 4XSZF 1FY7A 3GXOA 1IXRC 1WH7A 3KP3A 5B5EC 1X1AA 3IWFA 4EM2A 3GFLA 5FKKA 3JSPA 2DA4A 1MMNA 3EYIA 4L9TA 1VQLI 2MBFA 1X1DA 4EVIA 3J7AY 4FTHA 4ETSA 1P9QC 2OU2A 5F0FA 3FX3A 4KIGA 2OCEA 4LLLA 1X19A 4YEJA 2GA1A 4DBQA 1PDNC 2VBYA 3KE2A 2F2EA 4ZYGA 3FKJA 4MTDA 2K85A 1MMSA 2XAQA 3FXMA 2WV0A 2EH3A 4LG0B 3I56I 2KIQA 3BR1A 2JTVA 2XDVA 4RB2C 2Y9ZA 5EGOB 4JQFA 3A01A 4G94A 2MW8A 1SVMA 3CDIA 4MEYF 3OYHA 4LJZF 3LSPA 1F5TA 4G6QA 1I5ZA 5EZGA 2EILH 2UUZA 2VQHA 3L1PA 3LFUA 1PJRA 3BTIA 1S7AA 3OYIA 5BPIA 4AYBN 4QIWN 2VN2A 5LEJA 2FQ4A 3FXLA 5A2QZ 3BJ6A 1W4MA 1HCRA 1ZG5A 5GAEJ 5D5VB 1QBJA 4JP0A 4I2OA 5HLGA 4D5CA 4IRIA 2B0LA 2XRLA 2IA1A 2K02A 1TWGJ 3KP5A 4F52A 1H9GA 4CUGA 4PJNA 1SFOJ 2IS1A 1YRNA 1UELB 4PK4A 3H5AA 3K0LA 2VE9A 3H9QA 3TBIA 1E3HA 4XM3A 3OIPA 4O5VA 4ANJA 4IX7A 1GHCA 1DPUA 4E7SA 3ZPLA 3SEQA 2W57A 3TP0A 2R7VA 5A2QK 1G3TA 2HYFA 4FETA 2O9LA 3LMMA 5FLXZ 1U8BA 2L9SA 3OR2C 2LBFA 1R9TJ 2E35A 3PSFA 2ZJRF 3CCMI 3I4NJ 1MBEA 3TEDA 2HPIA 1TWFJ 3BQYA 1TTYA 2X1EA 1JUMA 2COBA 3SQNA 4Y15A 2O3FA 1MBJA 2IGMA 4CCLA 2QEXI 5JI6A 1O7FA 2CWEA 4M9XA 4H0EA 2DTZA 2HDCA 5LGUA 1OQYA 4RB1A 3LSRA 3E5QA 2JUGA 1K6YA 2BW3B 1LEBA 1HW5A 2P8TA 1X1CA 4U7DA 2R5ZB 1VQ8I 3GTQJ 5FLXK 3WTUC 2VQLA 4Y33A 5HS9A 2KFDA 2CUJA 2M2EA 2XASA 4ABZA 4OINF 3R60A 2ZMEC 1GVDA 1GXPA 2LKSA 4CXFA 3U21A 3J7ZI 2W48A 4AIDA 2V9KA 2YX4A 1KQ9A 4HZFA 3IH4A 1HOMA 3TOBA 1L0OC 2R5YB 3JTHA 1KU7A 2BHYA 1GXQA 1TW3A 2Y0SN 2R7RA 1MBKA 1VNDA 2I5UA 3NRVA 3JTGA 3FXOA 3CDHA 1MBGA 3J80Z 1ZH5A 3M4OJ 3GBGA 3ML6A 4A3GJ 2EB7A 5C4XJ 4XLHA 4NQWB 4C9YA 3VYRB 3CESA 3HUGB 2E1MB 3PL8A 3ULQB 4RA2A 2R7DA 3LAJA 1L3LA 1JKRC 2F5CA 4BBSJ 3VSKA 2ZXJA 2KRCA 1I27A 2M7AA 5IOZA 3HSFA 2VBWA 1FP2A 3TO9A 1ZRCA 2X51A 3FXRA 2XGCA 5FLVA 2ECBA 3C7JA 4CSWA 3QOEA 1NK3P 3HKZA 2E34A 3OOUA 2OZUA 4WK8F 4LB5A 1IN8A 4YIIA 1VQMI 2IBDA 2W7NA 5E8GA 4FISA 2W24A 2QSHX 2IS2A 1YYVA 4XQFA 2P5VA 2GXAA 5M5XJ 3FHZA 1I6XA 3J80K 3S2HJ 3SFIA 1ITYA 3H3VK 4A93J 2PN6A 4C2UA 2QBYA 5F64A 2ESHA 2LTPA 3IP4B 4A3MJ 2RC4A 2LFBA 2XGEA 1MZBA 4ZZDA 5LHIA 4BQAA 3ZQFA 4A69C 3EUHC 4A6DA 3PQJA 2STTA 1YJNI 2EK5A 2FOKA 3HRUA 3ZMVA 2OZ6A 2NNNA 4MLOA 4U0WA 1XTAA 3LAPA 4CHUA 1A04A 2XKPA 5J8CA 4KIBA 2CFXA 4QLCU 2R7QA 5FROA 5JFRA 2M7BA 4ZYEA 3WE3A 1FP1D 5DS9A 2E1NA 2MSYA 2HKOA 4XLAA 3GZ5A 5ILUA 3RI4A 2H1KA 2DA1A 3H1CA 2R7WA 3DP7A 3TDUC 4E6KG 2HQ5A 5LGNA 1ENHA 1ZGJA 4U88A 3WTWC 3L2WA 4KFCA 1E17A 4MNUA 5BS6A 2J5PA 3BR0A 4I99C 2ECCA 2R7OA 2ZC2A 1YW7A 5DD4A 1VQPI 2F4IA 3JCUC 1STZA 2HU9A 4U87A 5ICGA 1QGPA 2FMYA 3MKLA 4KNYA 2V6CA 4HPQA 4JYKA 4A3JJ 4KITB 3OYJA 1MGTA 1VQ9I 3BLYA 3EUAA 3ZMDA 1BJZA 3QPLA 4RLQA 1VQNI 4KISA 3K70D 2O03A 2MD5A 1Y1VJ 3F8FA 3S1RJ 4B43A 3FWEA 4DYRA 2UZKA 1X1BA 2ME0A 1RZ4A 1S8NA 5B3SH 3HOXJ 2GWRA 3BQZA 3M8JA 3JRIA 2DN0A 4R8HA 3CCJI 3WU1B 3OOPA 1D8KA 3SEZA 4G7HF 1K78A 5D5UB 3BZ6A 1I6HJ 5JLXA 1EA3A 5GP9A 1SD6A 2JSCA 3CCEI 1MNMC 4RLFA 3F8BA 3DTIA 2VUMJ 4DQ2A 3QWLA 1X4PA 2XF5A 1T56A 2P7CB 3DPTA 2MLKA 2VT2A 3ZQ7A 1VQ4I 5CYVA 3ZN0A 2DFFA 5F1JA 4L0YB 2BY0A 3TMOA 3I54A 4J01A 3P5JA 3RZDJ 1TQMA 4JX4A 3OYLA 3OV8A 2EIJH 3OY9A 3I55I 4LLNA 5ERIA 3KETA 2PMZA 5ILVA 4C3IJ 2XAHA 2ZFUA 1ZTRA 3ZP5A 2KIMA 1OYYA 1FBQA 1OPCA 2EJRA 2GIZA 2Z99A 2L2OA 4O6JA 1VZ0A 2IGOA 2M0CA 3H9GA 1I39A 2H94A 2H8RA 4XK4A 4LK1F 4GXOA 2K40A 1E0EA 3HTSB 4ZZLA 1J7KA 1BIAA 1B4AA 1MW7A 1Z91A 3W2WA 5EF6A 5LLQA 3BT9A 2X9DA 1MBFA 1X2MA 4A3FJ 3ELKA 4KDPA 5IYCJ 1YIJI 4HLYA 1Z67A 2AXLA 4M3DA 2HI3A 1EJ9A 2ZSIB 1D1AA 3HOTA 3OWTA 2WADA 4LB6B 1RR7A 1MH4A 2CUFA 2H09A 2EFPA 1Q1VA 2FXAA 2YR2A 3M1CA 3JRAA 4PJLA 2R92J 1AU7A 4B8XA 1B8IB 1LJ9A 3V4GA 2L3DA 3G1LA 5E20A 1Y8RB 4DBRA 1V5GA 2LP0A 1K7AA 1QA6A 1TBXA 1YOVB 1J2XA 1FBUA 1NG7A 2FBIA 2K9LA 4HEA2 4BHBA 3WU2C 5GTHC 1JTYA 3T8TA 2GXGA 2BXYA 1V4RA 4DZPA 1P7IA 3K4BA 1UG0A 1FMWA 3LSJA 4OIQF 4D5FA 1ETKA 5BNGA 2EFNA 1RRJA 3HPGA 2EZKA 4XKBA 4D0PA 3CCSI 1D0ZA 3HRMA 1JI8A 1EKEA 2DPDA 3JRFA 4BJ5C 3C2HA 4LITA 3DBHB 4A3KJ 4G8XA 1BR1A 2LVSA 5CPRB 3W6JB 2NYXA 4IQJA 1ZARA 5L3DA 2QSGX 1ZRDA 3L2RA 1G2HA 2DT5A 2DU9A 3K1NA 5K7FA 2BBYA 2DLLA 3GW2A 4HBLA 2CH0A 3O3KA 4JK1X 2ZMEA 5F04A 3UR3C 2QENA 3HIFA 1J5YA 2JZYA 4DW6A 2JMWA 2OJED 2M5WA 3M9AA 2HYGD 4KIFA 2KMUA 3FBIB 1PYVA 1QPIA 5J4YA 5EG0B 3AAFA 4RM3A 2A61A 2KP6A 1A6QA 2DODA 3Q9VA 1LFPA 3BDDA 3IAS2 2IEKA 5CVVA 1Z05A 3CJTB 2MD0A 2JRTA 2WC2A 1JGSA 2A5YB 3PM1A 2Z16A 2FQ3A 4I6ZA 5ILSA 4BY1J 1SFUA 3LWFA 5EEAA 4BJTA 3HJEA 2BXZA 1DU0A 3K6GA 1R22A 4LMYA 5BOXA 2LLKA 1O3SA 3F8MA 2DDAA 3ERMA 1JUSA 3L2VA 4IQ4A 2DFHA 2TDXA 1I1GA 3L2QA 3OIQA 4XLFA 3TOAA 2JT1A 3PO2J 3VYTB 2VKHA 2OC6A 3O6BB 4GYIA 1D0YA 3MFKA 2P6TA 2QKMB 3U1KA 2CW7A 4RGRA 2UXXA 1LPQA 1FTZA 1SD7A 3HRSA 3G3ZA 2IRFG 2R4GA 3WTSC 1T0FC 4NDLA 2Z33A 4D9JA 4IHVA 1RPWA 3SZGA 4G7ZF 2KDZA 1SAXA 5HODA 4BS9A 1YITI 4CZCA 1ON1A 2FE3A 2QQ8A 3RYRA 4AVPA 2FMLA 4N4OB 3JW4A 2ZXWH 5TGTA 1IRZA 2DT7B 2HYJA 3RKYA 3QPSA 3I9V2 4M9SA
chains in the Genus database with same CATH topology
1H88C 5E3NA 3ZQLA 4M3BA 2XSDC 2XGDA 2EH3A 3RQIA 3BR1A 4A3CJ 2M8GX 3OSFA 2Y9ZA 5EGOB 1AKHA 1APLC 3A01A 2E1OA 2MW8A 3HBLA 2X48A 3FKIJ 3LSPA 2CQQA 1W0TA 1BA5A 4C2MJ 4M3FA 2R5YA 5C44J 1LE8B 2K9SA 1A6IA 4BKXA 3SJMA 5EZGA 3JRCA 3L1PA 3BTIA 4AYBN 3JRDA 4QIWN 3FIWA 4S0HB 5C3EJ 2FQ4A 1JKPC 3S2DJ 2PMZN 4UUTA 1HCRA 4FE7A 2DA2A 4IHXA 4BY7J 1RETA 4A3DJ 4JP0A 2DA7A 4D5CA 4XIDA 2XRLA 3G1OA 2E2JJ 5JLWA 1TWGJ 4X1EA 4DYCA 1U78A 3HGGA 2IAIA 1D5YA 5IOYA 1SFOJ 1YRNA 2JN6A 3HOZJ 1JUPA 2LR8A 2Y31A 3BG9A 3F0CA 5F0CA 5FKMA 4JX5A 1IJWC 1MSFC 4MIMA 3TP0A 3WHCA 4J19A 3I4MJ 1Z0XA 4MFEA 3JREA 2O9LA 3S16J 1JGGA 3D1NI 1U8BA 9ANTA 4RBOA 1IV6A 1R9TJ 2WB1N 5M3MJ 1VF9A 4DYQA 1JJ8C 1MBEA 3I4NJ 3TEDA 1TWFJ 3BQYA 1JUMA 2FJ1A 2COBA 4UUSB 2CU7A 1MBJA 2QCOA 4JX6A 1ETYA 3PO3J 3NAUA 3DCFA 3UKGA 1T33A 1JT6A 1JTXA 5K7ZA 2DTZA 4DZJA 3LSRA 3C2BA 1U9OA 2L0KA 3RKQA 2VI6A 1FEXA 2HOSA 1XC5A 1MBHA 1UMQA 3GTQJ 2R5ZB 3K2AA 1ZQ3P 2RAEA 3GTOJ 2N8GA 2M2EA 1UG2A 4ABZA 4HNVA 3BTLA 3S14J 1GVDA 1VI0A 2R5ZA 3CDLA 2R0QC 1BL0A 3IH3A 3BR2A 4C3HJ 5M3FJ 2O8KA 1AKHB 2CQXA 3A01B 4IHWA 2W48A 1JKOC 5J3LA 1TWHJ 3LOCA 5IP9J 2JA7J 2DMPA 3ZQIA 2Y9YA 3IH4A 4EEFG 3S1QJ 2R5YB 3HOUJ 1HOMA 3MN2A 1OCPA 1GV2A 4G12A 1U9NA 3A02A 1E3OC 1ETWA 5J1UA 2Y0SN 1MBKA 5FKLA 4V2FA 1H89C 1VNDA 1VFCA 1MBGA 3M4OJ 3GBGA 3BR3A 2NVXJ 3FK7A 4A3GJ 5C4XJ 3G1MA 4I76A 1RKTA 4AUXA 1O4XA 4D7NA 2ELKA 1ZGWA 1X58A 2LKXA 1JKRC 4BBSJ 5EYRA 1TWCJ 2DMQA 1XS9A 2JA6J 1EF4A 3JRGA 1I50J 2DMUA 5IOZA 3VPRA 1XG1A 2I10A 2AO9A 1GT0C 4LOCA 2XGCA 5FLVA 2X6OA 2ECBA 1YRNB 3HOYJ 2CUEA 1A5JA 2NVQJ 2XPWA 1NK3P 1PUFA 3OOUA 5FJ8J 3S1NJ 2XPVA 3H0GJ 3RZOJ 2IBDA 5F0HA 4FISA 1FIAA 5M5XJ 4IHYA 2GBYA 2R93J 3S2HJ 3SFIA 1ITYA 3H3VK 4A93J 5F08A 5M5WJ 2VKVA 3GTLJ 2LTPA 1JT0A 4A3MJ 2GM4A 2LFBA 2XGEA 3ZQFA 4A69C 4QSHA 2GLOA 3Q3SA 1BW6A 2HXOA 4XICA 4A3EJ 2NOGA 1SANA 4MLOA 1IC8A 2XB0X 5FKNA 3LNQA 2K9NA 2NVYJ 4B3AA 2YUSA 3BTJA 1NTCA 1I3QJ 2Y30A 1WCMJ 5DS9A 2MSYA 2H1KA 1LFBA 4W97A 1W0UA 2DA1A 4RDUA 2HOTA 2HQ5A 2ID3A 2MGQA 1ENHA 2M34A 1B8IA 3GTGJ 3BR0A 2ECCA 3GTPJ 3MVPA 3HGYA 3MKLA 3K7AJ 4BXXJ 4JYKA 5FLMJ 3B6AA 4A3JJ 2DA6A 1QVUA 3JRBA 1BJZA 3QPLA 3TW6A 2LD5A 1IDZA 3LSGA 1Y1VJ 3BR5A 3Q0WA 2M9HA 2YU9J 3S1RJ 3W6VA 4DYRA 4CYCA 3S15J 1TWAJ 2FD5A 1FIPA 2TCTA 2ME0A 2MG4A 3HOXJ 1HLVA 3BQZA 4M6VA 3JRIA 2DN0A 4AC0A 2XB5A 1I6HJ 5JLXA 4FE4A 1POGA 5GP9A 3ZOBA 1MSEC 5E3MA 1MNMC 3HEFA 3JRHA 2LY9A 3HOVJ 2VUMJ 2D5VA 2OF7A 3HOWJ 4B1RA 2JWTA 1T56A 3A03A 3O8HA 1ORKA 5F1JA 1IDYA 5EG0A 3ZQGA 5J1YA 4BBRJ 3CCYA 3RZDJ 2EZIA 1H8AC 2WAQN 1K61A 4C3JJ 4JX4A 2HXIA 1Y1WJ 2R7ZJ 3S1MJ 1GV5A 1PUFB 3FISA 5J1RA 2NS8A 1DU6A 3BG5A 4C3IJ 1ETOA 1ZTRA 3IV5A 2EZLA 3E7LA 4GFBA 1NK2P 1IUFA 2M0CA 3ZQHA 2VPRA 1BW5A 2H8RA 2XPUA 4XK4A 2EZHA 4A3LJ 2K40A 5EZHA 2VKEA 1B72A 2DA3A 2JA8J 1F43A 1F36A 2Y2ZA 1QVTA 3GTMJ 5EF6A 3BT9A 2X9DA 1MBFA 1X2MA 4A3FJ 1ETQA 2FX0A 2ME6A 3HDDA 5IYCJ 3NARA 1ZR2A 1S7EA 5IYDJ 4M3DA 2HI3A 1K83J 5FKOA 1WI3A 1RESA 4M3EA 3IH2A 1RR7A 1MH4A 2CUFA 5IP7J 3HM5A 5DTDA 1Q1VA 1FTTA 3JRAA 4A3BJ 2R92J 2CRGA 1AU7A 1ETVA 3M3YJ 1B8IB 1JKQC 3JR9A 3G1LA 3CQZJ 5F27A 3B6CA 2HOAA 1ZR4A 2OPTA 1OCTC 1WGXA 2LP0A 1RKWA 4M3GA 3GTJJ 1OFCX 1P7JA 4XRSG 5EGOA 5M5YJ 1JTYA 5K7HA 3BG3A 1FJLA 4DZPA 1P7IA 1LE8A 3LSJA 1HF0A 4D5FA 1ETKA 5BNGA 2DJNA 4CYCB 2L9RA 1ETXA 2EZKA 4B4CA 3QQAA 3DEWA 1QRYA 3JRFA 1Z77A 1X2NA 4A3KJ 3TP3A 1JJ6C 4A3IJ 2B63J 2LVSA 2AHQA 3OSGA 1WH5A 3S17J 1ZK8A 2ZB9A 3HKZN 1G2HA 4L5EA 5K7FA 4XRSA 2QF7A 5GPCA 1AHDP 5F04A 3ZQCA 2NS7A 2JA5J 5E3LA 2G0EA 4DW6A 2EQRA 3BTCA 2HDDA 2JMWA 5EDNA 3HB9A 4Y7NJ 1WPKA 3O8GA 2L7ZA 3OIOA 5IP6A 5IPAA 2LK2A 4FCYA 1QPIA 4Y52J 4XRMA 1MH3A 5EG0B 3Q0UA 2DA5A 2E19A 2P81A 2YS9A 3Q0VA 3BR6A 2DMNA 1OJLA 2IEKA 4MO7A 3GTKJ 2O7OA 1LFUP 2EBIA 3PM1A 4I6ZA 1GDTA 2E2IJ 4BY1J 3SDGA 1GUUA 2JJ7A 3WHBA 5EEAA 4QTRA 1IG7A 2NVTJ 1DU0A 2LLKA 1JUSA 2L7FP 1TC3C 2ID6A 2CJJA 4D7MA 5E3OA 4V2GA 1B72B 2JK3A 3TW7A 5IYBJ 3PO2J 1UHSA 2WV1A 2DMTA 4W1UA 4UUSA 2KT0A 2E2HJ 1IGNA 4IEJA 1FTZA 2K9QA 5GPAA 1WH7A 4NDLA 4IHVA 1CQTA 1RPWA 4MFDA 2KDZA 5HODA 5FKKA 2DA4A 2TRTA 1ZKGA 1HDDC 1HDPA 3CMYA 3FK6A 4FTHA 1IRZA 2HYJA 5F0FA 3QPSA 5C4JJ 4X6AJ 2L7MP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H88 C;  5E3N A;  3ZQL A;  4M3B A;  2XSD C;  2XGD A;  2EH3 A;  3RQI A;  3BR1 A;  4A3C J;  2M8G X;  3OSF A;  2Y9Z A;  5EGO B;  1AKH A;  1APL C;  3A01 A;  2E1O A;  2MW8 A;  3HBL A;  2X48 A;  3FKI J;  3LSP A;  2CQQ A;  1W0T A;  1BA5 A;  4C2M J;  4M3F A;  2R5Y A;  5C44 J;  1LE8 B;  2K9S A;  1A6I A;  4BKX A;  3SJM A;  5EZG A;  3JRC A;  3L1P A;  3BTI A;  4AYB N;  3JRD A;  4QIW N;  3FIW A;  4S0H B;  5C3E J;  2FQ4 A;  1JKP C;  3S2D J;  2PMZ N;  4UUT A;  1HCR A;  4FE7 A;  2DA2 A;  4IHX A;  4BY7 J;  1RET A;  4A3D J;  4JP0 A;  2DA7 A;  4D5C A;  4XID A;  2XRL A;  3G1O A;  2E2J J;  5JLW A;  1TWG J;  4X1E A;  4DYC A;  1U78 A;  3HGG A;  2IAI A;  1D5Y A;  5IOY A;  1SFO J;  1YRN A;  2JN6 A;  3HOZ J;  1JUP A;  2LR8 A;  2Y31 A;  3BG9 A;  3F0C A;  5F0C A;  5FKM A;  4JX5 A;  1IJW C;  1MSF C;  4MIM A;  3TP0 A;  3WHC A;  4J19 A;  3I4M J;  1Z0X A;  4MFE A;  3JRE A;  2O9L A;  3S16 J;  1JGG A;  3D1N I;  1U8B A;  9ANT A;  4RBO A;  1IV6 A;  1R9T J;  2WB1 N;  5M3M J;  1VF9 A;  4DYQ A;  1JJ8 C;  1MBE A;  3I4N J;  3TED A;  1TWF J;  3BQY A;  1JUM A;  2FJ1 A;  2COB A;  4UUS B;  2CU7 A;  1MBJ A;  2QCO A;  4JX6 A;  1ETY A;  3PO3 J;  3NAU A;  3DCF A;  3UKG A;  1T33 A;  1JT6 A;  1JTX A;  5K7Z A;  2DTZ A;  4DZJ A;  3LSR A;  3C2B A;  1U9O A;  2L0K A;  3RKQ A;  2VI6 A;  1FEX A;  2HOS A;  1XC5 A;  1MBH A;  1UMQ A;  3GTQ J;  2R5Z B;  3K2A A;  1ZQ3 P;  2RAE A;  3GTO J;  2N8G A;  2M2E A;  1UG2 A;  4ABZ A;  4HNV A;  3BTL A;  3S14 J;  1GVD A;  1VI0 A;  2R5Z A;  3CDL A;  2R0Q C;  1BL0 A;  3IH3 A;  3BR2 A;  4C3H J;  5M3F J;  2O8K A;  1AKH B;  2CQX A;  3A01 B;  4IHW A;  2W48 A;  1JKO C;  5J3L A;  1TWH J;  3LOC A;  5IP9 J;  2JA7 J;  2DMP A;  3ZQI A;  2Y9Y A;  3IH4 A;  4EEF G;  3S1Q J;  2R5Y B;  3HOU J;  1HOM A;  3MN2 A;  1OCP A;  1GV2 A;  4G12 A;  1U9N A;  3A02 A;  1E3O C;  1ETW A;  5J1U A;  2Y0S N;  1MBK A;  5FKL A;  4V2F A;  1H89 C;  1VND A;  1VFC A;  1MBG A;  3M4O J;  3GBG A;  3BR3 A;  2NVX J;  3FK7 A;  4A3G J;  5C4X J;  3G1M A;  4I76 A;  1RKT A;  4AUX A;  1O4X A;  4D7N A;  2ELK A;  1ZGW A;  1X58 A;  2LKX A;  1JKR C;  4BBS J;  5EYR A;  1TWC J;  2DMQ A;  1XS9 A;  2JA6 J;  1EF4 A;  3JRG A;  1I50 J;  2DMU A;  5IOZ A;  3VPR A;  1XG1 A;  2I10 A;  2AO9 A;  1GT0 C;  4LOC A;  2XGC A;  5FLV A;  2X6O A;  2ECB A;  1YRN B;  3HOY J;  2CUE A;  1A5J A;  2NVQ J;  2XPW A;  1NK3 P;  1PUF A;  3OOU A;  5FJ8 J;  3S1N J;  2XPV A;  3H0G J;  3RZO J;  2IBD A;  5F0H A;  4FIS A;  1FIA A;  5M5X J;  4IHY A;  2GBY A;  2R93 J;  3S2H J;  3SFI A;  1ITY A;  3H3V K;  4A93 J;  5F08 A;  5M5W J;  2VKV A;  3GTL J;  2LTP A;  1JT0 A;  4A3M J;  2GM4 A;  2LFB A;  2XGE A;  3ZQF A;  4A69 C;  4QSH A;  2GLO A;  3Q3S A;  1BW6 A;  2HXO A;  4XIC A;  4A3E J;  2NOG A;  1SAN A;  4MLO A;  1IC8 A;  2XB0 X;  5FKN A;  3LNQ A;  2K9N A;  2NVY J;  4B3A A;  2YUS A;  3BTJ A;  1NTC A;  1I3Q J;  2Y30 A;  1WCM J;  5DS9 A;  2MSY A;  2H1K A;  1LFB A;  4W97 A;  1W0U A;  2DA1 A;  4RDU A;  2HOT A;  2HQ5 A;  2ID3 A;  2MGQ A;  1ENH A;  2M34 A;  1B8I A;  3GTG J;  3BR0 A;  2ECC A;  3GTP J;  3MVP A;  3HGY A;  3MKL A;  3K7A J;  4BXX J;  4JYK A;  5FLM J;  3B6A A;  4A3J J;  2DA6 A;  1QVU A;  3JRB A;  1BJZ A;  3QPL A;  3TW6 A;  2LD5 A;  1IDZ A;  3LSG A;  1Y1V J;  3BR5 A;  3Q0W A;  2M9H A;  2YU9 J;  3S1R J;  3W6V A;  4DYR A;  4CYC A;  3S15 J;  1TWA J;  2FD5 A;  1FIP A;  2TCT A;  2ME0 A;  2MG4 A;  3HOX J;  1HLV A;  3BQZ A;  4M6V A;  3JRI A;  2DN0 A;  4AC0 A;  2XB5 A;  1I6H J;  5JLX A;  4FE4 A;  1POG A;  5GP9 A;  3ZOB A;  1MSE C;  5E3M A;  1MNM C;  3HEF A;  3JRH A;  2LY9 A;  3HOV J;  2VUM J;  2D5V A;  2OF7 A;  3HOW J;  4B1R A;  2JWT A;  1T56 A;  3A03 A;  3O8H A;  1ORK A;  5F1J A;  1IDY A;  5EG0 A;  3ZQG A;  5J1Y A;  4BBR J;  3CCY A;  3RZD J;  2EZI A;  1H8A C;  2WAQ N;  1K61 A;  4C3J J;  4JX4 A;  2HXI A;  1Y1W J;  2R7Z J;  3S1M J;  1GV5 A;  1PUF B;  3FIS A;  5J1R A;  2NS8 A;  1DU6 A;  3BG5 A;  4C3I J;  1ETO A;  1ZTR A;  3IV5 A;  2EZL A;  3E7L A;  4GFB A;  1NK2 P;  1IUF A;  2M0C A;  3ZQH A;  2VPR A;  1BW5 A;  2H8R A;  2XPU A;  4XK4 A;  2EZH A;  4A3L J;  2K40 A;  5EZH A;  2VKE A;  1B72 A;  2DA3 A;  2JA8 J;  1F43 A;  1F36 A;  2Y2Z A;  1QVT A;  3GTM J;  5EF6 A;  3BT9 A;  2X9D A;  1MBF A;  1X2M A;  4A3F J;  1ETQ A;  2FX0 A;  2ME6 A;  3HDD A;  5IYC J;  3NAR A;  1ZR2 A;  1S7E A;  5IYD J;  4M3D A;  2HI3 A;  1K83 J;  5FKO A;  1WI3 A;  1RES A;  4M3E A;  3IH2 A;  1RR7 A;  1MH4 A;  2CUF A;  5IP7 J;  3HM5 A;  5DTD A;  1Q1V A;  1FTT A;  3JRA A;  4A3B J;  2R92 J;  2CRG A;  1AU7 A;  1ETV A;  3M3Y J;  1B8I B;  1JKQ C;  3JR9 A;  3G1L A;  3CQZ J;  5F27 A;  3B6C A;  2HOA A;  1ZR4 A;  2OPT A;  1OCT C;  1WGX A;  2LP0 A;  1RKW A;  4M3G A;  3GTJ J;  1OFC X;  1P7J A;  4XRS G;  5EGO A;  5M5Y J;  1JTY A;  5K7H A;  3BG3 A;  1FJL A;  4DZP A;  1P7I A;  1LE8 A;  3LSJ A;  1HF0 A;  4D5F A;  1ETK A;  5BNG A;  2DJN A;  4CYC B;  2L9R A;  1ETX A;  2EZK A;  4B4C A;  3QQA A;  3DEW A;  1QRY A;  3JRF A;  1Z77 A;  1X2N A;  4A3K J;  3TP3 A;  1JJ6 C;  4A3I J;  2B63 J;  2LVS A;  2AHQ A;  3OSG A;  1WH5 A;  3S17 J;  1ZK8 A;  2ZB9 A;  3HKZ N;  1G2H A;  4L5E A;  5K7F A;  4XRS A;  2QF7 A;  5GPC A;  1AHD P;  5F04 A;  3ZQC A;  2NS7 A;  2JA5 J;  5E3L A;  2G0E A;  4DW6 A;  2EQR A;  3BTC A;  2HDD A;  2JMW A;  5EDN A;  3HB9 A;  4Y7N J;  1WPK A;  3O8G A;  2L7Z A;  3OIO A;  5IP6 A;  5IPA A;  2LK2 A;  4FCY A;  1QPI A;  4Y52 J;  4XRM A;  1MH3 A;  5EG0 B;  3Q0U A;  2DA5 A;  2E19 A;  2P81 A;  2YS9 A;  3Q0V A;  3BR6 A;  2DMN A;  1OJL A;  2IEK A;  4MO7 A;  3GTK J;  2O7O A;  1LFU P;  2EBI A;  3PM1 A;  4I6Z A;  1GDT A;  2E2I J;  4BY1 J;  3SDG A;  1GUU A;  2JJ7 A;  3WHB A;  5EEA A;  4QTR A;  1IG7 A;  2NVT J;  1DU0 A;  2LLK A;  1JUS A;  2L7F P;  1TC3 C;  2ID6 A;  2CJJ A;  4D7M A;  5E3O A;  4V2G A;  1B72 B;  2JK3 A;  3TW7 A;  5IYB J;  3PO2 J;  1UHS A;  2WV1 A;  2DMT A;  4W1U A;  4UUS A;  2KT0 A;  2E2H J;  1IGN A;  4IEJ A;  1FTZ A;  2K9Q A;  5GPA A;  1WH7 A;  4NDL A;  4IHV A;  1CQT A;  1RPW A;  4MFD A;  2KDZ A;  5HOD A;  5FKK A;  2DA4 A;  2TRT A;  1ZKG A;  1HDD C;  1HDP A;  3CMY A;  3FK6 A;  4FTH A;  1IRZ A;  2HYJ A;  5F0F A;  3QPS A;  5C4J J;  4X6A J;  2L7M P; 
#chains in the Genus database with same CATH topology
 3G71 I;  4LIU A;  1XMK A;  5E3N A;  3EUH A;  3ZQL A;  5FRN A;  2HNH A;  2XGD A;  3L2C A;  1BJA A;  3R0J A;  3OR1 C;  3RQI A;  3OSF A;  1FX7 A;  1BI2 A;  4OAZ A;  4OU0 A;  5E1X A;  1AKH A;  4JBA A;  1OYI A;  3HBL A;  1UCR A;  3FKI J;  4NNJ A;  5TRD A;  2CQQ A;  4XKV A;  1BA5 A;  2XGX A;  3H5N A;  3SYT A;  5C44 J;  2K9S A;  1A6I A;  4BKX A;  2LF8 A;  3SJM A;  3GZN B;  3I71 A;  3QPT A;  4BUP A;  3ASO H;  4HDV A;  3JRC A;  4ZDL A;  2OD5 A;  1O3Q A;  3QOP A;  2BY3 A;  1MMD A;  2VQC A;  3ONQ A;  2Q0O A;  1ZLK A;  3FIW A;  3GME A;  1G6N A;  1LQ1 A;  3ZXS A;  3N05 A;  2WTE A;  2CW0 F;  4F93 B;  3VB2 A;  1FSE A;  4E7L A;  1Y6I A;  4FE7 A;  2DA2 A;  2DPU A;  4NB5 A;  4PFP A;  2EIK H;  1JXS A;  1J0R A;  2BEO A;  4OAY A;  4A3D J;  3GEZ A;  4XID A;  1LNW A;  1SAU A;  2E2J J;  2QYO A;  1XMX A;  3CUO A;  2JN6 A;  3J7Y J;  4PGG A;  4KA4 A;  1TP4 A;  4BEH A;  4XMY A;  2K5C A;  3MAJ A;  1BC7 C;  3BG9 A;  4QWQ A;  3LA3 A;  1R5G A;  3FMS A;  5FKM A;  1BI3 A;  2B9S A;  1T6S A;  4JX5 A;  1IJW C;  4NHJ A;  3K1M A;  1RR8 C;  2DK5 A;  3WHC A;  1LVK A;  2ZJ2 A;  5CVI A;  1FNN A;  4BL0 B;  3HZJ A;  1Z0X A;  4MEX F;  1FOW A;  3LA7 A;  2BVL A;  1R71 A;  1FYK A;  1U5T B;  9ANT A;  2JVG A;  3T8R A;  2RQP A;  2WAQ A;  3DTK A;  4RBO A;  2WB1 N;  3RTR A;  2FRH A;  4DYQ A;  3HC7 A;  1U3E M;  2W4S A;  4EJO A;  2ZNZ A;  4HNU A;  4MQ9 F;  4UUS B;  4HST A;  2E7X A;  1MDM A;  2CU7 A;  2QCO A;  4UNO A;  1MJA A;  5JVG F;  4XLN F;  4ENK A;  1U6G A;  1ETY A;  4CO8 A;  5DYM A;  1ONV A;  2KJB A;  2L9N A;  3NAU A;  4WXH A;  4PUS A;  4ZTF A;  2XF6 A;  3DLL F;  1JTX A;  1IZ1 A;  2A07 F;  4DZJ A;  3DPL C;  1U9O A;  2BYV E;  3I4P A;  4I09 A;  2LF7 A;  4F3Q A;  1P4A A;  2HOS A;  1XC5 A;  1O7L A;  3GVA A;  2GOX B;  3E6M A;  2MAB A;  1PP7 U;  3G73 A;  1MD0 A;  2IPQ X;  4YRV A;  1ZQ3 P;  5DM6 F;  2MA3 A;  4ENN A;  4BHP A;  4RS8 A;  1MND A;  3QYF A;  1VQO I;  3ERE D;  2W85 A;  3BTL A;  2R0Q C;  3BR2 A;  3WE2 A;  4C3H J;  1K6O A;  5DCM A;  2CQX A;  4E4H A;  2DAO A;  5J3L A;  2CS3 A;  1NH3 A;  3LOC A;  1XSD A;  2PFB A;  5D4S A;  2JA7 J;  3VWB A;  5DD8 A;  3HOU J;  1OCP A;  1XSX A;  4G12 A;  3ABT A;  3REO A;  1ZRF A;  3EET A;  4V2F A;  2VIX A;  3VOE A;  3I59 A;  1VFC A;  1WHU A;  1HKQ A;  1Z3Y A;  1OCR H;  1HW2 A;  2RRE A;  1ON2 A;  3G1M A;  4PCQ A;  4I76 A;  1P4X A;  3G4S I;  2M45 A;  1ZGW A;  5IT9 Z;  4M74 A;  1QO0 D;  1XS9 A;  2DMQ A;  2FNP A;  1QPM A;  4L9N A;  1JHF A;  4BXU A;  3MKY B;  1XG1 A;  1X3U A;  2I10 A;  2Y69 H;  3BP8 A;  2PJP A;  4E7I A;  3HOY J;  1A5J A;  2CUE A;  4BDZ A;  1WJF A;  4EQQ A;  1HC8 A;  3WGG A;  4ZYA A;  4U0Y A;  5CQG A;  3RZO J;  2A3S A;  5F0H A;  4ZH4 F;  2ICW G;  3HSR A;  1FIA A;  2V79 A;  2R93 J;  2GBY A;  4GGG A;  1A36 A;  5M5W J;  2A68 F;  1D3Y A;  3OYD A;  2XV4 S;  3GTL J;  2LG4 A;  4GDF A;  3F6V A;  4II3 A;  4RAG A;  5IT9 K;  3OYG A;  2VOO A;  4N9H A;  1KQ0 A;  2ZKZ A;  4QSH A;  4Y13 A;  5DDG A;  3AG3 H;  4GO1 A;  1IC8 A;  4II2 A;  5D4R A;  3QU3 A;  1G4D A;  1R5I D;  4G6D A;  2XB0 X;  5FKN A;  3LNQ A;  4EAT A;  4DIQ A;  1WI9 A;  4B3A A;  1NTC A;  2D1V A;  4YFX F;  2R7S A;  1OLT A;  2L54 A;  1HQC A;  2W1O A;  3D0S A;  1N77 A;  4W97 A;  3CTA A;  1RIO H;  1EH6 A;  4UUV A;  2HOT A;  1BI0 A;  2ID3 A;  1UZC A;  1CF7 B;  2A05 A;  3BZK A;  4RGU A;  5J47 A;  1DP7 P;  2K27 A;  3HGY A;  3PIO F;  4HF1 A;  4BQQ A;  4F7Z A;  3S32 A;  3DU6 A;  3K7A J;  2E1M C;  2DA6 A;  1QVU A;  5J40 A;  2F5E A;  2L9V A;  2LD5 A;  1XDS A;  3LSG A;  3VYS B;  3DBL B;  1E3P A;  2PBI A;  4G7O F;  3A0B C;  2OQG A;  3BPV A;  4CYC A;  2LSO A;  1TWA J;  4Q48 A;  2TCT A;  4GRI A;  2O6G E;  3PNT A;  4M6V A;  3P9I A;  3SZP A;  1KON A;  4YIR X;  5ICE A;  2CSO A;  5L3E A;  4AC0 A;  4ASN A;  3MQ0 A;  1W7P A;  4HLX A;  4CA0 A;  3KFW X;  3PFY A;  1POG A;  2AS5 F;  3LSK A;  4OWR B;  3K4C A;  3HEF A;  1IUY A;  2W84 A;  3OL3 A;  4XR6 A;  3KPH A;  3SZT A;  1R4M B;  1BI1 A;  2DOA A;  3MKZ A;  2OF7 A;  2QKL B;  1XD7 A;  2JWT A;  1FOY A;  2DI3 A;  1W36 C;  3WTZ A;  2LYC A;  1ZRE A;  1T2K A;  1B59 A;  1H9T A;  1IDY A;  2P6S A;  3ZQG A;  5J1Y A;  3T5X A;  4XSX F;  4AYB A;  2Z3Y A;  2KZV A;  1WJC A;  1FC3 A;  4AU7 A;  1Y1W J;  4BE1 A;  1HBX G;  3CC7 I;  2FNA A;  1PUF B;  2X6X A;  4FHT A;  4EJW A;  5KHD A;  1ETO A;  3IV5 A;  4E7J A;  4P9U A;  1YJW I;  2XUB A;  4GFB A;  1NK2 P;  4BH9 A;  3OS1 A;  2NS0 A;  1E2X A;  3H36 A;  2RGV A;  2LKP A;  2Y48 A;  1BW5 A;  2XPU A;  1XCB A;  2DFE A;  3PUB A;  2BV6 A;  2F5V A;  1OYW A;  5EZH A;  3PNY A;  1B72 A;  1F36 A;  1NG6 A;  3H3Z A;  3ZMZ A;  1T98 A;  2NXN B;  2K86 A;  3I0T A;  1HA8 A;  3GTM J;  5ED4 A;  1MKM A;  3DKX A;  1ETQ A;  1XGM A;  2DO7 A;  3FMQ A;  1ZR2 A;  1S7E A;  2IXS A;  2X6Y A;  3H5R A;  2Q1Z B;  5KAF C;  5HNH A;  1K83 J;  1XDU A;  3E6D A;  4XOP A;  2YX7 A;  3NQO A;  1RES A;  4S05 A;  2PJR B;  1LDK B;  1LUJ B;  5GAH J;  3E1S A;  2R7T A;  5DTD A;  1XB4 A;  4P1W A;  2HEO A;  2V9V A;  2FU4 A;  5D6E A;  4R79 A;  2CRG A;  4CH7 A;  2BOL A;  1ETV A;  2HKX A;  4YG2 F;  3DTE A;  5LEK A;  1S7O A;  3JR9 A;  2RVC A;  5CVR A;  5CQE A;  3FDY A;  2RNG A;  1OCT C;  3KP4 A;  1WGX A;  4LG0 A;  3GTJ J;  4XKC A;  3V7C A;  3IL2 A;  2V9P A;  5EGO A;  4OIO F;  3AL0 B;  4HQE A;  3P9C A;  4M71 A;  5K7H A;  3BG3 A;  4XNF A;  3GO5 A;  4XOR A;  3HPH A;  1YQA A;  2V26 A;  3EYY A;  1YX5 A;  3TO6 A;  1IRF A;  1HF0 A;  4B3X A;  3ESW B;  3A0H C;  4BGD A;  5H6R A;  4B4C A;  1P6R A;  1QRY A;  1Z77 A;  4HF0 A;  3S3M A;  2OCC H;  1EV7 A;  1JJ6 C;  4QPQ A;  4LK0 F;  3OSG A;  1WH5 A;  2V4J C;  2L4A A;  4UY8 I;  3GWZ A;  5GPC A;  3ECO A;  3LL7 A;  4BQO A;  2DOF A;  3WG7 H;  3UNG C;  4MGR A;  5L3F A;  4IL6 C;  1J09 A;  1AHD P;  3K4L A;  2NS7 A;  4IPA A;  4BU2 A;  3PJR A;  4NC7 A;  4UB6 C;  5FFZ A;  2EQR A;  1D1C A;  2M3A A;  3AFH A;  2DJI A;  1V3F A;  3HB9 A;  4IOC F;  5IP6 A;  5IPA A;  2Y0S A;  1UHW A;  2RKH A;  1MH3 A;  4BE2 A;  2QSF X;  3Q0U A;  4CDG A;  4E7K A;  2E19 A;  3FXU A;  2PG4 A;  2YS9 A;  3K4J A;  3Q0V A;  2F4M B;  2DMN A;  4MO7 A;  3F72 A;  4HG2 A;  3PUF A;  3CME I;  3TDZ C;  2JSP A;  3HXL A;  2EA4 A;  3RPU A;  4KN4 X;  3F21 A;  2Y75 A;  2ZXH A;  4HQM A;  1GDT A;  2YSR A;  1GUU A;  1Z6T A;  3DV8 A;  3LQQ A;  2JJ7 A;  4HW0 A;  1BN5 A;  1BR4 A;  1QU3 A;  3IRR A;  4XBF A;  2NVT J;  1T38 A;  3CF2 A;  4KYW A;  4A12 A;  4EM0 B;  2L7F P;  1YTY A;  2CJJ A;  2NAZ A;  3HSE A;  4V2G A;  2Q8K A;  1HST A;  1OCC H;  1IAW A;  1UHS A;  5L3G A;  2WV1 A;  2DMT A;  2DDB A;  4G9Y A;  3DFG A;  2J5O A;  2DQL A;  3MD2 A;  4W1U A;  3M07 A;  2KT0 A;  2E2H J;  3KEQ A;  4HYE A;  3KZZ A;  4IEJ A;  2M8E A;  1OCZ H;  3FM3 A;  3ROU A;  3N4M A;  5CVU A;  5FO5 A;  5GPA A;  3R6S A;  3CD6 I;  3IAM 2;  2G7H A;  1YW9 A;  1P2F A;  3F8C A;  2HDW A;  2VLA A;  2MC4 A;  1HDD C;  1I1S A;  2BW3 A;  3FK6 A;  2PMH A;  4HDU A;  2E71 A;  1TNS A;  3COA C;  2R5Z A;  1KU2 A;  5K5O A;  2BY2 A;  1AA7 A;  3RDI A;  4KT5 C;  4RGS A;  4AM3 A;  4AWX B;  3QPH A;  4M3B A;  2XSD C;  2C6Y A;  4IJA A;  1BIB A;  1YS7 A;  1J9I A;  3A2K A;  3M8E A;  4A3C J;  1TZL A;  5IT3 A;  2M8G X;  1APL C;  1HSJ A;  2EV6 A;  5F6F A;  3CUQ B;  4BJ6 C;  5J4V A;  2DTR A;  1W0T A;  3I64 A;  4C2M J;  4Y4R A;  4M3F A;  2R5Y A;  3C3W A;  1LE8 B;  4I02 A;  3WTX C;  3PSI A;  3ZMT A;  3C2G A;  1X3Z B;  2HQR A;  3ABL H;  2ELH A;  4HV5 A;  4JOM A;  3KP7 A;  3OYN A;  3OS2 A;  3JRD A;  1K79 A;  1HW1 A;  2XRN A;  3CCU I;  4S0H B;  1DGW Y;  2HQN A;  1JKP C;  4Y17 A;  3S2D J;  1PVE A;  1VQ7 I;  4NQW A;  2XAU A;  2LMD A;  1ERD A;  2O8X A;  1RET A;  3C1D A;  1W5C C;  2F4O B;  5CJ9 A;  3VEP A;  5BMZ A;  2P5K A;  1EH7 A;  2STW A;  1OIS A;  3G1O A;  1KU9 A;  5JLW A;  2R7X A;  2ZNY A;  4X1E A;  4DYC A;  1U78 A;  3MWM A;  1D5Y A;  2IAI A;  4U7B A;  5IOY A;  3CCR I;  3DLA A;  4P55 A;  3MZH A;  3AKZ A;  3CC2 I;  2E60 A;  1UFM A;  4XLC A;  4UV8 A;  4R1H A;  5FRM A;  3VDX A;  1MDM B;  2DYS H;  3F0C A;  5F0C A;  1XX5 A;  2IGN A;  2ZJP F;  3QP6 A;  3EQL F;  4MIM A;  1C0W A;  2VBX A;  4WX9 A;  3I4M J;  4XOT A;  2GA2 A;  3FXJ A;  4MFE A;  4ZYH A;  1O3R A;  2H6B A;  3VSL A;  4L9V A;  2OTL I;  2UWM A;  1G59 A;  3F9K A;  1JGG A;  3E97 A;  1IV6 A;  4EGZ A;  2DT6 A;  3TO7 A;  4UXN A;  2LDU A;  1VF9 A;  5M3M J;  1FBS A;  3W3C A;  1JJ8 C;  3D5L A;  1WJ5 A;  2FJ1 A;  4M6X A;  4A6E A;  2ZSH B;  5HDN A;  4A5M A;  1YJ9 I;  2IA0 A;  2WY7 Q;  5DEQ A;  5H2F C;  2QM3 A;  2ETH A;  1JT6 A;  5HS7 A;  5K7Z A;  4CCK A;  5LD2 C;  2DK8 A;  2M0M A;  1WRJ A;  1YW8 A;  4E7Z A;  3J81 Z;  4I01 A;  3RQ4 A;  2IJL A;  3RKQ A;  2VI6 A;  3HOS A;  3Q5F A;  4A0X A;  1MBH A;  5HOO A;  1G3W A;  4UHT A;  2NVU B;  1WZ2 A;  3DEE A;  1ACI A;  1G3S A;  3NEU A;  4Z6Y A;  3GX4 X;  2HPM A;  2RAE A;  3MMY B;  2L02 A;  2N8G A;  1UG2 A;  1IF1 A;  2QZ8 A;  3S93 A;  4WXC A;  5LHH A;  4PJM A;  1TQP A;  1VI0 A;  4IRG A;  2HOE A;  4HX8 A;  1BL0 A;  3IH3 A;  5M3F J;  3T1B A;  4F55 A;  3A01 B;  4BHC A;  3ABM H;  4IHW A;  4A5N A;  1RI7 A;  1TWH J;  1TL8 A;  5IP9 J;  3DKY A;  2DMP A;  2MYS A;  3TL4 X;  4LD5 A;  5KNL A;  3CCQ I;  1KQ8 A;  3KEO A;  3A02 A;  1E3O C;  4L18 B;  1ETW A;  1SC7 A;  3K4K A;  1LB2 A;  2QGU A;  2P5L C;  2COM A;  3J81 K;  2D45 A;  5HS8 A;  3CF5 F;  2EFO A;  2H8W A;  3KZI C;  5CVJ A;  1K4T A;  2NVX J;  1W7P D;  4YFK F;  1UAA A;  3OMY A;  3ZMU A;  4AUX A;  4G6T B;  4D7N A;  1LDD A;  4MQV A;  1U5T C;  1FMV A;  3HHG A;  1X58 A;  1Q1H A;  2LKX A;  3KCC A;  2KIU A;  1TWC J;  5EYR A;  1HXD A;  4I0A A;  2JA6 J;  2KRF A;  4B47 A;  1I50 J;  2DMU A;  3OYM A;  3JSO A;  3BY6 A;  1V5F A;  2JPC A;  5JVT A;  3DKW A;  1GT0 C;  1ODD A;  3WGH A;  3FMR A;  4LOC A;  2X6O A;  4EGY A;  1YRN B;  4HV6 A;  2FEZ A;  3KZY A;  2NVQ J;  3IHU A;  1BOA A;  5D8K B;  6PAX A;  3S1N J;  2XPV A;  2LNB A;  2A69 F;  5E1W A;  3CMA I;  1PUE E;  4PSW A;  2G9W A;  3CO6 C;  1J59 A;  2DFI A;  2OV7 A;  5D6F A;  4Z2Y A;  1DUX C;  3EDP A;  5F08 A;  3E3V A;  1MNE A;  4ESB A;  3VYU B;  1IN7 A;  2FOW A;  1IN4 A;  2VKV A;  2XAJ A;  3KIO A;  2QVO A;  4QPO A;  1A31 A;  1HKT A;  4BAY A;  2GM4 A;  3IKV A;  2LBF B;  4P5O A;  4LFU A;  1FWZ A;  3RSN A;  3W6K B;  2OTJ I;  4I0B A;  4XIC A;  4A3E J;  1VQK I;  2ZBK A;  5CLS A;  5K5Q A;  1SVL A;  1QHG A;  1U2W A;  3D5R C;  4OIP F;  3P9K A;  4M72 A;  2K9N A;  2NVY J;  2YUS A;  2FSW A;  2AQE A;  4M9Z A;  3TGN A;  2Y30 A;  2RN7 A;  3F22 A;  3GFM A;  2CQN A;  1ZLJ A;  4CCN A;  2PQ8 A;  1MIJ A;  1W0U A;  4OOI A;  4RDU A;  2G7U A;  1NHA A;  5D5X B;  5E1Z B;  4L9J A;  2MGQ A;  2VPL A;  1DP3 A;  4EM1 A;  3WGI A;  2EFQ A;  1W1W E;  3QU6 A;  1B8I A;  3P7N A;  2MH2 A;  3GTP J;  1B9N A;  3GFJ A;  4N9I A;  1R58 A;  1SD5 A;  4HX4 A;  2FBH A;  1K4S A;  2HR3 A;  3I58 A;  4CZZ A;  3ISP A;  2PX9 A;  4XKW A;  4AIH A;  4CCJ A;  3TW6 A;  2PMU A;  1S9H A;  1REP C;  3S3N A;  3E6C C;  1Z7U A;  2FA5 A;  2UV1 A;  1R7J A;  3KYL A;  3VOD A;  3H3U A;  3W6V A;  1OCO H;  3NWS A;  2H27 A;  3S17 J;  1EH8 A;  2FD5 A;  3LA2 A;  4ZJZ A;  2EPF A;  2MG4 A;  3IUO A;  3V8J A;  1N78 A;  1LDJ A;  1R00 A;  2QUF A;  2HZD A;  4O3M A;  3F23 A;  2LY2 A;  2JA2 A;  5AIQ A;  1ZN2 A;  4FE4 A;  3BOQ A;  3BRO A;  3ZOB A;  4P96 A;  3I3L A;  5E3M A;  1R1U A;  2QQB A;  2Z5U A;  3JRH A;  1MSE C;  2GIV A;  4DNC A;  2IP2 A;  1SMY F;  3DXJ F;  4IF4 A;  2P4W A;  3HOV J;  3AG4 H;  2D5V A;  4KUM A;  1YS6 A;  1A35 A;  1S6L A;  1YG2 A;  2GZW A;  3ABK H;  3CLQ A;  3MKW B;  3A03 A;  4DJA A;  2EWN A;  3CO7 C;  2VC0 A;  4XN3 A;  2EV0 A;  4KMF A;  2OQR A;  2HFH A;  5EG0 A;  3LFK A;  4L5I A;  1H8A C;  1K61 A;  3E5X A;  4C3J J;  3R61 A;  4LIV A;  5HDG A;  1WJE A;  2R7Z J;  5KCM A;  1MJ9 A;  1UJ8 A;  4ENJ A;  5E17 F;  2XKO A;  3MEX A;  4Q47 A;  2O0Y A;  4C30 A;  2EZL A;  3E7L A;  3RPU D;  4N0B A;  2JRM A;  3LST A;  2MLG A;  3K4N A;  5L3B A;  3L00 A;  3BPX A;  1IUF A;  4HOB A;  2QBY B;  3FHN A;  4ZDP A;  1U0J A;  1XSV A;  2EZH A;  5CKT A;  1X4O A;  3IC7 A;  4M73 A;  4A3L J;  3RPQ A;  3L9F A;  2JA8 J;  2DA3 A;  1IN5 A;  4CGZ A;  2Y2Z A;  4F91 B;  1FOX A;  2FX0 A;  4WXD A;  1WJD A;  2CV0 A;  3HDD A;  1FZP B;  2QWW A;  5IYD J;  1R1V A;  1FLI A;  1WI3 A;  4EJT A;  3V8L A;  1XCV A;  2HVS A;  4M3E A;  3SXY A;  3H9J A;  2IVM A;  1S72 I;  5IP7 J;  1FSH A;  2IA2 A;  5LFA A;  2QLZ A;  3HG9 A;  3KLO A;  1FTT A;  2WB1 A;  1SEU A;  4A3B J;  4L5J A;  4C2T A;  3FZV A;  4TV7 A;  2BGC A;  3M3Y J;  3OS0 A;  3HRT A;  1BR2 A;  1I3A A;  5ICC A;  1JKQ C;  4IHT A;  3FF5 A;  3M1E A;  4FX0 A;  3GFI A;  5F27 A;  3B6C A;  1ZR4 A;  1TT0 A;  3EPZ A;  2OPT A;  3IKT A;  3DU5 A;  2KPM A;  1UB9 A;  4M6Y A;  3BCB A;  1P7J A;  2XF7 A;  3F6O A;  2VKD A;  3KP2 A;  3IWZ A;  2A5W A;  1CGP A;  1V54 H;  1FYL A;  1LKX A;  3I5U A;  5DM7 F;  2DQR A;  3ABU A;  3HL2 A;  2XAG A;  2L9R A;  1ETX A;  2AQF A;  3BG6 A;  3DEW A;  1Z3X A;  4RGX A;  3TQN A;  5B66 C;  2LC2 A;  1OR7 C;  1X2N A;  1TW2 A;  3TP3 A;  2B63 J;  4PGH A;  5J6X A;  2LRE A;  2AHQ A;  1K78 B;  1F1Z A;  5B1B H;  1S29 A;  1ZK8 A;  2F48 A;  1G8X A;  1SD4 A;  3H35 A;  3HKZ N;  3ZGK A;  3CZ6 A;  1Y39 A;  3L7W A;  1ZGA A;  4L5E A;  2JPB A;  3ZN1 A;  3QYB A;  3CLO A;  1KA8 A;  2ACJ A;  1IXS B;  1KZH A;  2JA5 J;  4ESJ A;  2IS4 A;  3LSI A;  3WTT C;  1T0F A;  3RCO A;  4LLG F;  2MH9 A;  4Y7N J;  1WPK A;  2L7Z A;  4FCY A;  2E5N A;  2LK2 A;  2O5R A;  4Y52 J;  4XRM A;  5KAI C;  3C18 A;  2P81 A;  1JE8 A;  2B7E A;  2UXN A;  4AIK A;  3BR6 A;  2R3S A;  2WAE A;  2VXD A;  4XL9 A;  1ZAO A;  1W5S A;  4Y3O A;  5JHU A;  1LFU P;  3GLX A;  2DCE A;  2E2I J;  1ZG1 A;  3GYH X;  5AON A;  3WHB A;  2M4G A;  3HTU A;  3V7R A;  4ZDO A;  2WBM A;  3QRF F;  3S2W A;  2AXT C;  2RNJ A;  2Q2E A;  4ZYD A;  2HTS A;  1F4K A;  2F5D A;  2MFZ A;  1U5T A;  2ZJQ F;  2Z2S B;  2VBZ A;  2JK3 A;  3TW7 A;  5IYB J;  2VOD A;  5J8F A;  4B44 A;  1Z9C A;  1W36 D;  2MC3 A;  5KK1 A;  4UUS A;  3AL0 C;  3FXQ A;  5TJJ A;  4D1Q A;  4XON A;  3V8K A;  2M4K A;  2K9Q A;  2DOE A;  5FFX A;  3N97 A;  2K4B A;  1VTN C;  3Q9S A;  1CQT A;  4OMY A;  3R0A A;  4MFD A;  2W25 A;  1R23 A;  2TRT A;  3PFI A;  1ZKG A;  1IN6 A;  3QYE A;  2X0L A;  1QZE A;  2K9M A;  1HDP A;  3CMY A;  2HWV A;  1VQ5 I;  3OYB A;  1X1P A;  2P7V B;  5C4J J;  2QA4 I;  4X6A J;  2L7M P;  4GYG A;  3KYC B;  5BQT A;  1H88 C;  3LSH A;  5FB2 A;  3E5U A;  4IHS A;  1SFE A;  5GTI C;  3GZ6 A;  3CC4 I;  4RAY A;  5GAD J;  2QQ9 A;  1WSU A;  2OAZ A;  2V1N A;  2JVH A;  1T39 A;  2X1D A;  2E1O A;  1AWC A;  2X48 A;  3QP5 A;  1VQ6 I;  1BBY A;  2CMP A;  5EEH A;  5LHG A;  4KN7 X;  2KLO A;  2V1X A;  2EFW A;  4FQG A;  2XIG A;  4IKF A;  1Y56 A;  2ZCW A;  3U2R A;  1IO2 A;  2ZXI A;  3L2U A;  1WQ2 A;  4MTE A;  1MMG A;  3HYI A;  2OA4 A;  2VJ5 A;  3E6B A;  1ULY A;  3GF2 A;  4RB0 A;  5C3E J;  3ZMS A;  1D0X A;  5F1R A;  2X85 A;  4HSR A;  3G6E I;  2PMZ N;  4V19 K;  3SDB A;  4J00 A;  1H0M A;  4UUT A;  1F9N A;  3GUD A;  3IRQ A;  4IHX A;  1XGN A;  4BY7 J;  2ZME B;  2XAF A;  2DA7 A;  4IVN A;  2Z1D A;  5FD5 A;  4BXF A;  1XPX A;  4CYD A;  3QAH A;  1DPR A;  3EUK L;  1GVJ A;  2VJI A;  3W2A A;  5HVQ C;  4NBQ A;  1WWX A;  2DXI A;  2HZT A;  3HGG A;  4AVZ A;  3HHH A;  2CV1 A;  2D1H A;  3HOZ J;  1JUP A;  4A0Z A;  2LR8 A;  2W00 A;  5HLT A;  2KKO A;  2Y31 A;  4ESF A;  2L7K A;  4B09 A;  4YEL A;  3M8F A;  3OYE A;  3PQK A;  3K4M A;  1MSF C;  1MMA A;  3CP2 A;  3FM5 A;  3WU0 A;  4J19 A;  5LRR A;  3W2V A;  1USS A;  4HA8 A;  4EJV A;  2H1L A;  1DGR M;  2F6C A;  1KU3 A;  4XLE A;  3JRE A;  2K7L A;  2V6E A;  3S16 J;  3D1N I;  3KLN A;  4K2E A;  3WTV C;  4CCO A;  2Y0M A;  5HNF A;  2L01 A;  4UVC A;  2K4J A;  2VC1 A;  3K70 C;  2EIM H;  3QOD A;  2GQQ A;  3V42 A;  2KIF A;  1SFK A;  3CUQ C;  4JX6 A;  4BYY A;  2YPR A;  3AG2 H;  3K2Z A;  1YFH A;  3PO3 J;  1RUO A;  3K10 A;  3DCF A;  3UKG A;  1IRG A;  5H20 A;  1T33 A;  2HGC A;  3DF8 A;  3S3O A;  3RYP A;  2HVQ A;  4RAF A;  3C2B A;  2LH9 A;  2E1C A;  1BOB A;  1TT5 B;  1HKS A;  2L0K A;  5DUI A;  1UST A;  1CF7 A;  4HAM A;  3MCZ A;  1FEX A;  1XGS A;  5LGT A;  1UMQ A;  1R1T A;  1V55 H;  5D8L B;  3K2A A;  2CQ7 A;  1IXC A;  1DQU A;  5AIP A;  2QQA A;  3GTO J;  4E7H A;  3ZQQ A;  4YIF A;  1UHM A;  4HNV A;  4UVA A;  2IS6 A;  3S14 J;  1T95 A;  3CDL A;  1D1B A;  2JQ7 A;  2O8K A;  1D8J A;  1AKH B;  1OKR A;  1LVA A;  2BVM A;  4KMU X;  4PDK A;  1JKO C;  4LGW A;  2OUM A;  4BQN A;  3ZQI A;  2Y9Y A;  4EEF G;  3S1Q J;  2EIN H;  3VFZ A;  3MN2 A;  1GV2 A;  5E18 F;  4IXA A;  3OYF A;  1U9N A;  2IW5 A;  2HVR A;  2KL4 A;  2VOP A;  2HQA A;  5J1U A;  1MJB A;  3BG7 A;  5FKL A;  1H89 C;  2XC7 A;  1FOK A;  2KRH A;  3BR3 A;  1B9M A;  3FK7 A;  4ENM A;  2E5Z A;  4KT6 A;  1RKT A;  1O4X A;  2M30 A;  2M87 A;  2EA2 A;  2VJJ A;  1KYW A;  2ELK A;  1YE9 A;  4WCG A;  4EMS A;  1EF4 A;  2LY1 A;  3CP8 A;  1Z1D A;  3A4C A;  3PNV A;  4RM2 A;  3JRG A;  4I7H A;  2WA0 A;  3BJA A;  3VPR A;  3GLL A;  2GOM A;  4IZZ A;  4S04 A;  4H4K C;  2AO9 A;  1S5L C;  3ZCO A;  2KIS A;  1QHH D;  2NOJ B;  5KVR A;  3H0D A;  4BEH B;  3T0Y A;  5IY5 H;  2XPW A;  4OIR F;  1PUF A;  1N75 A;  3M7G A;  5FJ8 J;  5LRS A;  3B02 A;  1N25 A;  1XGO A;  2GAU A;  1OR7 A;  3H0G J;  3E0J B;  4E70 A;  4P9F A;  1IV8 A;  2CV2 A;  3BWG A;  3KX2 A;  3U1D A;  3ASN H;  4IHY A;  4LG3 A;  3CCV I;  1Z6R A;  5TIS C;  5JR3 A;  2VT3 A;  3HUG A;  2X1C A;  1WVR A;  1R49 A;  1FYM A;  2XSJ C;  1TLH B;  1JT0 A;  4FX4 A;  1QZZ A;  3DWL E;  2VE8 A;  3KP6 A;  1Y8Q B;  2ADU A;  2GLO A;  1BW6 A;  1ZYR F;  2HXO A;  3Q3S A;  2NOG A;  2XRO A;  1SAN A;  2O61 A;  4FT8 A;  5FD6 A;  4PJ0 C;  2A6E F;  4BDY A;  5ICF A;  4BAC A;  2ZO4 A;  1U8R A;  3BTJ A;  1QNT A;  2FF4 A;  1I3Q J;  3X2Q H;  4AIJ A;  2PJR A;  1T8I A;  3J7A O;  4XN0 A;  5EJC A;  1WCM J;  4ZC3 A;  1LFB A;  3OL4 A;  2M1B A;  1R36 A;  3BC8 A;  2WAF A;  2ESN A;  2R7F A;  2M34 A;  4HF2 A;  1RC9 A;  1WJB A;  4U0V A;  3OYC A;  2LRD A;  3GTG J;  1Z7L A;  3F3X A;  2JUC A;  1X3W B;  2LOO A;  3MVP A;  1YX3 A;  1ZHF A;  3JAM Z;  4BXX J;  3WG9 A;  5FLM J;  3B6A A;  3JRB A;  4PZJ A;  5E8I A;  1BM9 A;  5GAG J;  5DCM B;  4X0G A;  1IDZ A;  2Z9O A;  3BR5 A;  1J75 A;  3Q0W A;  2M9H A;  2YU9 J;  2GXB A;  2HTJ A;  3S15 J;  1YI2 I;  1FIP A;  4NC6 A;  2ISZ A;  3RKW A;  2BE5 F;  4WF2 A;  3LSM A;  1HLV A;  1YIO A;  3CCL I;  4NUB A;  2W82 A;  2ZFW A;  4BE0 A;  3I59 B;  1WFX A;  5K5R A;  2XB5 A;  4MHG A;  2XVC A;  4UVB A;  3RJP A;  4IRH A;  3MZY A;  2K3P A;  4EV0 A;  1T08 B;  3V7S A;  4ZTJ A;  2LY9 A;  2XHK A;  2BHZ A;  3R4K A;  3HOW J;  4B1R A;  4KIC A;  1KYZ A;  1G3Y A;  3K69 A;  3O8H A;  5HDK A;  3JAM K;  2VON A;  4CIC A;  2KDO A;  1RUN A;  1ORK A;  3TKY A;  1B6A A;  4NC8 A;  4PFO A;  2VXZ A;  1FT9 A;  3ZRG A;  2RQQ A;  3FBN B;  1SVO A;  1RNL A;  5DUK A;  4BBR J;  3CCY A;  2EZI A;  2WAQ N;  4HX7 A;  2CFO A;  4XRF A;  1PP8 F;  4RAZ A;  3OYK A;  2HXI A;  3S1M J;  1GV5 A;  3FIS A;  2DBB A;  5J1R A;  2NS8 A;  1DU6 A;  3BG5 A;  3ZR8 X;  2KHM A;  3CJQ B;  3BZC A;  1WKM A;  5DCF A;  1V5E A;  2E7W A;  2ELJ A;  1QQI A;  4FAS D;  3DEU A;  1P92 A;  3ZQH A;  2VQG A;  2RDP A;  2VPR A;  2PLY A;  5FGM A;  4A2U A;  2A6T A;  1QZY A;  1P4W A;  2VKE A;  2KJC A;  1XN7 A;  3PIP F;  1F43 A;  1LEA A;  1ZG3 A;  1QVT A;  4PJJ A;  4CCM A;  2ME6 A;  3S8P A;  3NAR A;  3SHF A;  1W5T A;  1KGS A;  2F5F A;  1SMT A;  4A0Y A;  3SFZ A;  5E79 C;  3F8N A;  5FKO A;  2FBK A;  3K9T A;  3RIR A;  2NRA C;  1R5H A;  1AOY A;  2H6C A;  4UV9 A;  1OMI A;  1XMA A;  3IH2 A;  4B48 A;  3OYA A;  1Z21 A;  3HM5 A;  1ZEL A;  3CJN A;  2ISY A;  3ECH A;  5DV5 A;  4PSX A;  2V1U A;  3K1P A;  4HRI A;  2PI0 A;  4KJZ A;  5BPD A;  1R4N B;  2L4M A;  4I98 B;  1O3T A;  1BC8 C;  1FPQ A;  1B1B A;  4XLP F;  4EJU A;  1Y0N A;  1YLF A;  2EV5 A;  2IT0 A;  2FUG 2;  3CQZ J;  2CG4 A;  1D5V A;  1WJA A;  2HOA A;  2V1D A;  5HLH A;  2PEX A;  4RMN A;  2VB6 A;  2V7F A;  3A1Y A;  4Q4Z F;  3CMM A;  3BCA A;  1RKW A;  4M3G A;  1OFC X;  3I53 A;  4XRS G;  2RV8 A;  5M5Y J;  3CUQ A;  4F92 B;  1TQI A;  1FJL A;  2OBP A;  3B73 A;  4HNT A;  1YHQ I;  4AD9 A;  1LE8 A;  3H92 A;  4CYC B;  2DJN A;  3L09 A;  5L3C A;  3CJR B;  4YFN F;  2IGK A;  3QQA A;  5H6Q A;  3WTY C;  2CQK A;  2X6W A;  2CUZ A;  2HS5 A;  4A3I J;  2YU3 A;  1W7P B;  3DPU A;  2CW8 A;  2ZB9 A;  3O2P E;  2WWY A;  5B1A H;  4XRS A;  2QF7 A;  3WOD F;  4Q5S F;  4GCV A;  5HLI A;  1M1E B;  3ZQC A;  2Q2E B;  2A6H F;  5E3L A;  2VAS A;  2G0E A;  2HDD A;  3BTC A;  3KEY A;  2X4H A;  2BZT A;  1R6R A;  5EDN A;  3O8G A;  3OIO A;  2BY1 A;  4DGW B;  2R7U A;  2VJ4 A;  2DA5 A;  2K3F A;  3LQR A;  2VL8 A;  5D5W B;  4UB8 C;  2CYY A;  1GLN A;  2D2W A;  2E36 A;  5JHF A;  2L5Q A;  5LBQ A;  1OJL A;  3GTK J;  2O7O A;  2NNY A;  1TNT A;  5EEG A;  2KZG A;  2I8D A;  2WY8 Q;  3D5S C;  3U9G A;  2EBI A;  3SDG A;  1YO5 C;  1S3J A;  4BNC A;  3NWT A;  4QTR A;  1IG7 A;  1DDN A;  2CGP A;  3BJO A;  4ITV A;  3DBR B;  2P0W A;  1TC3 C;  2ID6 A;  3AG1 H;  3G2B A;  4D7M A;  5E3O A;  4WWC A;  1IRX A;  3GCM A;  1B72 B;  3KYD B;  4IOA F;  3DQV C;  4N4N B;  4L0Z B;  3FXK A;  4ON0 A;  4DOZ A;  1Y0U A;  2CO5 A;  4IO9 F;  2DYR H;  1IW7 F;  2KQR A;  4RB3 C;  1O57 A;  1JHH A;  1SFX A;  2DW4 A;  3MZ8 A;  4OMZ A;  1IGN A;  3RKX A;  5K1Y A;  4XSZ F;  1FY7 A;  3GXO A;  1IXR C;  1WH7 A;  3KP3 A;  5B5E C;  1X1A A;  3IWF A;  4EM2 A;  3GFL A;  5FKK A;  3JSP A;  2DA4 A;  1MMN A;  3EYI A;  4L9T A;  1VQL I;  2MBF A;  1X1D A;  4EVI A;  3J7A Y;  4FTH A;  4ETS A;  1P9Q C;  2OU2 A;  5F0F A;  3FX3 A;  4KIG A;  2OCE A;  4LLL A;  1X19 A;  4YEJ A;  2GA1 A;  4DBQ A;  1PDN C;  2VBY A;  3KE2 A;  2F2E A;  4ZYG A;  3FKJ A;  4MTD A;  2K85 A;  1MMS A;  2XAQ A;  3FXM A;  2WV0 A;  2EH3 A;  4LG0 B;  3I56 I;  2KIQ A;  3BR1 A;  2JTV A;  2XDV A;  4RB2 C;  2Y9Z A;  5EGO B;  4JQF A;  3A01 A;  4G94 A;  2MW8 A;  1SVM A;  3CDI A;  4MEY F;  3OYH A;  4LJZ F;  3LSP A;  1F5T A;  4G6Q A;  1I5Z A;  5EZG A;  2EIL H;  2UUZ A;  2VQH A;  3L1P A;  3LFU A;  1PJR A;  3BTI A;  1S7A A;  3OYI A;  5BPI A;  4AYB N;  4QIW N;  2VN2 A;  5LEJ A;  2FQ4 A;  3FXL A;  5A2Q Z;  3BJ6 A;  1W4M A;  1HCR A;  1ZG5 A;  5GAE J;  5D5V B;  1QBJ A;  4JP0 A;  4I2O A;  5HLG A;  4D5C A;  4IRI A;  2B0L A;  2XRL A;  2IA1 A;  2K02 A;  1TWG J;  3KP5 A;  4F52 A;  1H9G A;  4CUG A;  4PJN A;  1SFO J;  2IS1 A;  1YRN A;  1UEL B;  4PK4 A;  3H5A A;  3K0L A;  2VE9 A;  3H9Q A;  3TBI A;  1E3H A;  4XM3 A;  3OIP A;  4O5V A;  4ANJ A;  4IX7 A;  1GHC A;  1DPU A;  4E7S A;  3ZPL A;  3SEQ A;  2W57 A;  3TP0 A;  2R7V A;  5A2Q K;  1G3T A;  2HYF A;  4FET A;  2O9L A;  3LMM A;  5FLX Z;  1U8B A;  2L9S A;  3OR2 C;  2LBF A;  1R9T J;  2E35 A;  3PSF A;  2ZJR F;  3CCM I;  3I4N J;  1MBE A;  3TED A;  2HPI A;  1TWF J;  3BQY A;  1TTY A;  2X1E A;  1JUM A;  2COB A;  3SQN A;  4Y15 A;  2O3F A;  1MBJ A;  2IGM A;  4CCL A;  2QEX I;  5JI6 A;  1O7F A;  2CWE A;  4M9X A;  4H0E A;  2DTZ A;  2HDC A;  5LGU A;  1OQY A;  4RB1 A;  3LSR A;  3E5Q A;  2JUG A;  1K6Y A;  2BW3 B;  1LEB A;  1HW5 A;  2P8T A;  1X1C A;  4U7D A;  2R5Z B;  1VQ8 I;  3GTQ J;  5FLX K;  3WTU C;  2VQL A;  4Y33 A;  5HS9 A;  2KFD A;  2CUJ A;  2M2E A;  2XAS A;  4ABZ A;  4OIN F;  3R60 A;  2ZME C;  1GVD A;  1GXP A;  2LKS A;  4CXF A;  3U21 A;  3J7Z I;  2W48 A;  4AID A;  2V9K A;  2YX4 A;  1KQ9 A;  4HZF A;  3IH4 A;  1HOM A;  3TOB A;  1L0O C;  2R5Y B;  3JTH A;  1KU7 A;  2BHY A;  1GXQ A;  1TW3 A;  2Y0S N;  2R7R A;  1MBK A;  1VND A;  2I5U A;  3NRV A;  3JTG A;  3FXO A;  3CDH A;  1MBG A;  3J80 Z;  1ZH5 A;  3M4O J;  3GBG A;  3ML6 A;  4A3G J;  2EB7 A;  5C4X J;  4XLH A;  4NQW B;  4C9Y A;  3VYR B;  3CES A;  3HUG B;  2E1M B;  3PL8 A;  3ULQ B;  4RA2 A;  2R7D A;  3LAJ A;  1L3L A;  1JKR C;  2F5C A;  4BBS J;  3VSK A;  2ZXJ A;  2KRC A;  1I27 A;  2M7A A;  5IOZ A;  3HSF A;  2VBW A;  1FP2 A;  3TO9 A;  1ZRC A;  2X51 A;  3FXR A;  2XGC A;  5FLV A;  2ECB A;  3C7J A;  4CSW A;  3QOE A;  1NK3 P;  3HKZ A;  2E34 A;  3OOU A;  2OZU A;  4WK8 F;  4LB5 A;  1IN8 A;  4YII A;  1VQM I;  2IBD A;  2W7N A;  5E8G A;  4FIS A;  2W24 A;  2QSH X;  2IS2 A;  1YYV A;  4XQF A;  2P5V A;  2GXA A;  5M5X J;  3FHZ A;  1I6X A;  3J80 K;  3S2H J;  3SFI A;  1ITY A;  3H3V K;  4A93 J;  2PN6 A;  4C2U A;  2QBY A;  5F64 A;  2ESH A;  2LTP A;  3IP4 B;  4A3M J;  2RC4 A;  2LFB A;  2XGE A;  1MZB A;  4ZZD A;  5LHI A;  4BQA A;  3ZQF A;  4A69 C;  3EUH C;  4A6D A;  3PQJ A;  2STT A;  1YJN I;  2EK5 A;  2FOK A;  3HRU A;  3ZMV A;  2OZ6 A;  2NNN A;  4MLO A;  4U0W A;  1XTA A;  3LAP A;  4CHU A;  1A04 A;  2XKP A;  5J8C A;  4KIB A;  2CFX A;  4QLC U;  2R7Q A;  5FRO A;  5JFR A;  2M7B A;  4ZYE A;  3WE3 A;  1FP1 D;  5DS9 A;  2E1N A;  2MSY A;  2HKO A;  4XLA A;  3GZ5 A;  5ILU A;  3RI4 A;  2H1K A;  2DA1 A;  3H1C A;  2R7W A;  3DP7 A;  3TDU C;  4E6K G;  2HQ5 A;  5LGN A;  1ENH A;  1ZGJ A;  4U88 A;  3WTW C;  3L2W A;  4KFC A;  1E17 A;  4MNU A;  5BS6 A;  2J5P A;  3BR0 A;  4I99 C;  2ECC A;  2R7O A;  2ZC2 A;  1YW7 A;  5DD4 A;  1VQP I;  2F4I A;  3JCU C;  1STZ A;  2HU9 A;  4U87 A;  5ICG A;  1QGP A;  2FMY A;  3MKL A;  4KNY A;  2V6C A;  4HPQ A;  4JYK A;  4A3J J;  4KIT B;  3OYJ A;  1MGT A;  1VQ9 I;  3BLY A;  3EUA A;  3ZMD A;  1BJZ A;  3QPL A;  4RLQ A;  1VQN I;  4KIS A;  3K70 D;  2O03 A;  2MD5 A;  1Y1V J;  3F8F A;  3S1R J;  4B43 A;  3FWE A;  4DYR A;  2UZK A;  1X1B A;  2ME0 A;  1RZ4 A;  1S8N A;  5B3S H;  3HOX J;  2GWR A;  3BQZ A;  3M8J A;  3JRI A;  2DN0 A;  4R8H A;  3CCJ I;  3WU1 B;  3OOP A;  1D8K A;  3SEZ A;  4G7H F;  1K78 A;  5D5U B;  3BZ6 A;  1I6H J;  5JLX A;  1EA3 A;  5GP9 A;  1SD6 A;  2JSC A;  3CCE I;  1MNM C;  4RLF A;  3F8B A;  3DTI A;  2VUM J;  4DQ2 A;  3QWL A;  1X4P A;  2XF5 A;  1T56 A;  2P7C B;  3DPT A;  2MLK A;  2VT2 A;  3ZQ7 A;  1VQ4 I;  5CYV A;  3ZN0 A;  2DFF A;  5F1J A;  4L0Y B;  2BY0 A;  3TMO A;  3I54 A;  4J01 A;  3P5J A;  3RZD J;  1TQM A;  4JX4 A;  3OYL A;  3OV8 A;  2EIJ H;  3OY9 A;  3I55 I;  4LLN A;  5ERI A;  3KET A;  2PMZ A;  5ILV A;  4C3I J;  2XAH A;  2ZFU A;  1ZTR A;  3ZP5 A;  2KIM A;  1OYY A;  1FBQ A;  1OPC A;  2EJR A;  2GIZ A;  2Z99 A;  2L2O A;  4O6J A;  1VZ0 A;  2IGO A;  2M0C A;  3H9G A;  1I39 A;  2H94 A;  2H8R A;  4XK4 A;  4LK1 F;  4GXO A;  2K40 A;  1E0E A;  3HTS B;  4ZZL A;  1J7K A;  1BIA A;  1B4A A;  1MW7 A;  1Z91 A;  3W2W A;  5EF6 A;  5LLQ A;  3BT9 A;  2X9D A;  1MBF A;  1X2M A;  4A3F J;  3ELK A;  4KDP A;  5IYC J;  1YIJ I;  4HLY A;  1Z67 A;  2AXL A;  4M3D A;  2HI3 A;  1EJ9 A;  2ZSI B;  1D1A A;  3HOT A;  3OWT A;  2WAD A;  4LB6 B;  1RR7 A;  1MH4 A;  2CUF A;  2H09 A;  2EFP A;  1Q1V A;  2FXA A;  2YR2 A;  3M1C A;  3JRA A;  4PJL A;  2R92 J;  1AU7 A;  4B8X A;  1B8I B;  1LJ9 A;  3V4G A;  2L3D A;  3G1L A;  5E20 A;  1Y8R B;  4DBR A;  1V5G A;  2LP0 A;  1K7A A;  1QA6 A;  1TBX A;  1YOV B;  1J2X A;  1FBU A;  1NG7 A;  2FBI A;  2K9L A;  4HEA 2;  4BHB A;  3WU2 C;  5GTH C;  1JTY A;  3T8T A;  2GXG A;  2BXY A;  1V4R A;  4DZP A;  1P7I A;  3K4B A;  1UG0 A;  1FMW A;  3LSJ A;  4OIQ F;  4D5F A;  1ETK A;  5BNG A;  2EFN A;  1RRJ A;  3HPG A;  2EZK A;  4XKB A;  4D0P A;  3CCS I;  1D0Z A;  3HRM A;  1JI8 A;  1EKE A;  2DPD A;  3JRF A;  4BJ5 C;  3C2H A;  4LIT A;  3DBH B;  4A3K J;  4G8X A;  1BR1 A;  2LVS A;  5CPR B;  3W6J B;  2NYX A;  4IQJ A;  1ZAR A;  5L3D A;  2QSG X;  1ZRD A;  3L2R A;  1G2H A;  2DT5 A;  2DU9 A;  3K1N A;  5K7F A;  2BBY A;  2DLL A;  3GW2 A;  4HBL A;  2CH0 A;  3O3K A;  4JK1 X;  2ZME A;  5F04 A;  3UR3 C;  2QEN A;  3HIF A;  1J5Y A;  2JZY A;  4DW6 A;  2JMW A;  2OJE D;  2M5W A;  3M9A A;  2HYG D;  4KIF A;  2KMU A;  3FBI B;  1PYV A;  1QPI A;  5J4Y A;  5EG0 B;  3AAF A;  4RM3 A;  2A61 A;  2KP6 A;  1A6Q A;  2DOD A;  3Q9V A;  1LFP A;  3BDD A;  3IAS 2;  2IEK A;  5CVV A;  1Z05 A;  3CJT B;  2MD0 A;  2JRT A;  2WC2 A;  1JGS A;  2A5Y B;  3PM1 A;  2Z16 A;  2FQ3 A;  4I6Z A;  5ILS A;  4BY1 J;  1SFU A;  3LWF A;  5EEA A;  4BJT A;  3HJE A;  2BXZ A;  1DU0 A;  3K6G A;  1R22 A;  4LMY A;  5BOX A;  2LLK A;  1O3S A;  3F8M A;  2DDA A;  3ERM A;  1JUS A;  3L2V A;  4IQ4 A;  2DFH A;  2TDX A;  1I1G A;  3L2Q A;  3OIQ A;  4XLF A;  3TOA A;  2JT1 A;  3PO2 J;  3VYT B;  2VKH A;  2OC6 A;  3O6B B;  4GYI A;  1D0Y A;  3MFK A;  2P6T A;  2QKM B;  3U1K A;  2CW7 A;  4RGR A;  2UXX A;  1LPQ A;  1FTZ A;  1SD7 A;  3HRS A;  3G3Z A;  2IRF G;  2R4G A;  3WTS C;  1T0F C;  4NDL A;  2Z33 A;  4D9J A;  4IHV A;  1RPW A;  3SZG A;  4G7Z F;  2KDZ A;  1SAX A;  5HOD A;  4BS9 A;  1YIT I;  4CZC A;  1ON1 A;  2FE3 A;  2QQ8 A;  3RYR A;  4AVP A;  2FML A;  4N4O B;  3JW4 A;  2ZXW H;  5TGT A;  1IRZ A;  2DT7 B;  2HYJ A;  3RKY A;  3QPS A;  3I9V 2;  4M9S A; 
#chains in the Genus database with same CATH homology
 1H88 C;  5E3N A;  3ZQL A;  4M3B A;  2XSD C;  2XGD A;  2EH3 A;  3RQI A;  3BR1 A;  4A3C J;  2M8G X;  3OSF A;  2Y9Z A;  5EGO B;  1AKH A;  1APL C;  3A01 A;  2E1O A;  2MW8 A;  3HBL A;  2X48 A;  3FKI J;  3LSP A;  2CQQ A;  1W0T A;  1BA5 A;  4C2M J;  4M3F A;  2R5Y A;  5C44 J;  1LE8 B;  2K9S A;  1A6I A;  4BKX A;  3SJM A;  5EZG A;  3JRC A;  3L1P A;  3BTI A;  4AYB N;  3JRD A;  4QIW N;  3FIW A;  4S0H B;  5C3E J;  2FQ4 A;  1JKP C;  3S2D J;  2PMZ N;  4UUT A;  1HCR A;  4FE7 A;  2DA2 A;  4IHX A;  4BY7 J;  1RET A;  4A3D J;  4JP0 A;  2DA7 A;  4D5C A;  4XID A;  2XRL A;  3G1O A;  2E2J J;  5JLW A;  1TWG J;  4X1E A;  4DYC A;  1U78 A;  3HGG A;  2IAI A;  1D5Y A;  5IOY A;  1SFO J;  1YRN A;  2JN6 A;  3HOZ J;  1JUP A;  2LR8 A;  2Y31 A;  3BG9 A;  3F0C A;  5F0C A;  5FKM A;  4JX5 A;  1IJW C;  1MSF C;  4MIM A;  3TP0 A;  3WHC A;  4J19 A;  3I4M J;  1Z0X A;  4MFE A;  3JRE A;  2O9L A;  3S16 J;  1JGG A;  3D1N I;  1U8B A;  9ANT A;  4RBO A;  1IV6 A;  1R9T J;  2WB1 N;  5M3M J;  1VF9 A;  4DYQ A;  1JJ8 C;  1MBE A;  3I4N J;  3TED A;  1TWF J;  3BQY A;  1JUM A;  2FJ1 A;  2COB A;  4UUS B;  2CU7 A;  1MBJ A;  2QCO A;  4JX6 A;  1ETY A;  3PO3 J;  3NAU A;  3DCF A;  3UKG A;  1T33 A;  1JT6 A;  1JTX A;  5K7Z A;  2DTZ A;  4DZJ A;  3LSR A;  3C2B A;  1U9O A;  2L0K A;  3RKQ A;  2VI6 A;  1FEX A;  2HOS A;  1XC5 A;  1MBH A;  1UMQ A;  3GTQ J;  2R5Z B;  3K2A A;  1ZQ3 P;  2RAE A;  3GTO J;  2N8G A;  2M2E A;  1UG2 A;  4ABZ A;  4HNV A;  3BTL A;  3S14 J;  1GVD A;  1VI0 A;  2R5Z A;  3CDL A;  2R0Q C;  1BL0 A;  3IH3 A;  3BR2 A;  4C3H J;  5M3F J;  2O8K A;  1AKH B;  2CQX A;  3A01 B;  4IHW A;  2W48 A;  1JKO C;  5J3L A;  1TWH J;  3LOC A;  5IP9 J;  2JA7 J;  2DMP A;  3ZQI A;  2Y9Y A;  3IH4 A;  4EEF G;  3S1Q J;  2R5Y B;  3HOU J;  1HOM A;  3MN2 A;  1OCP A;  1GV2 A;  4G12 A;  1U9N A;  3A02 A;  1E3O C;  1ETW A;  5J1U A;  2Y0S N;  1MBK A;  5FKL A;  4V2F A;  1H89 C;  1VND A;  1VFC A;  1MBG A;  3M4O J;  3GBG A;  3BR3 A;  2NVX J;  3FK7 A;  4A3G J;  5C4X J;  3G1M A;  4I76 A;  1RKT A;  4AUX A;  1O4X A;  4D7N A;  2ELK A;  1ZGW A;  1X58 A;  2LKX A;  1JKR C;  4BBS J;  5EYR A;  1TWC J;  2DMQ A;  1XS9 A;  2JA6 J;  1EF4 A;  3JRG A;  1I50 J;  2DMU A;  5IOZ A;  3VPR A;  1XG1 A;  2I10 A;  2AO9 A;  1GT0 C;  4LOC A;  2XGC A;  5FLV A;  2X6O A;  2ECB A;  1YRN B;  3HOY J;  2CUE A;  1A5J A;  2NVQ J;  2XPW A;  1NK3 P;  1PUF A;  3OOU A;  5FJ8 J;  3S1N J;  2XPV A;  3H0G J;  3RZO J;  2IBD A;  5F0H A;  4FIS A;  1FIA A;  5M5X J;  4IHY A;  2GBY A;  2R93 J;  3S2H J;  3SFI A;  1ITY A;  3H3V K;  4A93 J;  5F08 A;  5M5W J;  2VKV A;  3GTL J;  2LTP A;  1JT0 A;  4A3M J;  2GM4 A;  2LFB A;  2XGE A;  3ZQF A;  4A69 C;  4QSH A;  2GLO A;  3Q3S A;  1BW6 A;  2HXO A;  4XIC A;  4A3E J;  2NOG A;  1SAN A;  4MLO A;  1IC8 A;  2XB0 X;  5FKN A;  3LNQ A;  2K9N A;  2NVY J;  4B3A A;  2YUS A;  3BTJ A;  1NTC A;  1I3Q J;  2Y30 A;  1WCM J;  5DS9 A;  2MSY A;  2H1K A;  1LFB A;  4W97 A;  1W0U A;  2DA1 A;  4RDU A;  2HOT A;  2HQ5 A;  2ID3 A;  2MGQ A;  1ENH A;  2M34 A;  1B8I A;  3GTG J;  3BR0 A;  2ECC A;  3GTP J;  3MVP A;  3HGY A;  3MKL A;  3K7A J;  4BXX J;  4JYK A;  5FLM J;  3B6A A;  4A3J J;  2DA6 A;  1QVU A;  3JRB A;  1BJZ A;  3QPL A;  3TW6 A;  2LD5 A;  1IDZ A;  3LSG A;  1Y1V J;  3BR5 A;  3Q0W A;  2M9H A;  2YU9 J;  3S1R J;  3W6V A;  4DYR A;  4CYC A;  3S15 J;  1TWA J;  2FD5 A;  1FIP A;  2TCT A;  2ME0 A;  2MG4 A;  3HOX J;  1HLV A;  3BQZ A;  4M6V A;  3JRI A;  2DN0 A;  4AC0 A;  2XB5 A;  1I6H J;  5JLX A;  4FE4 A;  1POG A;  5GP9 A;  3ZOB A;  1MSE C;  5E3M A;  1MNM C;  3HEF A;  3JRH A;  2LY9 A;  3HOV J;  2VUM J;  2D5V A;  2OF7 A;  3HOW J;  4B1R A;  2JWT A;  1T56 A;  3A03 A;  3O8H A;  1ORK A;  5F1J A;  1IDY A;  5EG0 A;  3ZQG A;  5J1Y A;  4BBR J;  3CCY A;  3RZD J;  2EZI A;  1H8A C;  2WAQ N;  1K61 A;  4C3J J;  4JX4 A;  2HXI A;  1Y1W J;  2R7Z J;  3S1M J;  1GV5 A;  1PUF B;  3FIS A;  5J1R A;  2NS8 A;  1DU6 A;  3BG5 A;  4C3I J;  1ETO A;  1ZTR A;  3IV5 A;  2EZL A;  3E7L A;  4GFB A;  1NK2 P;  1IUF A;  2M0C A;  3ZQH A;  2VPR A;  1BW5 A;  2H8R A;  2XPU A;  4XK4 A;  2EZH A;  4A3L J;  2K40 A;  5EZH A;  2VKE A;  1B72 A;  2DA3 A;  2JA8 J;  1F43 A;  1F36 A;  2Y2Z A;  1QVT A;  3GTM J;  5EF6 A;  3BT9 A;  2X9D A;  1MBF A;  1X2M A;  4A3F J;  1ETQ A;  2FX0 A;  2ME6 A;  3HDD A;  5IYC J;  3NAR A;  1ZR2 A;  1S7E A;  5IYD J;  4M3D A;  2HI3 A;  1K83 J;  5FKO A;  1WI3 A;  1RES A;  4M3E A;  3IH2 A;  1RR7 A;  1MH4 A;  2CUF A;  5IP7 J;  3HM5 A;  5DTD A;  1Q1V A;  1FTT A;  3JRA A;  4A3B J;  2R92 J;  2CRG A;  1AU7 A;  1ETV A;  3M3Y J;  1B8I B;  1JKQ C;  3JR9 A;  3G1L A;  3CQZ J;  5F27 A;  3B6C A;  2HOA A;  1ZR4 A;  2OPT A;  1OCT C;  1WGX A;  2LP0 A;  1RKW A;  4M3G A;  3GTJ J;  1OFC X;  1P7J A;  4XRS G;  5EGO A;  5M5Y J;  1JTY A;  5K7H A;  3BG3 A;  1FJL A;  4DZP A;  1P7I A;  1LE8 A;  3LSJ A;  1HF0 A;  4D5F A;  1ETK A;  5BNG A;  2DJN A;  4CYC B;  2L9R A;  1ETX A;  2EZK A;  4B4C A;  3QQA A;  3DEW A;  1QRY A;  3JRF A;  1Z77 A;  1X2N A;  4A3K J;  3TP3 A;  1JJ6 C;  4A3I J;  2B63 J;  2LVS A;  2AHQ A;  3OSG A;  1WH5 A;  3S17 J;  1ZK8 A;  2ZB9 A;  3HKZ N;  1G2H A;  4L5E A;  5K7F A;  4XRS A;  2QF7 A;  5GPC A;  1AHD P;  5F04 A;  3ZQC A;  2NS7 A;  2JA5 J;  5E3L A;  2G0E A;  4DW6 A;  2EQR A;  3BTC A;  2HDD A;  2JMW A;  5EDN A;  3HB9 A;  4Y7N J;  1WPK A;  3O8G A;  2L7Z A;  3OIO A;  5IP6 A;  5IPA A;  2LK2 A;  4FCY A;  1QPI A;  4Y52 J;  4XRM A;  1MH3 A;  5EG0 B;  3Q0U A;  2DA5 A;  2E19 A;  2P81 A;  2YS9 A;  3Q0V A;  3BR6 A;  2DMN A;  1OJL A;  2IEK A;  4MO7 A;  3GTK J;  2O7O A;  1LFU P;  2EBI A;  3PM1 A;  4I6Z A;  1GDT A;  2E2I J;  4BY1 J;  3SDG A;  1GUU A;  2JJ7 A;  3WHB A;  5EEA A;  4QTR A;  1IG7 A;  2NVT J;  1DU0 A;  2LLK A;  1JUS A;  2L7F P;  1TC3 C;  2ID6 A;  2CJJ A;  4D7M A;  5E3O A;  4V2G A;  1B72 B;  2JK3 A;  3TW7 A;  5IYB J;  3PO2 J;  1UHS A;  2WV1 A;  2DMT A;  4W1U A;  4UUS A;  2KT0 A;  2E2H J;  1IGN A;  4IEJ A;  1FTZ A;  2K9Q A;  5GPA A;  1WH7 A;  4NDL A;  4IHV A;  1CQT A;  1RPW A;  4MFD A;  2KDZ A;  5HOD A;  5FKK A;  2DA4 A;  2TRT A;  1ZKG A;  1HDD C;  1HDP A;  3CMY A;  3FK6 A;  4FTH A;  1IRZ A;  2HYJ A;  5F0F A;  3QPS A;  5C4J J;  4X6A J;  2L7M P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...