3S1RJ

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s1rJ00
3TW7A 4IHWA 1JUPA 3RZDJ 3ZQFA 1UMQA 2ECCA 1ORKA 2HXIA 4A3JJ 3HGGA 1JUSA 5FKMA 1UHSA 4AUXA 2ECBA 4J19A 3GTOJ 3HKZN 3GBGA 1AKHB 2NS7A 2OPTA 1ZTRA 3QQAA 4DYRA 4AC0A 1G2HA 1U8BA 1OJLA 1RESA 4G12A 5EG0A 4A3KJ 1X58A 4A3FJ 2DA1A 2XGDA 3UKGA 5M5WJ 5DTDA 2M8GX 2Y9YA 3IH2A 3SFIA 2K40A 1F36A 2QCOA 1JKQC 1QPIA 2AO9A 4RBOA 1LE8B 2R93J 2DA3A 2E19A 3HOZJ 3K2AA 1ETYA 4XICA 1TWGJ 1FJLA 2Y30A 2B63J 1XS9A 4FE7A 3L1PA 3IH4A 2K9NA 4IHXA 2DA5A 3BG3A 3JRCA 5F1JA 1Z77A 4BXXJ 5F27A 4XK4A 2NVQJ 3F0CA 2E2HJ 3A01B 3K7AJ 3OIOA 5FKOA 2ZB9A 3PM1A 3HDDA 2HDDA 1Y1VJ 1POGA 2I10A 3JREA 3S15J 2XGCA 1APLC 3GTQJ 4B3AA 3M4OJ 2LP0A 2X48A 3JRIA 3JRGA 1IJWC 1MBEA 1MNMC 3G1OA 4NDLA 4UUSA 2ELKA 2WAQN 2XB0X 4A3CJ 1ETKA 1QRYA 2JA7J 4Y52J 3GTJJ 1FIAA 2R5ZA 2FJ1A 3B6AA 4C2MJ 4CYCA 4X1EA 3DCFA 2IBDA 3TEDA 1U78A 2JA6J 1WCMJ 1AU7A 5EEAA 1ZK8A 1MH3A 5FKKA 5J1UA 4IHYA 2LR8A 1PUFA 1BL0A 2EZHA 2VKVA 3C2BA 4LOCA 2KT0A 5EG0B 3HOWJ 4DYQA 2H8RA 1LFBA 3TP0A 1E3OC 3RKQA 4D5CA 1SANA 5E3NA 2R0QC 3BT9A 3FIWA 1B8IA 3ZQLA 3ZQCA 2CQXA 3S1RJ 3WHBA 4MFEA 4A3IJ 1A5JA 1EF4A 2DMUA 1X2MA 1I3QJ 5HODA 4FCYA 2RAEA 1BA5A 4BBSJ 1WH7A 2LTPA 3OSFA 2YU9J 2ME6A 2CUEA 2CJJA 3ZQGA 3BR6A 4Y7NJ 5F0HA 3Q0VA 3WHCA 4JX5A 3Q3SA 1YRNA 5GPCA 5FKNA 4DZPA 3S1MJ 1Y1WJ 3GTKJ 5EF6A 4DYCA 2DA7A 1JJ8C 5J1YA 1K61A 1OFCX 2JJ7A 1HLVA 3H0GJ 1JJ6C 1U9NA 5EDNA 1WGXA 1IRZA 3CDLA 2CQQA 4MLOA 1TWAJ 2XPVA 1ETVA 4V2FA 1ZR4A 1GDTA 3M3YJ 1I6HJ 3BTJA 3HOVJ 2K9SA 4FE4A 1JTXA 3LOCA 4QIWN 4IEJA 3LSRA 2VPRA 4W97A 4C3HJ 4UUSB 4RDUA 2LKXA 3SJMA 4M3GA 4C3JJ 1IDZA 4M6VA 5IP7J 3HB9A 2XSDC 5EZGA 1T33A 2XPWA 3BR3A 3E7LA 1NK3P 1CQTA 3Q0UA 2PMZN 5IOZA 2R5ZB 2OF7A 4CYCB 3GTPJ 3S1NJ 2DJNA 1MSFC 2ID3A 2FQ4A 3Q0WA 1JTYA 1A6IA 2TRTA 1ZR2A 1VI0A 2DA2A 4A69C 1PUFB 5M3FJ 2O9LA 5EZHA 5BNGA 5C4JJ 3HEFA 1FTTA 5EGOA 4A3GJ 1VNDA 5F04A 1R9TJ 2O8KA 2IAIA 2DTZA 2M34A 3RZOJ 3HOXJ 2K9QA 3BTCA 2XPUA 1GVDA 4L5EA 5FLMJ 2MW8A 4M3BA 2LK2A 2GM4A 1T56A 2O7OA 2JMWA 3FKIJ 3JRAA 3BR0A 3HM5A 1O4XA 1JT6A 3NAUA 3GTMJ 1K83J 4DW6A 2NOGA 5DS9A 1YRNB 3JRDA 4MIMA 5M3MJ 3TP3A 3ZQHA 2NS8A 5E3OA 1MH4A 4M3FA 5M5XJ 5M5YJ 3LSPA 2WV1A 4AYBN 4A3LJ 3MVPA 1SFOJ 4I6ZA 1I50J 2KDZA 3HOYJ 4A3BJ 1ENHA 5K7HA 2E2IJ 3OOUA 3MN2A 1HDPA 1ETQA 2LFBA 4IHVA 3I4NJ 2Y9ZA 3BG9A 2R5YA 3S14J 2D5VA 1OCTC 2EBIA 5IYBJ 1HDDC 3G1MA 1WI3A 2EQRA 3QPSA 3B6CA 5F08A 3S2DJ 2LVSA 5C4XJ 1TWFJ 4JX6A 1BW5A 3O8HA 2FX0A 1QVTA 2IEKA 2R7ZJ 5EGOB 2H1KA 1MBFA 2FD5A 3D1NI 5J1RA 3QPLA 2L0KA 2P81A 2DMQA 1B72A 3BG5A 5F0CA 4S0HB 1TWHJ 2HQ5A 1MBJA 2EZIA 4QTRA 3PO3J 2L9RA 2NVTJ 1JKOC 5GP9A 1FEXA 1DU0A 3H3VK 2L7ZA 1MBHA 4A93J 3FK7A 2LLKA 4QSHA 1HF0A 5IP6A 4M3EA 1RETA 3FISA 9ANTA 2CRGA 5J3LA 1FIPA 2ID6A 1HOMA 2W48A 3OSGA 2MSYA 2HI3A 3DEWA 5K7ZA 4B1RA 2HOAA 2L7FP 2N8GA 4JX4A 1RKWA 3ZOBA 2DN0A 1GV2A 1OCPA 1RR7A 2EH3A 4JP0A 5F0FA 4FTHA 1ZGWA 4A3DJ 1ETXA 2M0CA 4D7NA 1JGGA 3A02A 2VUMJ 2EZLA 1ETOA 1U9OA 4XRMA 3PO2J 4C3IJ 1JKPC 1S7EA 1NTCA 4D5FA 5IYCJ 4A3MJ 1Z0XA 1Q1VA 2R5YB 2ME0A 5FKLA 4X6AJ 1P7JA 3MKLA 4XRSA 1W0UA 2Y31A 4GFBA 3BTIA 3FK6A 2WB1N 2R92J 2VKEA 1RKTA 3A03A 1B8IB 3O8GA 4V2GA 3ZQIA 1ZKGA 4BY7J 1QVUA 4MO7A 5JLXA 3BQYA 4ABZA 3BTLA 2E2JJ 1VFCA 2E1OA 3HBLA 4A3EJ 1H88C 1IG7A 2EZKA 1GUUA 2X6OA 1ETWA 3S1QJ 3JR9A 3LSGA 1XC5A 3GTLJ 4W1UA 1JKRC 5IOYA 3GTGJ 3HGYA 2JA5J 3W6VA 4BKXA 1IUFA 5IPAA 3CCYA 2JK3A 1B72B 3S17J 4D7MA 1W0TA 2DA4A 1X2NA 2MG4A 1AHDP 2XB5A 3JRBA 1LFUP 2COBA 2CUFA 4HNVA 4BY1J 5E3LA 2AHQA 1FTZA 2MGQA 5IYDJ 5FLVA 1IC8A 2G0EA 4XRSG 1AKHA 2JN6A 2GLOA 3CQZJ 1BJZA 1GV5A 3IV5A 2HOTA 2XRLA 3VPRA 1F43A 1HCRA 1IGNA 2L7MP 5IP9J 2HYJA 2XGEA 2JWTA 2TCTA 1MBKA 2YUSA 3I4MJ 1D5YA 2VI6A 1NK2P 3BQZA 1LE8A 5EYRA 1UG2A 4DZJA 3LSJA 3JRFA 4M3DA 2NVXJ 1WPKA 1DU6A 4B4CA 1MBGA 1XG1A 2M9HA 1IDYA 3S16J 3BR1A 3SDGA 3RQIA 5GPAA 5JLWA 1BW6A 2JA8J 1P7IA 4UUTA 1JT0A 1IV6A 1ITYA 2CU7A 1H89C 1WH5A 2GBYA 2X9DA 4EEFG 4FISA 3LNQA 1JUMA 2QF7A 2HXOA 5K7FA 2NVYJ 3NARA 2DA6A 5FJ8J 2DMPA 3A01A 3TW6A 1GT0C 1MSEC 1TC3C 3S2HJ 2YS9A 4BBRJ 5C3EJ 2DMTA 4MFDA 3G1LA 2M2EA 3BR5A 1RPWA 1H8AC 5E3MA 2LY9A 3HOUJ 5C44J 2Y0SN 3IH3A 2DMNA 4XIDA 2HOSA 1VF9A 4JYKA 2LD5A 2Y2ZA 3JRHA 4I76A 3CMYA 1ZQ3P 3BR2A 1TWCJ
chains in the Genus database with same CATH superfamily
3ZQFA 3CC4I 2ZO4A 2JSCA 2ECCA 1ORKA 3DKWA 4A3JJ 2CO5A 2FOKA 3HGGA 4BNCA 1JUSA 5FKMA 2QBYA 4AUXA 2NS0A 5DUKA 1QPMA 1T0FA 5H2FC 2R7VA 4KT5C 2CQKA 4XN0A 4AC0A 4A5NA 1J75A 1QQIA 1IAWA 1RNLA 2QWWA 1VQ4I 1R22A 3OR1C 1NG7A 3GXOA 3DFGA 4I09A 1QZZA 3ZMUA 4D1QA 2I5UA 1YS6A 4PGGA 2M8GX 3IH2A 2DO7A 2K40A 3W2WA 2QCOA 2FOWA 2AO9A 2O3FA 4BUPA 5DCMA 5IY5H 4C30A 4RMNA 4RLQA 3K2AA 4XICA 5L3EA 2Z99A 2B63J 3GCMA 1ZGJA 3AFHA 2EV6A 4IXAA 2K9NA 1ON1A 1YQAA 2CQNA 3RKXA 1YX3A 2M1BA 3CUOA 1SFKA 2DA5A 1XSDA 3N05A 3A4CA 5F1JA 2KIMA 2WY7Q 3I59B 5F27A 2DI3A 3OL3A 3AG2H 2X4HA 3GX4X 2NVQJ 1WJEA 3OIOA 5AIPA 5FKOA 4YFXF 4M6YA 4A0ZA 2VE8A 3WTVC 3IWFA 1LVKA 3HDDA 2DT5A 2ZC2A 4YIRX 1KQ0A 3CTAA 3RQ4A 2VASA 4OMZA 3JSOA 3DWLE 1YI2I 1OR7C 3CDIA 1Z6TA 2H6BA 2P5KA 3QRFF 2RKHA 3M4OJ 3PQJA 3DTIA 2LP0A 2X48A 3ZMVA 3QU3A 1Q1HA 3G1OA 4YIIA 2ELKA 1UB9A 1G8XA 2FRHA 2JZYA 3KZIC 4A3CJ 1ETKA 1BI3A 3H92A 3WGIA 2L54A 4O6JA 1T0FC 2DFFA 4C2MJ 1MDMB 2FNAA 3DCFA 1VZ0A 3TEDA 2JA6J 3HRTA 2H09A 5JVTA 3EETA 2K9LA 3HZJA 5E1XA 4D0PA 2H94A 5LHIA 5ILSA 1BI1A 1X19A 3K1PA 2MC3A 2H8RA 2KRCA 1P4AA 2YSRA 4D5CA 1SANA 4WXDA 3FIWA 3HOSA 2KMUA 2KIFA 1S3JA 3DEEA 5B1BH 3OYGA 3ZQLA 1J2XA 2J5OA 3S3OA 4ASNA 4NQWA 4A5MA 3WHBA 1WJBA 1Z9CA 1VQ8I 3OYBA 3BG6A 1I3QJ 3PQKA 5HS8A 3VEPA 4BXUA 4FCYA 2VL8A 4YIFA 3GZ6A 1BA5A 2R7DA 4CSWA 2LTPA 2YU9J 3DV8A 3S2WA 3BR6A 1MZBA 1YRNA 3S1MJ 5FKNA 4DZPA 4BH9A 4ZZLA 1BM9A 2DA7A 3LAPA 3BZCA 3ZQ7A 2NYXA 2OZUA 4BDZA 1W4MA 4EJVA 4HDVA 2JRTA 2OC6A 4BE1A 1JJ6C 4IKFA 3CDLA 3WTWC 4M73A 3WODF 5DV5A 3JCUC 2OD5A 2IRFG 1ETVA 1OMIA 2GAUA 4BE0A 1KGSA 3KLNA 4K2EA 4MEYF 1KU3A 5ICGA 1FC3A 4AWXB 1R36A 4UUSB 2RQQA 3TO7A 4RDUA 2M45A 1UCRA 3OIPA 3SJMA 1IDZA 4M6VA 4R1HA 3TDUC 3K4BA 3JW4A 4HX8A 4BS9A 4PJ0C 2PJRB 2Z9OA 1U2WA 2OUMA 4HSTA 3SHFA 4E7SA 3P9IA 4HV6A 5A2QK 4CYCB 4AM3A 1DUXC 2EFPA 1JTYA 3T0YA 3K69A 1ZR2A 1MJAA 2V9KA 1WZ2A 2GIVA 5L3CA 3WU0A 1T2KA 2O9LA 5EZHA 2ADUA 4BEHA 5KNLA 5C4JJ 3DP7A 5E20A 1FOXA 5EGOA 2X51A 1IXRC 2O8KA 5CVIA 1R23A 4ESBA 3BTCA 4CCKA 5FLMJ 2ZSHB 3BR0A 3HM5A 4P5OA 4AYBA 1O4XA 1W7PA 3NAUA 4OIQF 2JVHA 2L9NA 1W7PD 1FBQA 1USTA 4PDKA 2XF6A 4H4KC 3LSTA 2BE5F 3N4MA 3WTSC 1FMVA 2H6CA 1CF7B 1MH4A 4M3FA 3KYLA 2R7RA 5B1AH 4XBFA 3I5UA 5J47A 2E1NA 1QA6A 4XKWA 4KDPA 4LIUA 2I8DA 2JPCA 1ZRCA 3WG9A 1TBXA 3LWFA 4XORA 3X2QH 4B47A 3ASNH 3FXJA 3FXKA 2OTJI 1I50J 2XC7A 4IRIA 1M1EB 2R3SA 4A3BJ 2CSOA 1YW9A 4II2A 1P9QC 3T1BA 1F5TA 3CD6I 1UJ8A 3MN2A 3OOUA 1K4TA 3PJRA 4IHVA 3I4NJ 2Y9ZA 4UXNA 5HLHA 4YRVA 2ZBKA 3V8LA 4XL9A 2LC2A 3CF2A 1SC7A 3GFJA 4M9XA 4WX9A 1FLIA 2WWYA 2HZDA 1KONA 4PK4A 3B6CA 4LG0A 4OWRB 3GFIA 5DEQA 3FWEA 3T8RA 1J7KA 3K4NA 1E3PA 3KP5A 3GWZA 5C4XJ 3QWLA 1N75A 1TWFJ 1LKXA 2K3PA 2LDUA 2FMLA 2EINH 2IEKA 2P7CB 4ZZDA 1PDNC 2CFXA 2F5VA 1ON2A 3A1YA 2JQ7A 2DOAA 4HG2A 1ZHFA 3D1NI 5KAIC 3IC7A 1STZA 2DMQA 2GIZA 3I71A 3MKWB 4FQGA 5F0CA 3VYSB 4QTRA 2JUCA 3OR2C 2R7UA 5E8GA 4LLNA 2L9RA 4M9SA 3OWTA 2IVMA 1BR4A 5JVGF 4CDGA 4A93J 3E6BA 3FK7A 1GXQA 4V19K 2V9VA 2X1CA 2P6TA 3HTSB 1W5SA 3HUGA 5IP6A 5GADJ 2QSHX 9ANTA 2XRNA 1FIPA 2DDAA 4L9NA 2MSYA 2GZWA 2A69F 5HLGA 2JUGA 3H5RA 5LBQA 3VSLA 4RB3C 3TBIA 3D5SC 1BOBA 1XGMA 4B1RA 2DT6A 2HOAA 5TGTA 2WV0A 1RKWA 1GVJA 2DN0A 1O3SA 4EV0A 4P9FA 4U0WA 3AG4H 1OCPA 2EH3A 2BYVE 4RAYA 4A6EA 4A3DJ 1ETXA 2RDPA 2L7KA 2XV4S 2M0CA 3QYEA 1MD0A 1QZYA 2VUMJ 3DBLB 1U9OA 1IN7A 4C3IJ 2HVQA 2R7TA 2NNYA 3RSNA 4A3MJ 1Z0XA 1EA3A 2DDBA 4EM1A 1HSJA 1XX5A 1P7JA 3MKLA 1W0UA 2Y31A 3FMQA 3BTIA 5HLIA 5AIQA 3FK6A 2L9SA 2WB1N 4D9JA 2P8TA 1WQ2A 1VQ7I 1MMDA 1UHWA 5KHDA 3CCLI 1FPQA 1RUOA 4XONA 4HNTA 3CCUI 1BC8C 3LA2A 5EJCA 6PAXA 1OLTA 2DJIA 3V7CA 2NXNB 4KA4A 3V4GA 1D1CA 2OV7A 4CCLA 2TDXA 3JR9A 3HPGA 2CFOA 4XLNF 3I55I 1KYWA 3HHGA 4F7ZA 3GTLJ 3MZHA 1XB4A 3KE2A 1JKRC 3R0AA 2E7WA 3HGYA 4KUMA 2JA5J 3GTGJ 1L0OC 4GCVA 2VOOA 5ICCA 2QM3A 4BDYA 1X2NA 3ONQA 4N9HA 2RN7A 2CUFA 2XKPA 4BY1J 5E3LA 4RA2A 4XM3A 4QPQA 1GLNA 1FTZA 1T6SA 4DJAA 3KP4A 5HOOA 3F22A 2KLOA 2X85A 1QHGA 4H0EA 2F5CA 3JAMK 3CQZJ 1BJZA 4RAGA 1HQCA 2MYSA 4QPOA 3VPRA 3MEXA 1U3EM 1P92A 2DYSH 2QLZA 4PJNA 4XSXF 4CXFA 1LDJA 2XGEA 5FO5A 1YJNI 1WJDA 5BS6A 1DP7P 1ZRFA 1UHMA 3BQZA 3W3CA 2QA4I 2DAOA 5EYRA 3JRFA 4PZJA 1YJ9I 2QQAA 4Y15A 4B4CA 4OOIA 1XG1A 2RNGA 3D5LA 3LFKA 3AKZA 1HA8A 2ZJ2A 2ZFWA 1W36D 1YIOA 2FXAA 2Y0SA 1ACIA 1ZYRF 2KP6A 2FU4A 2CYYA 4XLAA 3TGNA 3I59A 2HXOA 5K7FA 1SD4A 2M7BA 1MSEC 1ZN2A 2DMPA 3ULQB 2XAUA 5C3EJ 3PIOF 1D3YA 4PFPA 4L5IA 4S05A 4HV5A 2P4WA 5D5WB 2QZ8A 5DD4A 1GXPA 2LY9A 4MTDA 3RPQA 3K4MA 5C44J 2VBXA 2VQHA 4E4HA 3PL8A 3HG9A 4BU2A 1ZG5A 2A07F 4S04A 4IVNA 1MMAA 3KYCB 3JRHA 2ZJPF 4I76A 3LL7A 2VQGA 1SVMA 2LMDA 3M7GA 3BR2A 1XCBA 3CMYA 4I6ZA 1ZQ3P 3TW7A 4NBQA 2DOFA 4IHWA 4JBAA 3M1CA 2GA2A 2IT0A 1MDMA 1I5ZA 2HXIA 3VYRB 2G7HA 1TQIA 4R79A 3HIFA 1FSHA 2ECBA 2IS4A 1HKSA 3CCVI 2MC4A 3HKZN 4J19A 4G7ZF 5ICFA 2OPTA 1ZTRA 2ISZA 4F52A 3CUQB 4ANJA 3V8KA 1RESA 1U8BA 1TW2A 4KN7X 4B43A 1X58A 4A3FJ 2DA1A 3VB2A 1BC7C 2KFDA 1VQ9I 3MMYB 5E18F 4A12A 3G6EI 5M5WJ 1X3UA 4JOMA 1FYKA 3SFIA 4EJTA 1QPIA 3QYBA 2F4MB 1LE8B 2ZNZA 2DA3A 2E19A 1IRXA 2F5FA 2KZVA 3HOZJ 3S3MA 4RB2C 1ETYA 3FBIB 3IWZA 1U5TB 2XAFA 2Y30A 5KK1A 1RR8C 2K5CA 3L1PA 1R6RA 5FGMA 3IAM2 3IHUA 1YO5C 3AG1H 2JT1A 2QUFA 3BZKA 2IS1A 2FQ3A 3LSKA 3BG3A 3JRCA 2ZJRF 3M8JA 1Z77A 3OYDA 2WA0A 2NNNA 5J8CA 5F1RA 1NH3A 4HBLA 2W85A 3VFZA 1WJCA 3A01B 5FB2A 3K7AJ 5CQGA 4ON0A 3G71I 1J09A 3ECOA 2DFHA 2ZB9A 4P1WA 3OS1A 3M07A 2E1MB 4CA0A 4ZTFA 1Y1VJ 1POGA 2I10A 4UB8C 3S15J 3B02A 2R7WA 1Z6RA 2L4MA 4B3AA 2O03A 2HVSA 2RGVA 3GMEA 1E0EA 4L9JA 5IT9Z 4AU7A 1IJWC 1MNMC 4FX0A 3PUFA 4NDLA 4UUSA 2WAQN 3HSRA 3J7AY 3V42A 1QRYA 3OYNA 4E6KG 2PJRA 2M87A 2KDOA 2G7UA 3B6AA 4CYCA 5B66C 2IBDA 1U78A 2BW3B 1X4OA 3F72A 1SD7A 1BR2A 1MH3A 2WTEA 4FETA 2GXGA 1YW8A 1Y39A 2VLAA 3C2BA 4YFNF 3RDIA 5D6EA 3WGGA 3HOWJ 1LFBA 2EIKH 3TL4X 2F4IA 3CJQB 2A6HF 4TV7A 1IUYA 1RZ4A 1MKMA 3SYTA 5ICEA 2LSOA 4MFEA 4A3IJ 1A5JA 2DMUA 2DK8A 1K4SA 1BI0A 1T95A 2Z1DA 5KCMA 4OINF 2X1DA 4BBSJ 1WH7A 1FZPB 5K5QA 2CUEA 2CJJA 4Y7NJ 1K78B 3E0JB 3WHCA 3FHZA 2V1UA 5BPIA 2DQLA 1IXSB 3Q3SA 1WI9A 1MGTA 5HLTA 2OCCH 5J6XA 1Y1WJ 2EV5A 1JJ8C 1CF7A 3DQVC 3DLLF 1F9NA 4ENJA 1OKRA 1XGNA 3MD2A 3NWSA 1FOWA 4UV8A 3J81K 4IOCF 2DFEA 2VBYA 4EVIA 4M72A 2E34A 2XPVA 4HPQA 2C6YA 4FX4A 5FLXK 1MNEA 3HOVJ 4FE4A 2QEXI 1R5ID 2OU2A 3EUKL 2W57A 1BIBA 2OZ6A 2QKLB 4IEJA 4BJ5C 4W97A 3KZZA 4MHGA 3LSRA 2IW5A 3CO7C 2LKXA 5LD2C 3TO6A 4M3GA 4C3JJ 2XSDC 2VJ4A 1E3HA 1QZEA 3E7LA 4LIVA 2EB7A 3Q0UA 2PMZN 3M8EA 5IOZA 1YFHA 3DEUA 2MA3A 2OF7A 3GTPJ 1XSXA 2DJNA 2ZKZA 3DPLC 5H20A 3KETA 2FQ4A 2HOEA 4IF4A 4LK0F 4NC8A 1I3AA 3OY9A 1IRGA 2V9PA 4ZC3A 3W6JB 1LFPA 1PUFB 4C2TA 5BNGA 2PI0A 3LQQA 4I0AA 1D5VA 3FXUA 1WFXA 4CGZA 4RB0A 4A3GJ 1ZG3A 3D5RC 1ZELA 2STWA 4LLLA 3RJPA 2CW7A 2DTZA 3FM3A 4EMSA 3HOXJ 1MW7A 1EV7A 4XLFA 5D6FA 3T8TA 3ZMTA 2Z33A 3J80Z 2NOJB 2R7SA 1RUNA 2LK2A 2O7OA 2JMWA 3FKIJ 4U7DA 1FYLA 5H6RA 2MBFA 4DIQA 3OYLA 1UFMA 1N77A 2W1OA 5LRRA 4KNYA 4DW6A 5CKTA 3VYTB 1WVRA 1SFXA 3JRDA 2D2WA 3TP3A 2LG4A 2NS8A 4XKCA 2D45A 4OAZA 5M5XJ 2CV2A 1FOKA 1FY7A 3LSPA 2BVMA 2VT2A 3CO6C 4A3LJ 2IS2A 3MZ8A 3MVPA 1KA8A 1SFOJ 1X1AA 2LKPA 3P7NA 2K7LA 2KDZA 2HZTA 4NNJA 5ERIA 3PFIA 1FOYA 2K85A 2ICWG 4EM0B 3DTKA 5J4YA 3OYEA 2LFBA 2VJJA 4BE2A 2AQEA 2BXZA 3BG9A 3Q9SA 4F92B 1B4AA 1S6LA 2D5VA 2W4SA 1HDDC 3G1MA 4ITVA 2EQRA 4ZYDA 1FP2A 4RAZA 5LRSA 4MQVA 2V1DA 4Y4RA 3CP8A 3O8HA 3QOPA 2VT3A 5GTIC 2H1KA 3RIRA 2VE9A 2AXLA 2FD5A 2IXSA 3H36A 4G6DA 1KQ9A 1SAXA 3U9GA 2K9MA 3QPLA 5CVRA 5D8KB 2V79A 2M3AA 3DLAA 3OYAA 2B9SA 4CCOA 1TWHJ 2HQ5A 1LDDA 2Z16A 3TQNA 2FEZA 1W5CC 5L3BA 1JKOC 5GP9A 1W5TA 1BOAA 4I02A 2FBIA 1FEXA 2QKMB 3F3XA 3H3VK 2X6WA 2L7ZA 2W84A 2X6XA 2P7VB 2R7XA 3FX3A 2V26A 1XCVA 1HF0A 1G59A 2RVCA 4LFUA 3CMEI 4XKBA 1PJRA 2VIXA 4M3EA 2CRGA 5J3LA 2ID6A 2M8EA 2W48A 3OSGA 3BOQA 3HC7A 5F64A 1K79A 2HI3A 2BY0A 1FX7A 2DT7B 3DEWA 5K7ZA 5HDKA 3ROUA 2L7FP 4RB1A 2XAHA 1JHFA 1H9TA 4AVPA 3PNTA 1IN5A 5HDNA 5FRNA 4LB5A 4DBRA 5F0FA 3K4CA 3IRRA 3COAC 4J01A 3A0BC 2W7NA 3TO9A 1UELB 3A02A 4XLPF 2BV6A 1LEBA 4KIBA 4L18B 1ETOA 4XRMA 2HS5A 2W24A 4E70A 2NRAC 3A2KA 1S7EA 3K6GA 5IYCJ 1BI2A 2R5YB 4NB5A 4X6AJ 4XRSA 2GQQA 4EQQA 2K4BA 4GFBA 3QP5A 5BOXA 1Z7UA 3KP6A 2M0MA 2E60A 1RKTA 1S29A 4BY7J 4OAYA 3VYUB 3KEOA 1QVUA 4ZTJA 3BQYA 1U6GA 3K4LA 2OBPA 4A3EJ 2P0WA 2IA0A 4FASD 2EZKA 2X6OA 1PP7U 3OMYA 3LSGA 4HF1A 2XKOA 1BN5A 2GXAA 3QOEA 1R4NB 4WXCA 2K4JA 3R0JA 4WCGA 3W6VA 2WAQA 1IUFA 1IN6A 2HDWA 4B48A 3GFLA 4M74A 1Y8QB 1RI7A 4N0BA 3QYFA 2UUZA 2XB5A 3JRBA 2COBA 1LFUP 4RS8A 1V4RA 3F8CA 5E1ZB 3OYKA 2AHQA 1Z1DA 4IHSA 2AS5F 3EYYA 5CVJA 1VQOI 3G4SI 1WJFA 3WGHA 2JN6A 3CUQA 1GV5A 3IV5A 5DUIA 4ESFA 3BJ6A 2PBIA 3OYMA 1HCRA 1IGNA 3E1SA 1XN7A 3K9TA 2L7MP 1O3TA 2VOPA 3BJOA 3G3ZA 3F21A 3BC8A 5D5VB 2H27A 2GXBA 2JVGA 2PN6A 1L3LA 1IV8A 1IW7F 3S32A 1LE8A 4EGYA 4O3MA 1WJ5A 2XF5A 2MH2A 2YR2A 3LSJA 2UXNA 2VC0A 3NEUA 2NVXJ 2EIMH 3CCJI 1DPUA 1DU6A 1U5TA 1MBGA 3BROA 3V7SA 2ZNYA 1IDYA 2OQRA 3BR1A 2B7EA 3OIQA 4L9VA 3T5XA 1V55H 3CCSI 1IN8A 1V5GA 1J59A 2JA8J 2OQGA 2EA4A 1WH5A 4IQ4A 2GBYA 3L2UA 2MD0A 2DXIA 3FXRA 5LEJA 1D1AA 2DA6A 2LF8A 3A01A 5DD8A 1AOYA 2YS9A 1I27A 1P6RA 2LOOA 4BBRJ 3HJEA 2GOMA 1Z91A 5IT3A 4MFDA 3HXLA 3G1LA 2M2EA 5JFRA 3CP2A 4HNUA 1P4XA 4XNFA 1RPWA 1UG0A 2ESHA 4Z2YA 2UXXA 3LA3A 4LGWA 3HOUJ 4I01A 2A6EF 2P6SA 1DDNA 2A05A 1A04A 3GZNB 2HNHA 3ZN0A 1SMYF 4PUSA 2WADA 4CZCA 2DMNA 4KICA 1Y0UA 4N9IA 5HNFA 2RREA 4JYKA 2Y2ZA 3ISPA 2IS6A 4LD5A 4F3QA 4IZZA 4GXOA 3RZDJ 2QGUA 3DKXA 1EH8A 3ECHA 2UWMA 1UHSA 2DFIA 3CUQC 2DK5A 2BW3A 5CQEA 3LAJA 3GTOJ 3F8MA 3K1NA 3ABTA 5K5RA 3QQAA 3M8FA 2V6EA 3RPUA 4GRIA 2HDCA 3CC7I 3WTXC 1OJLA 1X3ZB 1BR1A 4A3KJ 2E5ZA 3CCEI 1LUJB 2YX7A 2QSGX 3GEZA 1X3WB 4U87A 2GWRA 2X6YA 1TQMA 5DTDA 1Y8RB 2Y9YA 2Y75A 3VOEA 1PVEA 1JKQC 3DBHB 1U5TC 5LHHA 3OS0A 1Z67A 5LHGA 1HW1A 2P5VA 5GAHJ 5TJJA 2F2EA 3W2VA 1W1WE 3E5UA 1TWGJ 4AIKA 5K1YA 3WTZA 2E5NA 5FRMA 3U2RA 4XLHA 1XS9A 2JTVA 4FE7A 4P55A 4A2UA 1K78A 1USSA 2LNBA 1H9GA 1KU2A 1ULYA 5E1WA 4Q5SF 3V7RA 3CLQA 3HSFA 3FZVA 3BPXA 4BXXJ 2E1MC 4XK4A 3RTRA 1UAAA 4MTEA 3WE2A 2YX4A 3PSFA 1TP4A 2L4AA 3W2AA 2IA1A 2CW8A 1J0RA 3PM1A 4O5VA 4L0YB 1K7AA 1B6AA 2HDDA 3KP7A 3KP3A 3GO5A 5JI6A 5HVQC 1APLC 3GTQJ 2YU3A 2KRHA 1KU9A 1VQKI 4PJMA 3HL2A 3JRIA 2AXTC 3F8BA 3OOPA 4HRIA 4UVCA 2KISA 4YELA 2JA7J 2XVCA 3HRUA 3LFUA 5D8LB 2X1EA 1A35A 2DW4A 2VQLA 4ZH4F 3OYCA 2F48A 2HPIA 1HXDA 2XGXA 4M9ZA 4X1EA 1VQNI 2VB6A 3MQ0A 2KIUA 5D5XB 2ZJQF 3SZPA 1WCMJ 3OL4A 2CW0F 4WXHA 1ZK8A 3F9KA 3ZQQA 5J1UA 2XASA 2LR8A 4CO8A 1PUFA 4PGHA 2EZHA 2VKVA 2KT0A 2EJRA 2DPUA 5EG0B 1LNWA 3TP0A 5CLSA 1E3OC 1Y6IA 4HF0A 4L9TA 4PFOA 5GTHC 3BT9A 2R0QC 1F1ZA 1B8IA 2CQXA 2FMYA 1ERDA 1GHCA 3S1RJ 1TQPA 3FF5A 1FBSA 2PMHA 5LLQA 1EF4A 1Y0NA 3R61A 5HODA 4IPAA 1PYVA 3GYHX 1QHHD 1S9HA 1I1SA 5JHUA 3ZQGA 2K02A 2OAZA 3GF2A 4G7OF 3Q0VA 4CZZA 3HTUA 5GPCA 1PUEE 3GTKJ 4DYCA 4KT6A 5J1YA 1OFCX 2JJ7A 3QAHA 3H35A 4Y17A 1IN4A 1Z7LA 2RC4A 4EATA 2P5LC 1R00A 5LFAA 1T98A 3H0GJ 1WRJA 2RV8A 1U9NA 1ZRDA 1IRZA 2DODA 1OYYA 1TT0A 3BY6A 3EPZA 4RLFA 4MLOA 1SFEA 2IGKA 2EFWA 1U0JA 2V7FA 4XSZF 1LPQA 3M3YJ 2PG4A 2FNPA 2ZXJA 1I6HJ 3IP4B 1JTXA 1WSUA 3LOCA 4C9YA 4QIWN 4P96A 3AL0B 2FUG2 2R4GA 2VC1A 1FMWA 4C3HJ 3CMAI 2V1XA 5IP7J 3HB9A 5EZGA 4DOZA 1U8RA 1ODDA 1T33A 5GAGJ 3P9CA 1NK3P 1CQTA 2HQNA 3MCZA 3HRMA 2R5ZB 4IRGA 3GLXA 5EEHA 4XQFA 1FYMA 3EUHA 3MKZA 4MEXF 1A36A 3S1NJ 2ID3A 2BHZA 2TRTA 1VQ5I 2ZSIB 4BXFA 2HTSA 5L3GA 1HW5A 1VI0A 4LJZF 2DA2A 4A69C 3I58A 3L09A 1X4PA 5D4RA 1KZHA 3PNYA 3HEFA 1FTTA 2UV1A 4XN3A 2VPLA 2M4KA 5D5UB 4YFKF 5F04A 5HNHA 1R9TJ 2IAIA 2M34A 2MD5A 2NVUB 3ESWB 2K9QA 3HHHA 5KAFC 2XPUA 2Y0MA 2MW8A 5DCFA 4M3BA 3SZGA 1D0YA 3R4KA 2GM4A 1T56A 2QENA 3JRAA 1JT6A 1G6NA 3GTMJ 2FE3A 2V1NA 4XR6A 4Y3OA 1B9NA 5J4VA 2E35A 1IO2A 2NOGA 4UNOA 5DS9A 1YTYA 1Z3XA 4E7JA 2OA4A 4MGRA 4IQJA 2PJPA 4G9YA 4R8HA 4P9UA 1Z21A 5M5YJ 2HFHA 3H5AA 5FFZA 2QVOA 3PSIA 2WV1A 4AYBN 4UY8I 1SD5A 3TDZC 3J7ZI 3L2VA 1OQYA 4HYEA 4KITB 2ISYA 4I99C 2XAQA 3K0LA 3JSPA 3KPHA 1YLFA 2W25A 3BP8A 3HOYJ 5K7HA 1DP3A 4BHBA 2ELJA 4PJLA 2IGMA 4BHCA 1HDPA 1ZREA 3FKJA 4BQAA 2R5YA 3G73A 3I4PA 3EUHC 4L0ZB 2EA2A 1OCTC 3R6SA 2EBIA 2HYGD 1J5YA 1LVAA 1WI3A 1MNDA 2W82A 4HEA2 3UNGC 2BY3A 5F08A 2WBMA 4B3XA 4YEJA 2JSPA 1TNSA 4JX6A 1BW5A 3ZXSA 1NG6A 3C3WA 2CS3A 2FBKA 3F6OA 2FX0A 4II3A 1QVTA 3S3NA 3A0HC 1TL8A 4G7HF 2VONA 1R71A 1MBFA 4MQ9F 4XLEA 2EFQA 4BJ6C 3H3UA 5J1RA 5EEGA 2P81A 2W00A 1DPRA 3BG5A 3VWBA 1QBJA 4UVBA 4S0HB 3KCCA 3RYPA 5E8IA 1MBJA 1FSEA 4EJWA 2EZIA 3CLOA 4FHTA 1FP1D 2CMPA 3PO3J 2NVTJ 1OCOH 2MABA 1OCRH 4UB6C 5F6FA 4A0XA 1T39A 1R58A 1LEAA 4AIDA 4HA8A 2L9VA 2XF7A 5TISC 1RETA 5DYMA 2VBWA 4EGZA 2JA2A 5FROA 1X1CA 2HWVA 1WJAA 3C2HA 1BBYA 2N8GA 2ZCWA 2ZXHA 4JX4A 5ILVA 1YJWI 4RGRA 2WB1A 3ZOBA 3FDYA 4U7BA 4X0GA 1TNTA 1XGSA 2Z3YA 2OJED 3H9QA 3LA7A 5CJ9A 1A31A 1VQLI 3KIOA 2BY1A 2LKSA 4FTHA 3NRVA 5JHFA 3REOA 3MKYB 3FMRA 4D7NA 1HSTA 3FXOA 5CPRB 2EZLA 3PO2J 3MWMA 1JKPC 3WG7H 3HOTA 2E1CA 5IT9K 1NTCA 1OPCA 4LK1F 3SEZA 2LREA 2ME0A 4G6TB 4CCMA 2M4GA 4OMYA 4AIHA 2NAZA 3A03A 1B8IB 4LG3A 2IGNA 5JR3A 1XD7A 3P5JA 3K10A 4ABZA 4G8XA 3ERED 2DQRA 2E2JJ 3O3KA 1VFCA 4BHPA 2E1OA 3HBLA 1LJ9A 1H88C 1JXSA 2HGCA 1IG7A 1XMAA 1GUUA 2VJIA 4BJTA 1ETWA 3S1QJ 4DGWB 3BG7A 1B1BA 2O61A 2VBZA 3IL2A 3CJTB 3V8JA 3F8NA 4E7HA 2FSWA 2HU9A 4W1UA 2BHYA 1Z3YA 2EFNA 5IPAA 2JK3A 2R7QA 4ZYAA 2LH9A 4IX7A 1B72B 3S17J 2PQ8A 5A2QZ 1W0TA 1KYZA 3DPUA 1X1BA 3OS2A 1AHDP 2DCEA 1YIJI 3W6KB 4HNVA 4RGSA 2QYOA 1ZGAA 3NQOA 4QWQA 1G3WA 3B73A 2QQ8A 3ZMSA 2MGQA 4M71A 5IYDJ 3FHNA 5FLVA 1IC8A 2G0EA 4Y13A 4HOBA 2WAFA 5L3DA 1RIOH 4EJUA 2GLOA 3IKVA 3DU6A 2A6TA 2HTJA 2XRLA 2A3SA 4UHTA 1F43A 4I0BA 3KX2A 2LBFB 2L3DA 1UZCA 1ZLKA 3CZ6A 2HYJA 2XIGA 1SEUA 3BZ6A 1QU3A 5HDGA 2TCTA 4Y33A 1D8JA 2YUSA 2XAJA 1S8NA 2VI6A 3E3VA 4KMFA 1NK2P 2ACJA 3ZPLA 3JTGA 2ZMEB 3HRSA 5E17F 1UG2A 4KIGA 4DZJA 5DM7F 3F6VA 1XDUA 2KQRA 2DLLA 1N78A 3E6DA 1OYIA 5LGUA 4G94A 4HLXA 3E5XA 4N4NB 3ZN1A 2M9HA 4CYDA 3SDGA 3RQIA 3FXLA 2L2OA 3I3LA 1P7IA 4UUTA 1IV6A 2PLYA 4U88A 4IHTA 2X9DA 2VODA 2CGPA 1JUMA 3QPTA 3EQLF 5FJ8J 1TC3C 2HKXA 3TW6A 4DQ2A 3S2HJ 2PFBA 4HQMA 1R1TA 1REPC 2DMTA 2A68F 3TKYA 2DOEA 2EWNA 3BR5A 4KMUX 1H0MA 5E3MA 3O6BB 3PIPF 3Q5FA 3H9JA 2Y0SN 3LMMA 2KL4A 3LQRA 4I2OA 4CHUA 1HKTA 3HKZA 3IH3A 2KPMA 4IJAA 3L9FA 4XIDA 3KFWX 3RKWA 1D1BA 2HOSA 1YS7A 4NC6A 3IRQA 2ZXWH 3PFYA 1O57A 5FFXA 1TWCJ 1JUPA 2EPFA 1O3QA 1D0XA 1UMQA 1FT9A 2LYCA 2RNJA 1FWZA 2O0YA 3J80K 2BVLA 4Z6YA 1YG2A 3GBGA 2IP2A 2KKOA 3C2GA 3EYIA 3K70D 1AKHB 2NS7A 1KQ8A 3OYJA 1E2XA 4DYRA 4ETSA 1G2HA 4G12A 4CH7A 5EG0A 4Q48A 2E36A 1XMKA 3KLOA 4RM2A 4BQNA 3S93A 3BCAA 1MJ9A 2XGDA 3UKGA 3QPHA 2R7OA 4AD9A 2XDVA 2PX9A 2QQBA 3GVAA 4F91B 2IGOA 1F36A 3DXJF 4RBOA 1QO0D 2R93J 4AVZA 4YG2F 1I6XA 1S72I 1FJLA 2CG4A 4L5JA 2DU9A 3QP6A 3IH4A 4UV9A 2Q2EB 3C1DA 4IHXA 2GOXB 1V3FA 1DQUA 5D4SA 3RI4A 5ILUA 4HQEA 1EH6A 3J7YJ 1K6OA 1OISA 3LSHA 1P4WA 3F0CA 4I98B 2E2HJ 2E71A 4KYWA 3IUOA 1R1UA 3L2CA 4E7LA 1R49A 2Q8KA 4KISA 2FF4A 4LLGF 2BOLA 1OCCH 2F6CA 4HF2A 3JREA 2AQFA 2XGCA 3Q9VA 3L2RA 1HC8A 2IA2A 1G3YA 3ZR8X 4EJOA 1MMNA 3WTYC 3JRGA 1MBEA 3S8PA 1LQ1A 3BLYA 1D0ZA 3H9GA 3I0TA 2XB0X 5FD6A 2M7AA 4ZDPA 1V5FA 2XAGA 1J9IA 1O7LA 2WAEA 3ABLH 2UZKA 3EUAA 3U21A 3WTTC 4Y52J 3GTJJ 2M30A 1FIAA 3C18A 1ZLJA 3PNVA 3K70C 1JI8A 2R5ZA 2FJ1A 4ZYEA 1T8IA 2QBYB 2STTA 1AU7A 1R1VA 3CMMA 2Y48A 5EEAA 3VDXA 1NHAA 5FKKA 4BYYA 3KZYA 2PEXA 4IHYA 3CJNA 3ZMZA 1BL0A 2CUZA 3BPVA 4LOCA 1EH7A 3WTUC 4DYQA 2D1VA 2VKHA 2O5RA 4FT8A 3TOAA 3RKQA 5E3NA 4ZDOA 2KIQA 2F4OB 2JRMA 3DTEA 1YYVA 4MNUA 3ZQCA 3H3ZA 4A0YA 5DCMB 5L3FA 1C0WA 1T38A 3CCQI 1X2MA 4RGXA 5J8FA 2RAEA 1XPXA 2VJ5A 5BMZA 2EV0A 2KZGA 3OSFA 3G2BA 2ME6A 4A6DA 3JAMZ 1Y56A 5F0HA 3K1MA 4ENNA 2EILH 1VTNC 4JX5A 3ZMDA 1MMGA 3SFZA 4J00A 3ZGKA 5EF6A 3MZYA 3L2QA 4NUBA 2ETHA 3KEYA 2Y69H 4Q47A 4XLCA 2ELHA 3U1KA 4BGDA 1K61A 2OTLI 4IOAF 1HLVA 3E6CC 3QU6A 3ML6A 1LB2A 3E6MA 5EDNA 1WGXA 1Z05A 1YW7A 2CQQA 4DNCA 3BCBA 2PMZA 4HX7A 1TWAJ 5K5OA 3AL0C 1GDTA 4V2FA 4M6XA 1ZR4A 3M9AA 1TTYA 3K2ZA 3BTJA 5LEKA 2K9SA 4PSWA 1DGWY 4JQFA 3NWTA 2VPRA 1S5LC 1IZ1A 5HS9A 3RPUD 2DBBA 2R7FA 3ZCOA 4XOTA 5LGTA 3AAFA 2X0LA 2XPWA 3BR3A 5J40A 1SFUA 4OIRF 4ZJZA 4IL6C 1V54H 4HZFA 2WC2A 2BY2A 1MSFC 3SQNA 3Q0WA 4UUVA 2CQ7A 1TT5B 1FBUA 1A6IA 1MIJA 2F5DA 1XGOA 2HKOA 4ZDLA 3H5NA 3GZ5A 2CV1A 3E5QA 2XHKA 3UR3C 5M3FJ 5BPDA 3I56I 4E7IA 4LMYA 1R5HA 1VNDA 1R5GA 5DDGA 1HKQA 3R60A 4GGGA 4LB6B 5ED4A 3RZOJ 4NQWB 1D8KA 2JPBA 3DF8A 4XRFA 1X1DA 3C7JA 3LSIA 1GVDA 2KJCA 3JTHA 4L5EA 2B0LA 3GUDA 3VODA 3F8FA 1TW3A 2CWEA 3K4JA 3IAS2 1K83J 2LF7A 1R7JA 3CDHA 3OYIA 4HDUA 1YRNB 4MIMA 5M3MJ 1QNTA 4ESJA 5HS7A 3WU1B 4OU0A 4HX4A 3ZQHA 1G3SA 5E3OA 1PP8F 1OCZH 4C2UA 2KRFA 3SXYA 1I39A 1WKMA 3VSKA 1SVOA 3GFMA 3WU2C 4HSRA 2K27A 5H6QA 4RGUA 3TOBA 5CYVA 1ENHA 2BZTA 3RKYA 2E2IJ 1MJBA 1TLHB 3MAJA 2MLGA 3FXMA 3CCRI 2EK5A 1ETQA 2V4JC 4GO1A 4U0VA 1IF1A 3ABMH 4BQQA 3S14J 1XSVA 1G4DA 3N97A 2MH9A 4UVAA 5IYBJ 3DBRB 2ZXIA 2IJLA 4KN4X 3CCMI 4QLCU 1IRFA 1WHUA 2VKDA 4B8XA 4BAYA 3DKYA 4WK8F 3QPSA 5FD5A 4DBQA 3FXQA 2H8WA 2F5EA 4OIPF 1EKEA 2HYFA 2LVSA 2XUBA 4CCNA 1ZH5A 3ABUA 3WE3A 4KFCA 3S2DJ 1WWXA 5TRDA 2HVRA 4U0YA 1XTAA 4NHJA 4BEHB 1SAUA 2Z5UA 2A5YB 2BEOA 1ZG1A 5LGNA 3OYHA 2R7ZJ 5EGOB 4CCJA 1P2FA 1N25A 1A6QA 1SVLA 4RM3A 3IKTA 2MFZA 2FBHA 3CF5F 5GAEJ 2CH0A 4NC7A 2L0KA 3FM5A 5CVUA 2VQCA 4F55A 1B72A 3DPTA 1X1PA 1V5EA 1KU7A 3L2WA 2EIJH 1HW2A 3CC2I 2L5QA 1FNNA 4KIFA 2Q1ZB 3ELKA 3OYFA 2VN2A 1DU0A 1VQ6I 1W7PB 1MBHA 2D1HA 4GYGA 2IPQX 3SDBA 1BIAA 2LLKA 2LY1A 4QSHA 2ZFUA 3U1DA 2G9WA 3F23A 3DU5A 3FISA 1HBXG 3BJAA 1JGSA 1HOMA 2K3FA 2LBFA 2XSJC 1S7OA 1O7FA 2E7XA 1T08B 2HR3A 4HAMA 4IRHA 5CVVA 1RRJA 3CJRB 2HPMA 2BBYA 5KVRA 5BQTA 3RCOA 1GV2A 1YITI 2HEOA 1RR7A 2CUJA 4AIJA 1YE9A 2ZMEA 4JP0A 4N4OB 1ZGWA 4OIOF 4LITA 2EFOA 4HW0A 1JGGA 3K4KA 1AA7A 3ASOH 2K86A 4RAFA 2LY2A 4B09A 3E97A 3I64A 3RYRA 1S7AA 4D5FA 1Q1VA 2J5PA 5FKLA 4XOPA 3L00A 1EJ9A 3H1CA 1VQPI 2R92J 2VKEA 3KP2A 4WF2A 1R4MB 4CUGA 3J81Z 4ENKA 3O8GA 4V2GA 3ZQIA 1ZKGA 4HLYA 2MLKA 1W36C 2O6GE 3OV8A 3D0SA 4LG0B 2COMA 3LSMA 4MO7A 5JLXA 2RQPA 3BTLA 5FLXZ 4PSXA 4BACA 2M5WA 1LDKB 4Q4ZF 1MMSA 1JHHA 1E17A 1QGPA 2KJBA 1B59A 3AG3H 5E79C 3BWGA 1XC5A 4PJJA 2O8XA 3SEQA 3ZRGA 5B5EC 2XROA 2V6CA 1SMTA 5IOYA 2HQRA 2ESNA 4BKXA 4E7KA 3CCYA 1CGPA 1ZARA 4D7MA 1AWCA 3HSEA 3KEQA 2DA4A 2QSFX 2MG4A 3H0DA 3HYIA 2L02A 4PCQA 1JE8A 4G6QA 4CICA 2Q0OA 4GDFA 3PUBA 3SZTA 2Z2SB 4XRSG 1AKHA 1YOVB 3HUGB 3BDDA 2HOTA 1TZLA 2PMUA 1ONVA 3MFKA 3TMOA 1BJAA 3O2PE 4KJZA 1I1GA 1O3RA 5IP9J 1XDSA 2ZMEC 3EDPA 2JWTA 4BQOA 1YHQI 1MBKA 3I4MJ 1D5YA 3FMSA 4ENMA 2A5WA 4JK1X 4BL0B 2HQAA 4WWCA 1IXCA 4M3DA 1WPKA 2H1LA 3KYDB 1DGRM 4ZYGA 4F93B 1SD6A 1XMXA 3QODA 3M1EA 5DM6F 3S16J 3P9KA 2Q2EA 5B3SH 1K6YA 2WY8Q 4I7HA 5GPAA 5JLWA 1BW6A 3HPHA 2LRDA 1VQMI 3I9V2 2DPDA 1JT0A 1ITYA 2CU7A 2VXDA 1H89C 2BXYA 5AONA 4EEFG 4FISA 3LNQA 2A61A 4ZYHA 1OYWA 2QF7A 2NVYJ 3NARA 4IO9F 1GT0C 3J7AO 4XMYA 2QQ9A 2YPRA 4E7ZA 3GLLA 2DTRA 3L7WA 1H8AC 4EM2A 2VXZA 3ZP5A 4B44A 3ERMA 2CV0A 2L01A 2KHMA 3ABKH 3FBNB 1B9MA 2OCEA 3GW2A 2BGCA 1ZAOA 2DYRH 1YX5A 2GA1A 4XKVA 1VF9A 2LD5A 1OR7A 2FA5A 4GYIA 3CESA 1RC9A 3I53A 1F4KA 3I54A 1G3TA
chains in the Genus database with same CATH topology
3TW7A 4IHWA 1JUPA 3RZDJ 3ZQFA 1UMQA 2ECCA 1ORKA 2HXIA 4A3JJ 3HGGA 1JUSA 5FKMA 1UHSA 4AUXA 2ECBA 4J19A 3GTOJ 3HKZN 3GBGA 1AKHB 2NS7A 2OPTA 1ZTRA 3QQAA 4DYRA 4AC0A 1G2HA 1U8BA 1OJLA 1RESA 4G12A 5EG0A 4A3KJ 1X58A 4A3FJ 2DA1A 2XGDA 3UKGA 5M5WJ 5DTDA 2M8GX 2Y9YA 3IH2A 3SFIA 2K40A 1F36A 2QCOA 1JKQC 1QPIA 2AO9A 4RBOA 1LE8B 2R93J 2DA3A 2E19A 3HOZJ 3K2AA 1ETYA 4XICA 1TWGJ 1FJLA 2Y30A 2B63J 1XS9A 4FE7A 3L1PA 3IH4A 2K9NA 4IHXA 2DA5A 3BG3A 3JRCA 5F1JA 1Z77A 4BXXJ 5F27A 4XK4A 2NVQJ 3F0CA 2E2HJ 3A01B 3K7AJ 3OIOA 5FKOA 2ZB9A 3PM1A 3HDDA 2HDDA 1Y1VJ 1POGA 2I10A 3JREA 3S15J 2XGCA 1APLC 3GTQJ 4B3AA 3M4OJ 2LP0A 2X48A 3JRIA 3JRGA 1IJWC 1MBEA 1MNMC 3G1OA 4NDLA 4UUSA 2ELKA 2WAQN 2XB0X 4A3CJ 1ETKA 1QRYA 2JA7J 4Y52J 3GTJJ 1FIAA 2R5ZA 2FJ1A 3B6AA 4C2MJ 4CYCA 4X1EA 3DCFA 2IBDA 3TEDA 1U78A 2JA6J 1WCMJ 1AU7A 5EEAA 1ZK8A 1MH3A 5FKKA 5J1UA 4IHYA 2LR8A 1PUFA 1BL0A 2EZHA 2VKVA 3C2BA 4LOCA 2KT0A 5EG0B 3HOWJ 4DYQA 2H8RA 1LFBA 3TP0A 1E3OC 3RKQA 4D5CA 1SANA 5E3NA 2R0QC 3BT9A 3FIWA 1B8IA 3ZQLA 3ZQCA 2CQXA 3S1RJ 3WHBA 4MFEA 4A3IJ 1A5JA 1EF4A 2DMUA 1X2MA 1I3QJ 5HODA 4FCYA 2RAEA 1BA5A 4BBSJ 1WH7A 2LTPA 3OSFA 2YU9J 2ME6A 2CUEA 2CJJA 3ZQGA 3BR6A 4Y7NJ 5F0HA 3Q0VA 3WHCA 4JX5A 3Q3SA 1YRNA 5GPCA 5FKNA 4DZPA 3S1MJ 1Y1WJ 3GTKJ 5EF6A 4DYCA 2DA7A 1JJ8C 5J1YA 1K61A 1OFCX 2JJ7A 1HLVA 3H0GJ 1JJ6C 1U9NA 5EDNA 1WGXA 1IRZA 3CDLA 2CQQA 4MLOA 1TWAJ 2XPVA 1ETVA 4V2FA 1ZR4A 1GDTA 3M3YJ 1I6HJ 3BTJA 3HOVJ 2K9SA 4FE4A 1JTXA 3LOCA 4QIWN 4IEJA 3LSRA 2VPRA 4W97A 4C3HJ 4UUSB 4RDUA 2LKXA 3SJMA 4M3GA 4C3JJ 1IDZA 4M6VA 5IP7J 3HB9A 2XSDC 5EZGA 1T33A 2XPWA 3BR3A 3E7LA 1NK3P 1CQTA 3Q0UA 2PMZN 5IOZA 2R5ZB 2OF7A 4CYCB 3GTPJ 3S1NJ 2DJNA 1MSFC 2ID3A 2FQ4A 3Q0WA 1JTYA 1A6IA 2TRTA 1ZR2A 1VI0A 2DA2A 4A69C 1PUFB 5M3FJ 2O9LA 5EZHA 5BNGA 5C4JJ 3HEFA 1FTTA 5EGOA 4A3GJ 1VNDA 5F04A 1R9TJ 2O8KA 2IAIA 2DTZA 2M34A 3RZOJ 3HOXJ 2K9QA 3BTCA 2XPUA 1GVDA 4L5EA 5FLMJ 2MW8A 4M3BA 2LK2A 2GM4A 1T56A 2O7OA 2JMWA 3FKIJ 3JRAA 3BR0A 3HM5A 1O4XA 1JT6A 3NAUA 3GTMJ 1K83J 4DW6A 2NOGA 5DS9A 1YRNB 3JRDA 4MIMA 5M3MJ 3TP3A 3ZQHA 2NS8A 5E3OA 1MH4A 4M3FA 5M5XJ 5M5YJ 3LSPA 2WV1A 4AYBN 4A3LJ 3MVPA 1SFOJ 4I6ZA 1I50J 2KDZA 3HOYJ 4A3BJ 1ENHA 5K7HA 2E2IJ 3OOUA 3MN2A 1HDPA 1ETQA 2LFBA 4IHVA 3I4NJ 2Y9ZA 3BG9A 2R5YA 3S14J 2D5VA 1OCTC 2EBIA 5IYBJ 1HDDC 3G1MA 1WI3A 2EQRA 3QPSA 3B6CA 5F08A 3S2DJ 2LVSA 5C4XJ 1TWFJ 4JX6A 1BW5A 3O8HA 2FX0A 1QVTA 2IEKA 2R7ZJ 5EGOB 2H1KA 1MBFA 2FD5A 3D1NI 5J1RA 3QPLA 2L0KA 2P81A 2DMQA 1B72A 3BG5A 5F0CA 4S0HB 1TWHJ 2HQ5A 1MBJA 2EZIA 4QTRA 3PO3J 2L9RA 2NVTJ 1JKOC 5GP9A 1FEXA 1DU0A 3H3VK 2L7ZA 1MBHA 4A93J 3FK7A 2LLKA 4QSHA 1HF0A 5IP6A 4M3EA 1RETA 3FISA 9ANTA 2CRGA 5J3LA 1FIPA 2ID6A 1HOMA 2W48A 3OSGA 2MSYA 2HI3A 3DEWA 5K7ZA 4B1RA 2HOAA 2L7FP 2N8GA 4JX4A 1RKWA 3ZOBA 2DN0A 1GV2A 1OCPA 1RR7A 2EH3A 4JP0A 5F0FA 4FTHA 1ZGWA 4A3DJ 1ETXA 2M0CA 4D7NA 1JGGA 3A02A 2VUMJ 2EZLA 1ETOA 1U9OA 4XRMA 3PO2J 4C3IJ 1JKPC 1S7EA 1NTCA 4D5FA 5IYCJ 4A3MJ 1Z0XA 1Q1VA 2R5YB 2ME0A 5FKLA 4X6AJ 1P7JA 3MKLA 4XRSA 1W0UA 2Y31A 4GFBA 3BTIA 3FK6A 2WB1N 2R92J 2VKEA 1RKTA 3A03A 1B8IB 3O8GA 4V2GA 3ZQIA 1ZKGA 4BY7J 1QVUA 4MO7A 5JLXA 3BQYA 4ABZA 3BTLA 2E2JJ 1VFCA 2E1OA 3HBLA 4A3EJ 1H88C 1IG7A 2EZKA 1GUUA 2X6OA 1ETWA 3S1QJ 3JR9A 3LSGA 1XC5A 3GTLJ 4W1UA 1JKRC 5IOYA 3GTGJ 3HGYA 2JA5J 3W6VA 4BKXA 1IUFA 5IPAA 3CCYA 2JK3A 1B72B 3S17J 4D7MA 1W0TA 2DA4A 1X2NA 2MG4A 1AHDP 2XB5A 3JRBA 1LFUP 2COBA 2CUFA 4HNVA 4BY1J 5E3LA 2AHQA 1FTZA 2MGQA 5IYDJ 5FLVA 1IC8A 2G0EA 4XRSG 1AKHA 2JN6A 2GLOA 3CQZJ 1BJZA 1GV5A 3IV5A 2HOTA 2XRLA 3VPRA 1F43A 1HCRA 1IGNA 2L7MP 5IP9J 2HYJA 2XGEA 2JWTA 2TCTA 1MBKA 2YUSA 3I4MJ 1D5YA 2VI6A 1NK2P 3BQZA 1LE8A 5EYRA 1UG2A 4DZJA 3LSJA 3JRFA 4M3DA 2NVXJ 1WPKA 1DU6A 4B4CA 1MBGA 1XG1A 2M9HA 1IDYA 3S16J 3BR1A 3SDGA 3RQIA 5GPAA 5JLWA 1BW6A 2JA8J 1P7IA 4UUTA 1JT0A 1IV6A 1ITYA 2CU7A 1H89C 1WH5A 2GBYA 2X9DA 4EEFG 4FISA 3LNQA 1JUMA 2QF7A 2HXOA 5K7FA 2NVYJ 3NARA 2DA6A 5FJ8J 2DMPA 3A01A 3TW6A 1GT0C 1MSEC 1TC3C 3S2HJ 2YS9A 4BBRJ 5C3EJ 2DMTA 4MFDA 3G1LA 2M2EA 3BR5A 1RPWA 1H8AC 5E3MA 2LY9A 3HOUJ 5C44J 2Y0SN 3IH3A 2DMNA 4XIDA 2HOSA 1VF9A 4JYKA 2LD5A 2Y2ZA 3JRHA 4I76A 3CMYA 1ZQ3P 3BR2A 1TWCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TW7 A;  4IHW A;  1JUP A;  3RZD J;  3ZQF A;  1UMQ A;  2ECC A;  1ORK A;  2HXI A;  4A3J J;  3HGG A;  1JUS A;  5FKM A;  1UHS A;  4AUX A;  2ECB A;  4J19 A;  3GTO J;  3HKZ N;  3GBG A;  1AKH B;  2NS7 A;  2OPT A;  1ZTR A;  3QQA A;  4DYR A;  4AC0 A;  1G2H A;  1U8B A;  1OJL A;  1RES A;  4G12 A;  5EG0 A;  4A3K J;  1X58 A;  4A3F J;  2DA1 A;  2XGD A;  3UKG A;  5M5W J;  5DTD A;  2M8G X;  2Y9Y A;  3IH2 A;  3SFI A;  2K40 A;  1F36 A;  2QCO A;  1JKQ C;  1QPI A;  2AO9 A;  4RBO A;  1LE8 B;  2R93 J;  2DA3 A;  2E19 A;  3HOZ J;  3K2A A;  1ETY A;  4XIC A;  1TWG J;  1FJL A;  2Y30 A;  2B63 J;  1XS9 A;  4FE7 A;  3L1P A;  3IH4 A;  2K9N A;  4IHX A;  2DA5 A;  3BG3 A;  3JRC A;  5F1J A;  1Z77 A;  4BXX J;  5F27 A;  4XK4 A;  2NVQ J;  3F0C A;  2E2H J;  3A01 B;  3K7A J;  3OIO A;  5FKO A;  2ZB9 A;  3PM1 A;  3HDD A;  2HDD A;  1Y1V J;  1POG A;  2I10 A;  3JRE A;  3S15 J;  2XGC A;  1APL C;  3GTQ J;  4B3A A;  3M4O J;  2LP0 A;  2X48 A;  3JRI A;  3JRG A;  1IJW C;  1MBE A;  1MNM C;  3G1O A;  4NDL A;  4UUS A;  2ELK A;  2WAQ N;  2XB0 X;  4A3C J;  1ETK A;  1QRY A;  2JA7 J;  4Y52 J;  3GTJ J;  1FIA A;  2R5Z A;  2FJ1 A;  3B6A A;  4C2M J;  4CYC A;  4X1E A;  3DCF A;  2IBD A;  3TED A;  1U78 A;  2JA6 J;  1WCM J;  1AU7 A;  5EEA A;  1ZK8 A;  1MH3 A;  5FKK A;  5J1U A;  4IHY A;  2LR8 A;  1PUF A;  1BL0 A;  2EZH A;  2VKV A;  3C2B A;  4LOC A;  2KT0 A;  5EG0 B;  3HOW J;  4DYQ A;  2H8R A;  1LFB A;  3TP0 A;  1E3O C;  3RKQ A;  4D5C A;  1SAN A;  5E3N A;  2R0Q C;  3BT9 A;  3FIW A;  1B8I A;  3ZQL A;  3ZQC A;  2CQX A;  3S1R J;  3WHB A;  4MFE A;  4A3I J;  1A5J A;  1EF4 A;  2DMU A;  1X2M A;  1I3Q J;  5HOD A;  4FCY A;  2RAE A;  1BA5 A;  4BBS J;  1WH7 A;  2LTP A;  3OSF A;  2YU9 J;  2ME6 A;  2CUE A;  2CJJ A;  3ZQG A;  3BR6 A;  4Y7N J;  5F0H A;  3Q0V A;  3WHC A;  4JX5 A;  3Q3S A;  1YRN A;  5GPC A;  5FKN A;  4DZP A;  3S1M J;  1Y1W J;  3GTK J;  5EF6 A;  4DYC A;  2DA7 A;  1JJ8 C;  5J1Y A;  1K61 A;  1OFC X;  2JJ7 A;  1HLV A;  3H0G J;  1JJ6 C;  1U9N A;  5EDN A;  1WGX A;  1IRZ A;  3CDL A;  2CQQ A;  4MLO A;  1TWA J;  2XPV A;  1ETV A;  4V2F A;  1ZR4 A;  1GDT A;  3M3Y J;  1I6H J;  3BTJ A;  3HOV J;  2K9S A;  4FE4 A;  1JTX A;  3LOC A;  4QIW N;  4IEJ A;  3LSR A;  2VPR A;  4W97 A;  4C3H J;  4UUS B;  4RDU A;  2LKX A;  3SJM A;  4M3G A;  4C3J J;  1IDZ A;  4M6V A;  5IP7 J;  3HB9 A;  2XSD C;  5EZG A;  1T33 A;  2XPW A;  3BR3 A;  3E7L A;  1NK3 P;  1CQT A;  3Q0U A;  2PMZ N;  5IOZ A;  2R5Z B;  2OF7 A;  4CYC B;  3GTP J;  3S1N J;  2DJN A;  1MSF C;  2ID3 A;  2FQ4 A;  3Q0W A;  1JTY A;  1A6I A;  2TRT A;  1ZR2 A;  1VI0 A;  2DA2 A;  4A69 C;  1PUF B;  5M3F J;  2O9L A;  5EZH A;  5BNG A;  5C4J J;  3HEF A;  1FTT A;  5EGO A;  4A3G J;  1VND A;  5F04 A;  1R9T J;  2O8K A;  2IAI A;  2DTZ A;  2M34 A;  3RZO J;  3HOX J;  2K9Q A;  3BTC A;  2XPU A;  1GVD A;  4L5E A;  5FLM J;  2MW8 A;  4M3B A;  2LK2 A;  2GM4 A;  1T56 A;  2O7O A;  2JMW A;  3FKI J;  3JRA A;  3BR0 A;  3HM5 A;  1O4X A;  1JT6 A;  3NAU A;  3GTM J;  1K83 J;  4DW6 A;  2NOG A;  5DS9 A;  1YRN B;  3JRD A;  4MIM A;  5M3M J;  3TP3 A;  3ZQH A;  2NS8 A;  5E3O A;  1MH4 A;  4M3F A;  5M5X J;  5M5Y J;  3LSP A;  2WV1 A;  4AYB N;  4A3L J;  3MVP A;  1SFO J;  4I6Z A;  1I50 J;  2KDZ A;  3HOY J;  4A3B J;  1ENH A;  5K7H A;  2E2I J;  3OOU A;  3MN2 A;  1HDP A;  1ETQ A;  2LFB A;  4IHV A;  3I4N J;  2Y9Z A;  3BG9 A;  2R5Y A;  3S14 J;  2D5V A;  1OCT C;  2EBI A;  5IYB J;  1HDD C;  3G1M A;  1WI3 A;  2EQR A;  3QPS A;  3B6C A;  5F08 A;  3S2D J;  2LVS A;  5C4X J;  1TWF J;  4JX6 A;  1BW5 A;  3O8H A;  2FX0 A;  1QVT A;  2IEK A;  2R7Z J;  5EGO B;  2H1K A;  1MBF A;  2FD5 A;  3D1N I;  5J1R A;  3QPL A;  2L0K A;  2P81 A;  2DMQ A;  1B72 A;  3BG5 A;  5F0C A;  4S0H B;  1TWH J;  2HQ5 A;  1MBJ A;  2EZI A;  4QTR A;  3PO3 J;  2L9R A;  2NVT J;  1JKO C;  5GP9 A;  1FEX A;  1DU0 A;  3H3V K;  2L7Z A;  1MBH A;  4A93 J;  3FK7 A;  2LLK A;  4QSH A;  1HF0 A;  5IP6 A;  4M3E A;  1RET A;  3FIS A;  9ANT A;  2CRG A;  5J3L A;  1FIP A;  2ID6 A;  1HOM A;  2W48 A;  3OSG A;  2MSY A;  2HI3 A;  3DEW A;  5K7Z A;  4B1R A;  2HOA A;  2L7F P;  2N8G A;  4JX4 A;  1RKW A;  3ZOB A;  2DN0 A;  1GV2 A;  1OCP A;  1RR7 A;  2EH3 A;  4JP0 A;  5F0F A;  4FTH A;  1ZGW A;  4A3D J;  1ETX A;  2M0C A;  4D7N A;  1JGG A;  3A02 A;  2VUM J;  2EZL A;  1ETO A;  1U9O A;  4XRM A;  3PO2 J;  4C3I J;  1JKP C;  1S7E A;  1NTC A;  4D5F A;  5IYC J;  4A3M J;  1Z0X A;  1Q1V A;  2R5Y B;  2ME0 A;  5FKL A;  4X6A J;  1P7J A;  3MKL A;  4XRS A;  1W0U A;  2Y31 A;  4GFB A;  3BTI A;  3FK6 A;  2WB1 N;  2R92 J;  2VKE A;  1RKT A;  3A03 A;  1B8I B;  3O8G A;  4V2G A;  3ZQI A;  1ZKG A;  4BY7 J;  1QVU A;  4MO7 A;  5JLX A;  3BQY A;  4ABZ A;  3BTL A;  2E2J J;  1VFC A;  2E1O A;  3HBL A;  4A3E J;  1H88 C;  1IG7 A;  2EZK A;  1GUU A;  2X6O A;  1ETW A;  3S1Q J;  3JR9 A;  3LSG A;  1XC5 A;  3GTL J;  4W1U A;  1JKR C;  5IOY A;  3GTG J;  3HGY A;  2JA5 J;  3W6V A;  4BKX A;  1IUF A;  5IPA A;  3CCY A;  2JK3 A;  1B72 B;  3S17 J;  4D7M A;  1W0T A;  2DA4 A;  1X2N A;  2MG4 A;  1AHD P;  2XB5 A;  3JRB A;  1LFU P;  2COB A;  2CUF A;  4HNV A;  4BY1 J;  5E3L A;  2AHQ A;  1FTZ A;  2MGQ A;  5IYD J;  5FLV A;  1IC8 A;  2G0E A;  4XRS G;  1AKH A;  2JN6 A;  2GLO A;  3CQZ J;  1BJZ A;  1GV5 A;  3IV5 A;  2HOT A;  2XRL A;  3VPR A;  1F43 A;  1HCR A;  1IGN A;  2L7M P;  5IP9 J;  2HYJ A;  2XGE A;  2JWT A;  2TCT A;  1MBK A;  2YUS A;  3I4M J;  1D5Y A;  2VI6 A;  1NK2 P;  3BQZ A;  1LE8 A;  5EYR A;  1UG2 A;  4DZJ A;  3LSJ A;  3JRF A;  4M3D A;  2NVX J;  1WPK A;  1DU6 A;  4B4C A;  1MBG A;  1XG1 A;  2M9H A;  1IDY A;  3S16 J;  3BR1 A;  3SDG A;  3RQI A;  5GPA A;  5JLW A;  1BW6 A;  2JA8 J;  1P7I A;  4UUT A;  1JT0 A;  1IV6 A;  1ITY A;  2CU7 A;  1H89 C;  1WH5 A;  2GBY A;  2X9D A;  4EEF G;  4FIS A;  3LNQ A;  1JUM A;  2QF7 A;  2HXO A;  5K7F A;  2NVY J;  3NAR A;  2DA6 A;  5FJ8 J;  2DMP A;  3A01 A;  3TW6 A;  1GT0 C;  1MSE C;  1TC3 C;  3S2H J;  2YS9 A;  4BBR J;  5C3E J;  2DMT A;  4MFD A;  3G1L A;  2M2E A;  3BR5 A;  1RPW A;  1H8A C;  5E3M A;  2LY9 A;  3HOU J;  5C44 J;  2Y0S N;  3IH3 A;  2DMN A;  4XID A;  2HOS A;  1VF9 A;  4JYK A;  2LD5 A;  2Y2Z A;  3JRH A;  4I76 A;  3CMY A;  1ZQ3 P;  3BR2 A;  1TWC J; 
#chains in the Genus database with same CATH topology
 3ZQF A;  3CC4 I;  2ZO4 A;  2JSC A;  2ECC A;  1ORK A;  3DKW A;  4A3J J;  2CO5 A;  2FOK A;  3HGG A;  4BNC A;  1JUS A;  5FKM A;  2QBY A;  4AUX A;  2NS0 A;  5DUK A;  1QPM A;  1T0F A;  5H2F C;  2R7V A;  4KT5 C;  2CQK A;  4XN0 A;  4AC0 A;  4A5N A;  1J75 A;  1QQI A;  1IAW A;  1RNL A;  2QWW A;  1VQ4 I;  1R22 A;  3OR1 C;  1NG7 A;  3GXO A;  3DFG A;  4I09 A;  1QZZ A;  3ZMU A;  4D1Q A;  2I5U A;  1YS6 A;  4PGG A;  2M8G X;  3IH2 A;  2DO7 A;  2K40 A;  3W2W A;  2QCO A;  2FOW A;  2AO9 A;  2O3F A;  4BUP A;  5DCM A;  5IY5 H;  4C30 A;  4RMN A;  4RLQ A;  3K2A A;  4XIC A;  5L3E A;  2Z99 A;  2B63 J;  3GCM A;  1ZGJ A;  3AFH A;  2EV6 A;  4IXA A;  2K9N A;  1ON1 A;  1YQA A;  2CQN A;  3RKX A;  1YX3 A;  2M1B A;  3CUO A;  1SFK A;  2DA5 A;  1XSD A;  3N05 A;  3A4C A;  5F1J A;  2KIM A;  2WY7 Q;  3I59 B;  5F27 A;  2DI3 A;  3OL3 A;  3AG2 H;  2X4H A;  3GX4 X;  2NVQ J;  1WJE A;  3OIO A;  5AIP A;  5FKO A;  4YFX F;  4M6Y A;  4A0Z A;  2VE8 A;  3WTV C;  3IWF A;  1LVK A;  3HDD A;  2DT5 A;  2ZC2 A;  4YIR X;  1KQ0 A;  3CTA A;  3RQ4 A;  2VAS A;  4OMZ A;  3JSO A;  3DWL E;  1YI2 I;  1OR7 C;  3CDI A;  1Z6T A;  2H6B A;  2P5K A;  3QRF F;  2RKH A;  3M4O J;  3PQJ A;  3DTI A;  2LP0 A;  2X48 A;  3ZMV A;  3QU3 A;  1Q1H A;  3G1O A;  4YII A;  2ELK A;  1UB9 A;  1G8X A;  2FRH A;  2JZY A;  3KZI C;  4A3C J;  1ETK A;  1BI3 A;  3H92 A;  3WGI A;  2L54 A;  4O6J A;  1T0F C;  2DFF A;  4C2M J;  1MDM B;  2FNA A;  3DCF A;  1VZ0 A;  3TED A;  2JA6 J;  3HRT A;  2H09 A;  5JVT A;  3EET A;  2K9L A;  3HZJ A;  5E1X A;  4D0P A;  2H94 A;  5LHI A;  5ILS A;  1BI1 A;  1X19 A;  3K1P A;  2MC3 A;  2H8R A;  2KRC A;  1P4A A;  2YSR A;  4D5C A;  1SAN A;  4WXD A;  3FIW A;  3HOS A;  2KMU A;  2KIF A;  1S3J A;  3DEE A;  5B1B H;  3OYG A;  3ZQL A;  1J2X A;  2J5O A;  3S3O A;  4ASN A;  4NQW A;  4A5M A;  3WHB A;  1WJB A;  1Z9C A;  1VQ8 I;  3OYB A;  3BG6 A;  1I3Q J;  3PQK A;  5HS8 A;  3VEP A;  4BXU A;  4FCY A;  2VL8 A;  4YIF A;  3GZ6 A;  1BA5 A;  2R7D A;  4CSW A;  2LTP A;  2YU9 J;  3DV8 A;  3S2W A;  3BR6 A;  1MZB A;  1YRN A;  3S1M J;  5FKN A;  4DZP A;  4BH9 A;  4ZZL A;  1BM9 A;  2DA7 A;  3LAP A;  3BZC A;  3ZQ7 A;  2NYX A;  2OZU A;  4BDZ A;  1W4M A;  4EJV A;  4HDV A;  2JRT A;  2OC6 A;  4BE1 A;  1JJ6 C;  4IKF A;  3CDL A;  3WTW C;  4M73 A;  3WOD F;  5DV5 A;  3JCU C;  2OD5 A;  2IRF G;  1ETV A;  1OMI A;  2GAU A;  4BE0 A;  1KGS A;  3KLN A;  4K2E A;  4MEY F;  1KU3 A;  5ICG A;  1FC3 A;  4AWX B;  1R36 A;  4UUS B;  2RQQ A;  3TO7 A;  4RDU A;  2M45 A;  1UCR A;  3OIP A;  3SJM A;  1IDZ A;  4M6V A;  4R1H A;  3TDU C;  3K4B A;  3JW4 A;  4HX8 A;  4BS9 A;  4PJ0 C;  2PJR B;  2Z9O A;  1U2W A;  2OUM A;  4HST A;  3SHF A;  4E7S A;  3P9I A;  4HV6 A;  5A2Q K;  4CYC B;  4AM3 A;  1DUX C;  2EFP A;  1JTY A;  3T0Y A;  3K69 A;  1ZR2 A;  1MJA A;  2V9K A;  1WZ2 A;  2GIV A;  5L3C A;  3WU0 A;  1T2K A;  2O9L A;  5EZH A;  2ADU A;  4BEH A;  5KNL A;  5C4J J;  3DP7 A;  5E20 A;  1FOX A;  5EGO A;  2X51 A;  1IXR C;  2O8K A;  5CVI A;  1R23 A;  4ESB A;  3BTC A;  4CCK A;  5FLM J;  2ZSH B;  3BR0 A;  3HM5 A;  4P5O A;  4AYB A;  1O4X A;  1W7P A;  3NAU A;  4OIQ F;  2JVH A;  2L9N A;  1W7P D;  1FBQ A;  1UST A;  4PDK A;  2XF6 A;  4H4K C;  3LST A;  2BE5 F;  3N4M A;  3WTS C;  1FMV A;  2H6C A;  1CF7 B;  1MH4 A;  4M3F A;  3KYL A;  2R7R A;  5B1A H;  4XBF A;  3I5U A;  5J47 A;  2E1N A;  1QA6 A;  4XKW A;  4KDP A;  4LIU A;  2I8D A;  2JPC A;  1ZRC A;  3WG9 A;  1TBX A;  3LWF A;  4XOR A;  3X2Q H;  4B47 A;  3ASN H;  3FXJ A;  3FXK A;  2OTJ I;  1I50 J;  2XC7 A;  4IRI A;  1M1E B;  2R3S A;  4A3B J;  2CSO A;  1YW9 A;  4II2 A;  1P9Q C;  3T1B A;  1F5T A;  3CD6 I;  1UJ8 A;  3MN2 A;  3OOU A;  1K4T A;  3PJR A;  4IHV A;  3I4N J;  2Y9Z A;  4UXN A;  5HLH A;  4YRV A;  2ZBK A;  3V8L A;  4XL9 A;  2LC2 A;  3CF2 A;  1SC7 A;  3GFJ A;  4M9X A;  4WX9 A;  1FLI A;  2WWY A;  2HZD A;  1KON A;  4PK4 A;  3B6C A;  4LG0 A;  4OWR B;  3GFI A;  5DEQ A;  3FWE A;  3T8R A;  1J7K A;  3K4N A;  1E3P A;  3KP5 A;  3GWZ A;  5C4X J;  3QWL A;  1N75 A;  1TWF J;  1LKX A;  2K3P A;  2LDU A;  2FML A;  2EIN H;  2IEK A;  2P7C B;  4ZZD A;  1PDN C;  2CFX A;  2F5V A;  1ON2 A;  3A1Y A;  2JQ7 A;  2DOA A;  4HG2 A;  1ZHF A;  3D1N I;  5KAI C;  3IC7 A;  1STZ A;  2DMQ A;  2GIZ A;  3I71 A;  3MKW B;  4FQG A;  5F0C A;  3VYS B;  4QTR A;  2JUC A;  3OR2 C;  2R7U A;  5E8G A;  4LLN A;  2L9R A;  4M9S A;  3OWT A;  2IVM A;  1BR4 A;  5JVG F;  4CDG A;  4A93 J;  3E6B A;  3FK7 A;  1GXQ A;  4V19 K;  2V9V A;  2X1C A;  2P6T A;  3HTS B;  1W5S A;  3HUG A;  5IP6 A;  5GAD J;  2QSH X;  9ANT A;  2XRN A;  1FIP A;  2DDA A;  4L9N A;  2MSY A;  2GZW A;  2A69 F;  5HLG A;  2JUG A;  3H5R A;  5LBQ A;  3VSL A;  4RB3 C;  3TBI A;  3D5S C;  1BOB A;  1XGM A;  4B1R A;  2DT6 A;  2HOA A;  5TGT A;  2WV0 A;  1RKW A;  1GVJ A;  2DN0 A;  1O3S A;  4EV0 A;  4P9F A;  4U0W A;  3AG4 H;  1OCP A;  2EH3 A;  2BYV E;  4RAY A;  4A6E A;  4A3D J;  1ETX A;  2RDP A;  2L7K A;  2XV4 S;  2M0C A;  3QYE A;  1MD0 A;  1QZY A;  2VUM J;  3DBL B;  1U9O A;  1IN7 A;  4C3I J;  2HVQ A;  2R7T A;  2NNY A;  3RSN A;  4A3M J;  1Z0X A;  1EA3 A;  2DDB A;  4EM1 A;  1HSJ A;  1XX5 A;  1P7J A;  3MKL A;  1W0U A;  2Y31 A;  3FMQ A;  3BTI A;  5HLI A;  5AIQ A;  3FK6 A;  2L9S A;  2WB1 N;  4D9J A;  2P8T A;  1WQ2 A;  1VQ7 I;  1MMD A;  1UHW A;  5KHD A;  3CCL I;  1FPQ A;  1RUO A;  4XON A;  4HNT A;  3CCU I;  1BC8 C;  3LA2 A;  5EJC A;  6PAX A;  1OLT A;  2DJI A;  3V7C A;  2NXN B;  4KA4 A;  3V4G A;  1D1C A;  2OV7 A;  4CCL A;  2TDX A;  3JR9 A;  3HPG A;  2CFO A;  4XLN F;  3I55 I;  1KYW A;  3HHG A;  4F7Z A;  3GTL J;  3MZH A;  1XB4 A;  3KE2 A;  1JKR C;  3R0A A;  2E7W A;  3HGY A;  4KUM A;  2JA5 J;  3GTG J;  1L0O C;  4GCV A;  2VOO A;  5ICC A;  2QM3 A;  4BDY A;  1X2N A;  3ONQ A;  4N9H A;  2RN7 A;  2CUF A;  2XKP A;  4BY1 J;  5E3L A;  4RA2 A;  4XM3 A;  4QPQ A;  1GLN A;  1FTZ A;  1T6S A;  4DJA A;  3KP4 A;  5HOO A;  3F22 A;  2KLO A;  2X85 A;  1QHG A;  4H0E A;  2F5C A;  3JAM K;  3CQZ J;  1BJZ A;  4RAG A;  1HQC A;  2MYS A;  4QPO A;  3VPR A;  3MEX A;  1U3E M;  1P92 A;  2DYS H;  2QLZ A;  4PJN A;  4XSX F;  4CXF A;  1LDJ A;  2XGE A;  5FO5 A;  1YJN I;  1WJD A;  5BS6 A;  1DP7 P;  1ZRF A;  1UHM A;  3BQZ A;  3W3C A;  2QA4 I;  2DAO A;  5EYR A;  3JRF A;  4PZJ A;  1YJ9 I;  2QQA A;  4Y15 A;  4B4C A;  4OOI A;  1XG1 A;  2RNG A;  3D5L A;  3LFK A;  3AKZ A;  1HA8 A;  2ZJ2 A;  2ZFW A;  1W36 D;  1YIO A;  2FXA A;  2Y0S A;  1ACI A;  1ZYR F;  2KP6 A;  2FU4 A;  2CYY A;  4XLA A;  3TGN A;  3I59 A;  2HXO A;  5K7F A;  1SD4 A;  2M7B A;  1MSE C;  1ZN2 A;  2DMP A;  3ULQ B;  2XAU A;  5C3E J;  3PIO F;  1D3Y A;  4PFP A;  4L5I A;  4S05 A;  4HV5 A;  2P4W A;  5D5W B;  2QZ8 A;  5DD4 A;  1GXP A;  2LY9 A;  4MTD A;  3RPQ A;  3K4M A;  5C44 J;  2VBX A;  2VQH A;  4E4H A;  3PL8 A;  3HG9 A;  4BU2 A;  1ZG5 A;  2A07 F;  4S04 A;  4IVN A;  1MMA A;  3KYC B;  3JRH A;  2ZJP F;  4I76 A;  3LL7 A;  2VQG A;  1SVM A;  2LMD A;  3M7G A;  3BR2 A;  1XCB A;  3CMY A;  4I6Z A;  1ZQ3 P;  3TW7 A;  4NBQ A;  2DOF A;  4IHW A;  4JBA A;  3M1C A;  2GA2 A;  2IT0 A;  1MDM A;  1I5Z A;  2HXI A;  3VYR B;  2G7H A;  1TQI A;  4R79 A;  3HIF A;  1FSH A;  2ECB A;  2IS4 A;  1HKS A;  3CCV I;  2MC4 A;  3HKZ N;  4J19 A;  4G7Z F;  5ICF A;  2OPT A;  1ZTR A;  2ISZ A;  4F52 A;  3CUQ B;  4ANJ A;  3V8K A;  1RES A;  1U8B A;  1TW2 A;  4KN7 X;  4B43 A;  1X58 A;  4A3F J;  2DA1 A;  3VB2 A;  1BC7 C;  2KFD A;  1VQ9 I;  3MMY B;  5E18 F;  4A12 A;  3G6E I;  5M5W J;  1X3U A;  4JOM A;  1FYK A;  3SFI A;  4EJT A;  1QPI A;  3QYB A;  2F4M B;  1LE8 B;  2ZNZ A;  2DA3 A;  2E19 A;  1IRX A;  2F5F A;  2KZV A;  3HOZ J;  3S3M A;  4RB2 C;  1ETY A;  3FBI B;  3IWZ A;  1U5T B;  2XAF A;  2Y30 A;  5KK1 A;  1RR8 C;  2K5C A;  3L1P A;  1R6R A;  5FGM A;  3IAM 2;  3IHU A;  1YO5 C;  3AG1 H;  2JT1 A;  2QUF A;  3BZK A;  2IS1 A;  2FQ3 A;  3LSK A;  3BG3 A;  3JRC A;  2ZJR F;  3M8J A;  1Z77 A;  3OYD A;  2WA0 A;  2NNN A;  5J8C A;  5F1R A;  1NH3 A;  4HBL A;  2W85 A;  3VFZ A;  1WJC A;  3A01 B;  5FB2 A;  3K7A J;  5CQG A;  4ON0 A;  3G71 I;  1J09 A;  3ECO A;  2DFH A;  2ZB9 A;  4P1W A;  3OS1 A;  3M07 A;  2E1M B;  4CA0 A;  4ZTF A;  1Y1V J;  1POG A;  2I10 A;  4UB8 C;  3S15 J;  3B02 A;  2R7W A;  1Z6R A;  2L4M A;  4B3A A;  2O03 A;  2HVS A;  2RGV A;  3GME A;  1E0E A;  4L9J A;  5IT9 Z;  4AU7 A;  1IJW C;  1MNM C;  4FX0 A;  3PUF A;  4NDL A;  4UUS A;  2WAQ N;  3HSR A;  3J7A Y;  3V42 A;  1QRY A;  3OYN A;  4E6K G;  2PJR A;  2M87 A;  2KDO A;  2G7U A;  3B6A A;  4CYC A;  5B66 C;  2IBD A;  1U78 A;  2BW3 B;  1X4O A;  3F72 A;  1SD7 A;  1BR2 A;  1MH3 A;  2WTE A;  4FET A;  2GXG A;  1YW8 A;  1Y39 A;  2VLA A;  3C2B A;  4YFN F;  3RDI A;  5D6E A;  3WGG A;  3HOW J;  1LFB A;  2EIK H;  3TL4 X;  2F4I A;  3CJQ B;  2A6H F;  4TV7 A;  1IUY A;  1RZ4 A;  1MKM A;  3SYT A;  5ICE A;  2LSO A;  4MFE A;  4A3I J;  1A5J A;  2DMU A;  2DK8 A;  1K4S A;  1BI0 A;  1T95 A;  2Z1D A;  5KCM A;  4OIN F;  2X1D A;  4BBS J;  1WH7 A;  1FZP B;  5K5Q A;  2CUE A;  2CJJ A;  4Y7N J;  1K78 B;  3E0J B;  3WHC A;  3FHZ A;  2V1U A;  5BPI A;  2DQL A;  1IXS B;  3Q3S A;  1WI9 A;  1MGT A;  5HLT A;  2OCC H;  5J6X A;  1Y1W J;  2EV5 A;  1JJ8 C;  1CF7 A;  3DQV C;  3DLL F;  1F9N A;  4ENJ A;  1OKR A;  1XGN A;  3MD2 A;  3NWS A;  1FOW A;  4UV8 A;  3J81 K;  4IOC F;  2DFE A;  2VBY A;  4EVI A;  4M72 A;  2E34 A;  2XPV A;  4HPQ A;  2C6Y A;  4FX4 A;  5FLX K;  1MNE A;  3HOV J;  4FE4 A;  2QEX I;  1R5I D;  2OU2 A;  3EUK L;  2W57 A;  1BIB A;  2OZ6 A;  2QKL B;  4IEJ A;  4BJ5 C;  4W97 A;  3KZZ A;  4MHG A;  3LSR A;  2IW5 A;  3CO7 C;  2LKX A;  5LD2 C;  3TO6 A;  4M3G A;  4C3J J;  2XSD C;  2VJ4 A;  1E3H A;  1QZE A;  3E7L A;  4LIV A;  2EB7 A;  3Q0U A;  2PMZ N;  3M8E A;  5IOZ A;  1YFH A;  3DEU A;  2MA3 A;  2OF7 A;  3GTP J;  1XSX A;  2DJN A;  2ZKZ A;  3DPL C;  5H20 A;  3KET A;  2FQ4 A;  2HOE A;  4IF4 A;  4LK0 F;  4NC8 A;  1I3A A;  3OY9 A;  1IRG A;  2V9P A;  4ZC3 A;  3W6J B;  1LFP A;  1PUF B;  4C2T A;  5BNG A;  2PI0 A;  3LQQ A;  4I0A A;  1D5V A;  3FXU A;  1WFX A;  4CGZ A;  4RB0 A;  4A3G J;  1ZG3 A;  3D5R C;  1ZEL A;  2STW A;  4LLL A;  3RJP A;  2CW7 A;  2DTZ A;  3FM3 A;  4EMS A;  3HOX J;  1MW7 A;  1EV7 A;  4XLF A;  5D6F A;  3T8T A;  3ZMT A;  2Z33 A;  3J80 Z;  2NOJ B;  2R7S A;  1RUN A;  2LK2 A;  2O7O A;  2JMW A;  3FKI J;  4U7D A;  1FYL A;  5H6R A;  2MBF A;  4DIQ A;  3OYL A;  1UFM A;  1N77 A;  2W1O A;  5LRR A;  4KNY A;  4DW6 A;  5CKT A;  3VYT B;  1WVR A;  1SFX A;  3JRD A;  2D2W A;  3TP3 A;  2LG4 A;  2NS8 A;  4XKC A;  2D45 A;  4OAZ A;  5M5X J;  2CV2 A;  1FOK A;  1FY7 A;  3LSP A;  2BVM A;  2VT2 A;  3CO6 C;  4A3L J;  2IS2 A;  3MZ8 A;  3MVP A;  1KA8 A;  1SFO J;  1X1A A;  2LKP A;  3P7N A;  2K7L A;  2KDZ A;  2HZT A;  4NNJ A;  5ERI A;  3PFI A;  1FOY A;  2K85 A;  2ICW G;  4EM0 B;  3DTK A;  5J4Y A;  3OYE A;  2LFB A;  2VJJ A;  4BE2 A;  2AQE A;  2BXZ A;  3BG9 A;  3Q9S A;  4F92 B;  1B4A A;  1S6L A;  2D5V A;  2W4S A;  1HDD C;  3G1M A;  4ITV A;  2EQR A;  4ZYD A;  1FP2 A;  4RAZ A;  5LRS A;  4MQV A;  2V1D A;  4Y4R A;  3CP8 A;  3O8H A;  3QOP A;  2VT3 A;  5GTI C;  2H1K A;  3RIR A;  2VE9 A;  2AXL A;  2FD5 A;  2IXS A;  3H36 A;  4G6D A;  1KQ9 A;  1SAX A;  3U9G A;  2K9M A;  3QPL A;  5CVR A;  5D8K B;  2V79 A;  2M3A A;  3DLA A;  3OYA A;  2B9S A;  4CCO A;  1TWH J;  2HQ5 A;  1LDD A;  2Z16 A;  3TQN A;  2FEZ A;  1W5C C;  5L3B A;  1JKO C;  5GP9 A;  1W5T A;  1BOA A;  4I02 A;  2FBI A;  1FEX A;  2QKM B;  3F3X A;  3H3V K;  2X6W A;  2L7Z A;  2W84 A;  2X6X A;  2P7V B;  2R7X A;  3FX3 A;  2V26 A;  1XCV A;  1HF0 A;  1G59 A;  2RVC A;  4LFU A;  3CME I;  4XKB A;  1PJR A;  2VIX A;  4M3E A;  2CRG A;  5J3L A;  2ID6 A;  2M8E A;  2W48 A;  3OSG A;  3BOQ A;  3HC7 A;  5F64 A;  1K79 A;  2HI3 A;  2BY0 A;  1FX7 A;  2DT7 B;  3DEW A;  5K7Z A;  5HDK A;  3ROU A;  2L7F P;  4RB1 A;  2XAH A;  1JHF A;  1H9T A;  4AVP A;  3PNT A;  1IN5 A;  5HDN A;  5FRN A;  4LB5 A;  4DBR A;  5F0F A;  3K4C A;  3IRR A;  3COA C;  4J01 A;  3A0B C;  2W7N A;  3TO9 A;  1UEL B;  3A02 A;  4XLP F;  2BV6 A;  1LEB A;  4KIB A;  4L18 B;  1ETO A;  4XRM A;  2HS5 A;  2W24 A;  4E70 A;  2NRA C;  3A2K A;  1S7E A;  3K6G A;  5IYC J;  1BI2 A;  2R5Y B;  4NB5 A;  4X6A J;  4XRS A;  2GQQ A;  4EQQ A;  2K4B A;  4GFB A;  3QP5 A;  5BOX A;  1Z7U A;  3KP6 A;  2M0M A;  2E60 A;  1RKT A;  1S29 A;  4BY7 J;  4OAY A;  3VYU B;  3KEO A;  1QVU A;  4ZTJ A;  3BQY A;  1U6G A;  3K4L A;  2OBP A;  4A3E J;  2P0W A;  2IA0 A;  4FAS D;  2EZK A;  2X6O A;  1PP7 U;  3OMY A;  3LSG A;  4HF1 A;  2XKO A;  1BN5 A;  2GXA A;  3QOE A;  1R4N B;  4WXC A;  2K4J A;  3R0J A;  4WCG A;  3W6V A;  2WAQ A;  1IUF A;  1IN6 A;  2HDW A;  4B48 A;  3GFL A;  4M74 A;  1Y8Q B;  1RI7 A;  4N0B A;  3QYF A;  2UUZ A;  2XB5 A;  3JRB A;  2COB A;  1LFU P;  4RS8 A;  1V4R A;  3F8C A;  5E1Z B;  3OYK A;  2AHQ A;  1Z1D A;  4IHS A;  2AS5 F;  3EYY A;  5CVJ A;  1VQO I;  3G4S I;  1WJF A;  3WGH A;  2JN6 A;  3CUQ A;  1GV5 A;  3IV5 A;  5DUI A;  4ESF A;  3BJ6 A;  2PBI A;  3OYM A;  1HCR A;  1IGN A;  3E1S A;  1XN7 A;  3K9T A;  2L7M P;  1O3T A;  2VOP A;  3BJO A;  3G3Z A;  3F21 A;  3BC8 A;  5D5V B;  2H27 A;  2GXB A;  2JVG A;  2PN6 A;  1L3L A;  1IV8 A;  1IW7 F;  3S32 A;  1LE8 A;  4EGY A;  4O3M A;  1WJ5 A;  2XF5 A;  2MH2 A;  2YR2 A;  3LSJ A;  2UXN A;  2VC0 A;  3NEU A;  2NVX J;  2EIM H;  3CCJ I;  1DPU A;  1DU6 A;  1U5T A;  1MBG A;  3BRO A;  3V7S A;  2ZNY A;  1IDY A;  2OQR A;  3BR1 A;  2B7E A;  3OIQ A;  4L9V A;  3T5X A;  1V55 H;  3CCS I;  1IN8 A;  1V5G A;  1J59 A;  2JA8 J;  2OQG A;  2EA4 A;  1WH5 A;  4IQ4 A;  2GBY A;  3L2U A;  2MD0 A;  2DXI A;  3FXR A;  5LEJ A;  1D1A A;  2DA6 A;  2LF8 A;  3A01 A;  5DD8 A;  1AOY A;  2YS9 A;  1I27 A;  1P6R A;  2LOO A;  4BBR J;  3HJE A;  2GOM A;  1Z91 A;  5IT3 A;  4MFD A;  3HXL A;  3G1L A;  2M2E A;  5JFR A;  3CP2 A;  4HNU A;  1P4X A;  4XNF A;  1RPW A;  1UG0 A;  2ESH A;  4Z2Y A;  2UXX A;  3LA3 A;  4LGW A;  3HOU J;  4I01 A;  2A6E F;  2P6S A;  1DDN A;  2A05 A;  1A04 A;  3GZN B;  2HNH A;  3ZN0 A;  1SMY F;  4PUS A;  2WAD A;  4CZC A;  2DMN A;  4KIC A;  1Y0U A;  4N9I A;  5HNF A;  2RRE A;  4JYK A;  2Y2Z A;  3ISP A;  2IS6 A;  4LD5 A;  4F3Q A;  4IZZ A;  4GXO A;  3RZD J;  2QGU A;  3DKX A;  1EH8 A;  3ECH A;  2UWM A;  1UHS A;  2DFI A;  3CUQ C;  2DK5 A;  2BW3 A;  5CQE A;  3LAJ A;  3GTO J;  3F8M A;  3K1N A;  3ABT A;  5K5R A;  3QQA A;  3M8F A;  2V6E A;  3RPU A;  4GRI A;  2HDC A;  3CC7 I;  3WTX C;  1OJL A;  1X3Z B;  1BR1 A;  4A3K J;  2E5Z A;  3CCE I;  1LUJ B;  2YX7 A;  2QSG X;  3GEZ A;  1X3W B;  4U87 A;  2GWR A;  2X6Y A;  1TQM A;  5DTD A;  1Y8R B;  2Y9Y A;  2Y75 A;  3VOE A;  1PVE A;  1JKQ C;  3DBH B;  1U5T C;  5LHH A;  3OS0 A;  1Z67 A;  5LHG A;  1HW1 A;  2P5V A;  5GAH J;  5TJJ A;  2F2E A;  3W2V A;  1W1W E;  3E5U A;  1TWG J;  4AIK A;  5K1Y A;  3WTZ A;  2E5N A;  5FRM A;  3U2R A;  4XLH A;  1XS9 A;  2JTV A;  4FE7 A;  4P55 A;  4A2U A;  1K78 A;  1USS A;  2LNB A;  1H9G A;  1KU2 A;  1ULY A;  5E1W A;  4Q5S F;  3V7R A;  3CLQ A;  3HSF A;  3FZV A;  3BPX A;  4BXX J;  2E1M C;  4XK4 A;  3RTR A;  1UAA A;  4MTE A;  3WE2 A;  2YX4 A;  3PSF A;  1TP4 A;  2L4A A;  3W2A A;  2IA1 A;  2CW8 A;  1J0R A;  3PM1 A;  4O5V A;  4L0Y B;  1K7A A;  1B6A A;  2HDD A;  3KP7 A;  3KP3 A;  3GO5 A;  5JI6 A;  5HVQ C;  1APL C;  3GTQ J;  2YU3 A;  2KRH A;  1KU9 A;  1VQK I;  4PJM A;  3HL2 A;  3JRI A;  2AXT C;  3F8B A;  3OOP A;  4HRI A;  4UVC A;  2KIS A;  4YEL A;  2JA7 J;  2XVC A;  3HRU A;  3LFU A;  5D8L B;  2X1E A;  1A35 A;  2DW4 A;  2VQL A;  4ZH4 F;  3OYC A;  2F48 A;  2HPI A;  1HXD A;  2XGX A;  4M9Z A;  4X1E A;  1VQN I;  2VB6 A;  3MQ0 A;  2KIU A;  5D5X B;  2ZJQ F;  3SZP A;  1WCM J;  3OL4 A;  2CW0 F;  4WXH A;  1ZK8 A;  3F9K A;  3ZQQ A;  5J1U A;  2XAS A;  2LR8 A;  4CO8 A;  1PUF A;  4PGH A;  2EZH A;  2VKV A;  2KT0 A;  2EJR A;  2DPU A;  5EG0 B;  1LNW A;  3TP0 A;  5CLS A;  1E3O C;  1Y6I A;  4HF0 A;  4L9T A;  4PFO A;  5GTH C;  3BT9 A;  2R0Q C;  1F1Z A;  1B8I A;  2CQX A;  2FMY A;  1ERD A;  1GHC A;  3S1R J;  1TQP A;  3FF5 A;  1FBS A;  2PMH A;  5LLQ A;  1EF4 A;  1Y0N A;  3R61 A;  5HOD A;  4IPA A;  1PYV A;  3GYH X;  1QHH D;  1S9H A;  1I1S A;  5JHU A;  3ZQG A;  2K02 A;  2OAZ A;  3GF2 A;  4G7O F;  3Q0V A;  4CZZ A;  3HTU A;  5GPC A;  1PUE E;  3GTK J;  4DYC A;  4KT6 A;  5J1Y A;  1OFC X;  2JJ7 A;  3QAH A;  3H35 A;  4Y17 A;  1IN4 A;  1Z7L A;  2RC4 A;  4EAT A;  2P5L C;  1R00 A;  5LFA A;  1T98 A;  3H0G J;  1WRJ A;  2RV8 A;  1U9N A;  1ZRD A;  1IRZ A;  2DOD A;  1OYY A;  1TT0 A;  3BY6 A;  3EPZ A;  4RLF A;  4MLO A;  1SFE A;  2IGK A;  2EFW A;  1U0J A;  2V7F A;  4XSZ F;  1LPQ A;  3M3Y J;  2PG4 A;  2FNP A;  2ZXJ A;  1I6H J;  3IP4 B;  1JTX A;  1WSU A;  3LOC A;  4C9Y A;  4QIW N;  4P96 A;  3AL0 B;  2FUG 2;  2R4G A;  2VC1 A;  1FMW A;  4C3H J;  3CMA I;  2V1X A;  5IP7 J;  3HB9 A;  5EZG A;  4DOZ A;  1U8R A;  1ODD A;  1T33 A;  5GAG J;  3P9C A;  1NK3 P;  1CQT A;  2HQN A;  3MCZ A;  3HRM A;  2R5Z B;  4IRG A;  3GLX A;  5EEH A;  4XQF A;  1FYM A;  3EUH A;  3MKZ A;  4MEX F;  1A36 A;  3S1N J;  2ID3 A;  2BHZ A;  2TRT A;  1VQ5 I;  2ZSI B;  4BXF A;  2HTS A;  5L3G A;  1HW5 A;  1VI0 A;  4LJZ F;  2DA2 A;  4A69 C;  3I58 A;  3L09 A;  1X4P A;  5D4R A;  1KZH A;  3PNY A;  3HEF A;  1FTT A;  2UV1 A;  4XN3 A;  2VPL A;  2M4K A;  5D5U B;  4YFK F;  5F04 A;  5HNH A;  1R9T J;  2IAI A;  2M34 A;  2MD5 A;  2NVU B;  3ESW B;  2K9Q A;  3HHH A;  5KAF C;  2XPU A;  2Y0M A;  2MW8 A;  5DCF A;  4M3B A;  3SZG A;  1D0Y A;  3R4K A;  2GM4 A;  1T56 A;  2QEN A;  3JRA A;  1JT6 A;  1G6N A;  3GTM J;  2FE3 A;  2V1N A;  4XR6 A;  4Y3O A;  1B9N A;  5J4V A;  2E35 A;  1IO2 A;  2NOG A;  4UNO A;  5DS9 A;  1YTY A;  1Z3X A;  4E7J A;  2OA4 A;  4MGR A;  4IQJ A;  2PJP A;  4G9Y A;  4R8H A;  4P9U A;  1Z21 A;  5M5Y J;  2HFH A;  3H5A A;  5FFZ A;  2QVO A;  3PSI A;  2WV1 A;  4AYB N;  4UY8 I;  1SD5 A;  3TDZ C;  3J7Z I;  3L2V A;  1OQY A;  4HYE A;  4KIT B;  2ISY A;  4I99 C;  2XAQ A;  3K0L A;  3JSP A;  3KPH A;  1YLF A;  2W25 A;  3BP8 A;  3HOY J;  5K7H A;  1DP3 A;  4BHB A;  2ELJ A;  4PJL A;  2IGM A;  4BHC A;  1HDP A;  1ZRE A;  3FKJ A;  4BQA A;  2R5Y A;  3G73 A;  3I4P A;  3EUH C;  4L0Z B;  2EA2 A;  1OCT C;  3R6S A;  2EBI A;  2HYG D;  1J5Y A;  1LVA A;  1WI3 A;  1MND A;  2W82 A;  4HEA 2;  3UNG C;  2BY3 A;  5F08 A;  2WBM A;  4B3X A;  4YEJ A;  2JSP A;  1TNS A;  4JX6 A;  1BW5 A;  3ZXS A;  1NG6 A;  3C3W A;  2CS3 A;  2FBK A;  3F6O A;  2FX0 A;  4II3 A;  1QVT A;  3S3N A;  3A0H C;  1TL8 A;  4G7H F;  2VON A;  1R71 A;  1MBF A;  4MQ9 F;  4XLE A;  2EFQ A;  4BJ6 C;  3H3U A;  5J1R A;  5EEG A;  2P81 A;  2W00 A;  1DPR A;  3BG5 A;  3VWB A;  1QBJ A;  4UVB A;  4S0H B;  3KCC A;  3RYP A;  5E8I A;  1MBJ A;  1FSE A;  4EJW A;  2EZI A;  3CLO A;  4FHT A;  1FP1 D;  2CMP A;  3PO3 J;  2NVT J;  1OCO H;  2MAB A;  1OCR H;  4UB6 C;  5F6F A;  4A0X A;  1T39 A;  1R58 A;  1LEA A;  4AID A;  4HA8 A;  2L9V A;  2XF7 A;  5TIS C;  1RET A;  5DYM A;  2VBW A;  4EGZ A;  2JA2 A;  5FRO A;  1X1C A;  2HWV A;  1WJA A;  3C2H A;  1BBY A;  2N8G A;  2ZCW A;  2ZXH A;  4JX4 A;  5ILV A;  1YJW I;  4RGR A;  2WB1 A;  3ZOB A;  3FDY A;  4U7B A;  4X0G A;  1TNT A;  1XGS A;  2Z3Y A;  2OJE D;  3H9Q A;  3LA7 A;  5CJ9 A;  1A31 A;  1VQL I;  3KIO A;  2BY1 A;  2LKS A;  4FTH A;  3NRV A;  5JHF A;  3REO A;  3MKY B;  3FMR A;  4D7N A;  1HST A;  3FXO A;  5CPR B;  2EZL A;  3PO2 J;  3MWM A;  1JKP C;  3WG7 H;  3HOT A;  2E1C A;  5IT9 K;  1NTC A;  1OPC A;  4LK1 F;  3SEZ A;  2LRE A;  2ME0 A;  4G6T B;  4CCM A;  2M4G A;  4OMY A;  4AIH A;  2NAZ A;  3A03 A;  1B8I B;  4LG3 A;  2IGN A;  5JR3 A;  1XD7 A;  3P5J A;  3K10 A;  4ABZ A;  4G8X A;  3ERE D;  2DQR A;  2E2J J;  3O3K A;  1VFC A;  4BHP A;  2E1O A;  3HBL A;  1LJ9 A;  1H88 C;  1JXS A;  2HGC A;  1IG7 A;  1XMA A;  1GUU A;  2VJI A;  4BJT A;  1ETW A;  3S1Q J;  4DGW B;  3BG7 A;  1B1B A;  2O61 A;  2VBZ A;  3IL2 A;  3CJT B;  3V8J A;  3F8N A;  4E7H A;  2FSW A;  2HU9 A;  4W1U A;  2BHY A;  1Z3Y A;  2EFN A;  5IPA A;  2JK3 A;  2R7Q A;  4ZYA A;  2LH9 A;  4IX7 A;  1B72 B;  3S17 J;  2PQ8 A;  5A2Q Z;  1W0T A;  1KYZ A;  3DPU A;  1X1B A;  3OS2 A;  1AHD P;  2DCE A;  1YIJ I;  3W6K B;  4HNV A;  4RGS A;  2QYO A;  1ZGA A;  3NQO A;  4QWQ A;  1G3W A;  3B73 A;  2QQ8 A;  3ZMS A;  2MGQ A;  4M71 A;  5IYD J;  3FHN A;  5FLV A;  1IC8 A;  2G0E A;  4Y13 A;  4HOB A;  2WAF A;  5L3D A;  1RIO H;  4EJU A;  2GLO A;  3IKV A;  3DU6 A;  2A6T A;  2HTJ A;  2XRL A;  2A3S A;  4UHT A;  1F43 A;  4I0B A;  3KX2 A;  2LBF B;  2L3D A;  1UZC A;  1ZLK A;  3CZ6 A;  2HYJ A;  2XIG A;  1SEU A;  3BZ6 A;  1QU3 A;  5HDG A;  2TCT A;  4Y33 A;  1D8J A;  2YUS A;  2XAJ A;  1S8N A;  2VI6 A;  3E3V A;  4KMF A;  1NK2 P;  2ACJ A;  3ZPL A;  3JTG A;  2ZME B;  3HRS A;  5E17 F;  1UG2 A;  4KIG A;  4DZJ A;  5DM7 F;  3F6V A;  1XDU A;  2KQR A;  2DLL A;  1N78 A;  3E6D A;  1OYI A;  5LGU A;  4G94 A;  4HLX A;  3E5X A;  4N4N B;  3ZN1 A;  2M9H A;  4CYD A;  3SDG A;  3RQI A;  3FXL A;  2L2O A;  3I3L A;  1P7I A;  4UUT A;  1IV6 A;  2PLY A;  4U88 A;  4IHT A;  2X9D A;  2VOD A;  2CGP A;  1JUM A;  3QPT A;  3EQL F;  5FJ8 J;  1TC3 C;  2HKX A;  3TW6 A;  4DQ2 A;  3S2H J;  2PFB A;  4HQM A;  1R1T A;  1REP C;  2DMT A;  2A68 F;  3TKY A;  2DOE A;  2EWN A;  3BR5 A;  4KMU X;  1H0M A;  5E3M A;  3O6B B;  3PIP F;  3Q5F A;  3H9J A;  2Y0S N;  3LMM A;  2KL4 A;  3LQR A;  4I2O A;  4CHU A;  1HKT A;  3HKZ A;  3IH3 A;  2KPM A;  4IJA A;  3L9F A;  4XID A;  3KFW X;  3RKW A;  1D1B A;  2HOS A;  1YS7 A;  4NC6 A;  3IRQ A;  2ZXW H;  3PFY A;  1O57 A;  5FFX A;  1TWC J;  1JUP A;  2EPF A;  1O3Q A;  1D0X A;  1UMQ A;  1FT9 A;  2LYC A;  2RNJ A;  1FWZ A;  2O0Y A;  3J80 K;  2BVL A;  4Z6Y A;  1YG2 A;  3GBG A;  2IP2 A;  2KKO A;  3C2G A;  3EYI A;  3K70 D;  1AKH B;  2NS7 A;  1KQ8 A;  3OYJ A;  1E2X A;  4DYR A;  4ETS A;  1G2H A;  4G12 A;  4CH7 A;  5EG0 A;  4Q48 A;  2E36 A;  1XMK A;  3KLO A;  4RM2 A;  4BQN A;  3S93 A;  3BCA A;  1MJ9 A;  2XGD A;  3UKG A;  3QPH A;  2R7O A;  4AD9 A;  2XDV A;  2PX9 A;  2QQB A;  3GVA A;  4F91 B;  2IGO A;  1F36 A;  3DXJ F;  4RBO A;  1QO0 D;  2R93 J;  4AVZ A;  4YG2 F;  1I6X A;  1S72 I;  1FJL A;  2CG4 A;  4L5J A;  2DU9 A;  3QP6 A;  3IH4 A;  4UV9 A;  2Q2E B;  3C1D A;  4IHX A;  2GOX B;  1V3F A;  1DQU A;  5D4S A;  3RI4 A;  5ILU A;  4HQE A;  1EH6 A;  3J7Y J;  1K6O A;  1OIS A;  3LSH A;  1P4W A;  3F0C A;  4I98 B;  2E2H J;  2E71 A;  4KYW A;  3IUO A;  1R1U A;  3L2C A;  4E7L A;  1R49 A;  2Q8K A;  4KIS A;  2FF4 A;  4LLG F;  2BOL A;  1OCC H;  2F6C A;  4HF2 A;  3JRE A;  2AQF A;  2XGC A;  3Q9V A;  3L2R A;  1HC8 A;  2IA2 A;  1G3Y A;  3ZR8 X;  4EJO A;  1MMN A;  3WTY C;  3JRG A;  1MBE A;  3S8P A;  1LQ1 A;  3BLY A;  1D0Z A;  3H9G A;  3I0T A;  2XB0 X;  5FD6 A;  2M7A A;  4ZDP A;  1V5F A;  2XAG A;  1J9I A;  1O7L A;  2WAE A;  3ABL H;  2UZK A;  3EUA A;  3U21 A;  3WTT C;  4Y52 J;  3GTJ J;  2M30 A;  1FIA A;  3C18 A;  1ZLJ A;  3PNV A;  3K70 C;  1JI8 A;  2R5Z A;  2FJ1 A;  4ZYE A;  1T8I A;  2QBY B;  2STT A;  1AU7 A;  1R1V A;  3CMM A;  2Y48 A;  5EEA A;  3VDX A;  1NHA A;  5FKK A;  4BYY A;  3KZY A;  2PEX A;  4IHY A;  3CJN A;  3ZMZ A;  1BL0 A;  2CUZ A;  3BPV A;  4LOC A;  1EH7 A;  3WTU C;  4DYQ A;  2D1V A;  2VKH A;  2O5R A;  4FT8 A;  3TOA A;  3RKQ A;  5E3N A;  4ZDO A;  2KIQ A;  2F4O B;  2JRM A;  3DTE A;  1YYV A;  4MNU A;  3ZQC A;  3H3Z A;  4A0Y A;  5DCM B;  5L3F A;  1C0W A;  1T38 A;  3CCQ I;  1X2M A;  4RGX A;  5J8F A;  2RAE A;  1XPX A;  2VJ5 A;  5BMZ A;  2EV0 A;  2KZG A;  3OSF A;  3G2B A;  2ME6 A;  4A6D A;  3JAM Z;  1Y56 A;  5F0H A;  3K1M A;  4ENN A;  2EIL H;  1VTN C;  4JX5 A;  3ZMD A;  1MMG A;  3SFZ A;  4J00 A;  3ZGK A;  5EF6 A;  3MZY A;  3L2Q A;  4NUB A;  2ETH A;  3KEY A;  2Y69 H;  4Q47 A;  4XLC A;  2ELH A;  3U1K A;  4BGD A;  1K61 A;  2OTL I;  4IOA F;  1HLV A;  3E6C C;  3QU6 A;  3ML6 A;  1LB2 A;  3E6M A;  5EDN A;  1WGX A;  1Z05 A;  1YW7 A;  2CQQ A;  4DNC A;  3BCB A;  2PMZ A;  4HX7 A;  1TWA J;  5K5O A;  3AL0 C;  1GDT A;  4V2F A;  4M6X A;  1ZR4 A;  3M9A A;  1TTY A;  3K2Z A;  3BTJ A;  5LEK A;  2K9S A;  4PSW A;  1DGW Y;  4JQF A;  3NWT A;  2VPR A;  1S5L C;  1IZ1 A;  5HS9 A;  3RPU D;  2DBB A;  2R7F A;  3ZCO A;  4XOT A;  5LGT A;  3AAF A;  2X0L A;  2XPW A;  3BR3 A;  5J40 A;  1SFU A;  4OIR F;  4ZJZ A;  4IL6 C;  1V54 H;  4HZF A;  2WC2 A;  2BY2 A;  1MSF C;  3SQN A;  3Q0W A;  4UUV A;  2CQ7 A;  1TT5 B;  1FBU A;  1A6I A;  1MIJ A;  2F5D A;  1XGO A;  2HKO A;  4ZDL A;  3H5N A;  3GZ5 A;  2CV1 A;  3E5Q A;  2XHK A;  3UR3 C;  5M3F J;  5BPD A;  3I56 I;  4E7I A;  4LMY A;  1R5H A;  1VND A;  1R5G A;  5DDG A;  1HKQ A;  3R60 A;  4GGG A;  4LB6 B;  5ED4 A;  3RZO J;  4NQW B;  1D8K A;  2JPB A;  3DF8 A;  4XRF A;  1X1D A;  3C7J A;  3LSI A;  1GVD A;  2KJC A;  3JTH A;  4L5E A;  2B0L A;  3GUD A;  3VOD A;  3F8F A;  1TW3 A;  2CWE A;  3K4J A;  3IAS 2;  1K83 J;  2LF7 A;  1R7J A;  3CDH A;  3OYI A;  4HDU A;  1YRN B;  4MIM A;  5M3M J;  1QNT A;  4ESJ A;  5HS7 A;  3WU1 B;  4OU0 A;  4HX4 A;  3ZQH A;  1G3S A;  5E3O A;  1PP8 F;  1OCZ H;  4C2U A;  2KRF A;  3SXY A;  1I39 A;  1WKM A;  3VSK A;  1SVO A;  3GFM A;  3WU2 C;  4HSR A;  2K27 A;  5H6Q A;  4RGU A;  3TOB A;  5CYV A;  1ENH A;  2BZT A;  3RKY A;  2E2I J;  1MJB A;  1TLH B;  3MAJ A;  2MLG A;  3FXM A;  3CCR I;  2EK5 A;  1ETQ A;  2V4J C;  4GO1 A;  4U0V A;  1IF1 A;  3ABM H;  4BQQ A;  3S14 J;  1XSV A;  1G4D A;  3N97 A;  2MH9 A;  4UVA A;  5IYB J;  3DBR B;  2ZXI A;  2IJL A;  4KN4 X;  3CCM I;  4QLC U;  1IRF A;  1WHU A;  2VKD A;  4B8X A;  4BAY A;  3DKY A;  4WK8 F;  3QPS A;  5FD5 A;  4DBQ A;  3FXQ A;  2H8W A;  2F5E A;  4OIP F;  1EKE A;  2HYF A;  2LVS A;  2XUB A;  4CCN A;  1ZH5 A;  3ABU A;  3WE3 A;  4KFC A;  3S2D J;  1WWX A;  5TRD A;  2HVR A;  4U0Y A;  1XTA A;  4NHJ A;  4BEH B;  1SAU A;  2Z5U A;  2A5Y B;  2BEO A;  1ZG1 A;  5LGN A;  3OYH A;  2R7Z J;  5EGO B;  4CCJ A;  1P2F A;  1N25 A;  1A6Q A;  1SVL A;  4RM3 A;  3IKT A;  2MFZ A;  2FBH A;  3CF5 F;  5GAE J;  2CH0 A;  4NC7 A;  2L0K A;  3FM5 A;  5CVU A;  2VQC A;  4F55 A;  1B72 A;  3DPT A;  1X1P A;  1V5E A;  1KU7 A;  3L2W A;  2EIJ H;  1HW2 A;  3CC2 I;  2L5Q A;  1FNN A;  4KIF A;  2Q1Z B;  3ELK A;  3OYF A;  2VN2 A;  1DU0 A;  1VQ6 I;  1W7P B;  1MBH A;  2D1H A;  4GYG A;  2IPQ X;  3SDB A;  1BIA A;  2LLK A;  2LY1 A;  4QSH A;  2ZFU A;  3U1D A;  2G9W A;  3F23 A;  3DU5 A;  3FIS A;  1HBX G;  3BJA A;  1JGS A;  1HOM A;  2K3F A;  2LBF A;  2XSJ C;  1S7O A;  1O7F A;  2E7X A;  1T08 B;  2HR3 A;  4HAM A;  4IRH A;  5CVV A;  1RRJ A;  3CJR B;  2HPM A;  2BBY A;  5KVR A;  5BQT A;  3RCO A;  1GV2 A;  1YIT I;  2HEO A;  1RR7 A;  2CUJ A;  4AIJ A;  1YE9 A;  2ZME A;  4JP0 A;  4N4O B;  1ZGW A;  4OIO F;  4LIT A;  2EFO A;  4HW0 A;  1JGG A;  3K4K A;  1AA7 A;  3ASO H;  2K86 A;  4RAF A;  2LY2 A;  4B09 A;  3E97 A;  3I64 A;  3RYR A;  1S7A A;  4D5F A;  1Q1V A;  2J5P A;  5FKL A;  4XOP A;  3L00 A;  1EJ9 A;  3H1C A;  1VQP I;  2R92 J;  2VKE A;  3KP2 A;  4WF2 A;  1R4M B;  4CUG A;  3J81 Z;  4ENK A;  3O8G A;  4V2G A;  3ZQI A;  1ZKG A;  4HLY A;  2MLK A;  1W36 C;  2O6G E;  3OV8 A;  3D0S A;  4LG0 B;  2COM A;  3LSM A;  4MO7 A;  5JLX A;  2RQP A;  3BTL A;  5FLX Z;  4PSX A;  4BAC A;  2M5W A;  1LDK B;  4Q4Z F;  1MMS A;  1JHH A;  1E17 A;  1QGP A;  2KJB A;  1B59 A;  3AG3 H;  5E79 C;  3BWG A;  1XC5 A;  4PJJ A;  2O8X A;  3SEQ A;  3ZRG A;  5B5E C;  2XRO A;  2V6C A;  1SMT A;  5IOY A;  2HQR A;  2ESN A;  4BKX A;  4E7K A;  3CCY A;  1CGP A;  1ZAR A;  4D7M A;  1AWC A;  3HSE A;  3KEQ A;  2DA4 A;  2QSF X;  2MG4 A;  3H0D A;  3HYI A;  2L02 A;  4PCQ A;  1JE8 A;  4G6Q A;  4CIC A;  2Q0O A;  4GDF A;  3PUB A;  3SZT A;  2Z2S B;  4XRS G;  1AKH A;  1YOV B;  3HUG B;  3BDD A;  2HOT A;  1TZL A;  2PMU A;  1ONV A;  3MFK A;  3TMO A;  1BJA A;  3O2P E;  4KJZ A;  1I1G A;  1O3R A;  5IP9 J;  1XDS A;  2ZME C;  3EDP A;  2JWT A;  4BQO A;  1YHQ I;  1MBK A;  3I4M J;  1D5Y A;  3FMS A;  4ENM A;  2A5W A;  4JK1 X;  4BL0 B;  2HQA A;  4WWC A;  1IXC A;  4M3D A;  1WPK A;  2H1L A;  3KYD B;  1DGR M;  4ZYG A;  4F93 B;  1SD6 A;  1XMX A;  3QOD A;  3M1E A;  5DM6 F;  3S16 J;  3P9K A;  2Q2E A;  5B3S H;  1K6Y A;  2WY8 Q;  4I7H A;  5GPA A;  5JLW A;  1BW6 A;  3HPH A;  2LRD A;  1VQM I;  3I9V 2;  2DPD A;  1JT0 A;  1ITY A;  2CU7 A;  2VXD A;  1H89 C;  2BXY A;  5AON A;  4EEF G;  4FIS A;  3LNQ A;  2A61 A;  4ZYH A;  1OYW A;  2QF7 A;  2NVY J;  3NAR A;  4IO9 F;  1GT0 C;  3J7A O;  4XMY A;  2QQ9 A;  2YPR A;  4E7Z A;  3GLL A;  2DTR A;  3L7W A;  1H8A C;  4EM2 A;  2VXZ A;  3ZP5 A;  4B44 A;  3ERM A;  2CV0 A;  2L01 A;  2KHM A;  3ABK H;  3FBN B;  1B9M A;  2OCE A;  3GW2 A;  2BGC A;  1ZAO A;  2DYR H;  1YX5 A;  2GA1 A;  4XKV A;  1VF9 A;  2LD5 A;  1OR7 A;  2FA5 A;  4GYI A;  3CES A;  1RC9 A;  3I53 A;  1F4K A;  3I54 A;  1G3T A; 
#chains in the Genus database with same CATH homology
 3TW7 A;  4IHW A;  1JUP A;  3RZD J;  3ZQF A;  1UMQ A;  2ECC A;  1ORK A;  2HXI A;  4A3J J;  3HGG A;  1JUS A;  5FKM A;  1UHS A;  4AUX A;  2ECB A;  4J19 A;  3GTO J;  3HKZ N;  3GBG A;  1AKH B;  2NS7 A;  2OPT A;  1ZTR A;  3QQA A;  4DYR A;  4AC0 A;  1G2H A;  1U8B A;  1OJL A;  1RES A;  4G12 A;  5EG0 A;  4A3K J;  1X58 A;  4A3F J;  2DA1 A;  2XGD A;  3UKG A;  5M5W J;  5DTD A;  2M8G X;  2Y9Y A;  3IH2 A;  3SFI A;  2K40 A;  1F36 A;  2QCO A;  1JKQ C;  1QPI A;  2AO9 A;  4RBO A;  1LE8 B;  2R93 J;  2DA3 A;  2E19 A;  3HOZ J;  3K2A A;  1ETY A;  4XIC A;  1TWG J;  1FJL A;  2Y30 A;  2B63 J;  1XS9 A;  4FE7 A;  3L1P A;  3IH4 A;  2K9N A;  4IHX A;  2DA5 A;  3BG3 A;  3JRC A;  5F1J A;  1Z77 A;  4BXX J;  5F27 A;  4XK4 A;  2NVQ J;  3F0C A;  2E2H J;  3A01 B;  3K7A J;  3OIO A;  5FKO A;  2ZB9 A;  3PM1 A;  3HDD A;  2HDD A;  1Y1V J;  1POG A;  2I10 A;  3JRE A;  3S15 J;  2XGC A;  1APL C;  3GTQ J;  4B3A A;  3M4O J;  2LP0 A;  2X48 A;  3JRI A;  3JRG A;  1IJW C;  1MBE A;  1MNM C;  3G1O A;  4NDL A;  4UUS A;  2ELK A;  2WAQ N;  2XB0 X;  4A3C J;  1ETK A;  1QRY A;  2JA7 J;  4Y52 J;  3GTJ J;  1FIA A;  2R5Z A;  2FJ1 A;  3B6A A;  4C2M J;  4CYC A;  4X1E A;  3DCF A;  2IBD A;  3TED A;  1U78 A;  2JA6 J;  1WCM J;  1AU7 A;  5EEA A;  1ZK8 A;  1MH3 A;  5FKK A;  5J1U A;  4IHY A;  2LR8 A;  1PUF A;  1BL0 A;  2EZH A;  2VKV A;  3C2B A;  4LOC A;  2KT0 A;  5EG0 B;  3HOW J;  4DYQ A;  2H8R A;  1LFB A;  3TP0 A;  1E3O C;  3RKQ A;  4D5C A;  1SAN A;  5E3N A;  2R0Q C;  3BT9 A;  3FIW A;  1B8I A;  3ZQL A;  3ZQC A;  2CQX A;  3S1R J;  3WHB A;  4MFE A;  4A3I J;  1A5J A;  1EF4 A;  2DMU A;  1X2M A;  1I3Q J;  5HOD A;  4FCY A;  2RAE A;  1BA5 A;  4BBS J;  1WH7 A;  2LTP A;  3OSF A;  2YU9 J;  2ME6 A;  2CUE A;  2CJJ A;  3ZQG A;  3BR6 A;  4Y7N J;  5F0H A;  3Q0V A;  3WHC A;  4JX5 A;  3Q3S A;  1YRN A;  5GPC A;  5FKN A;  4DZP A;  3S1M J;  1Y1W J;  3GTK J;  5EF6 A;  4DYC A;  2DA7 A;  1JJ8 C;  5J1Y A;  1K61 A;  1OFC X;  2JJ7 A;  1HLV A;  3H0G J;  1JJ6 C;  1U9N A;  5EDN A;  1WGX A;  1IRZ A;  3CDL A;  2CQQ A;  4MLO A;  1TWA J;  2XPV A;  1ETV A;  4V2F A;  1ZR4 A;  1GDT A;  3M3Y J;  1I6H J;  3BTJ A;  3HOV J;  2K9S A;  4FE4 A;  1JTX A;  3LOC A;  4QIW N;  4IEJ A;  3LSR A;  2VPR A;  4W97 A;  4C3H J;  4UUS B;  4RDU A;  2LKX A;  3SJM A;  4M3G A;  4C3J J;  1IDZ A;  4M6V A;  5IP7 J;  3HB9 A;  2XSD C;  5EZG A;  1T33 A;  2XPW A;  3BR3 A;  3E7L A;  1NK3 P;  1CQT A;  3Q0U A;  2PMZ N;  5IOZ A;  2R5Z B;  2OF7 A;  4CYC B;  3GTP J;  3S1N J;  2DJN A;  1MSF C;  2ID3 A;  2FQ4 A;  3Q0W A;  1JTY A;  1A6I A;  2TRT A;  1ZR2 A;  1VI0 A;  2DA2 A;  4A69 C;  1PUF B;  5M3F J;  2O9L A;  5EZH A;  5BNG A;  5C4J J;  3HEF A;  1FTT A;  5EGO A;  4A3G J;  1VND A;  5F04 A;  1R9T J;  2O8K A;  2IAI A;  2DTZ A;  2M34 A;  3RZO J;  3HOX J;  2K9Q A;  3BTC A;  2XPU A;  1GVD A;  4L5E A;  5FLM J;  2MW8 A;  4M3B A;  2LK2 A;  2GM4 A;  1T56 A;  2O7O A;  2JMW A;  3FKI J;  3JRA A;  3BR0 A;  3HM5 A;  1O4X A;  1JT6 A;  3NAU A;  3GTM J;  1K83 J;  4DW6 A;  2NOG A;  5DS9 A;  1YRN B;  3JRD A;  4MIM A;  5M3M J;  3TP3 A;  3ZQH A;  2NS8 A;  5E3O A;  1MH4 A;  4M3F A;  5M5X J;  5M5Y J;  3LSP A;  2WV1 A;  4AYB N;  4A3L J;  3MVP A;  1SFO J;  4I6Z A;  1I50 J;  2KDZ A;  3HOY J;  4A3B J;  1ENH A;  5K7H A;  2E2I J;  3OOU A;  3MN2 A;  1HDP A;  1ETQ A;  2LFB A;  4IHV A;  3I4N J;  2Y9Z A;  3BG9 A;  2R5Y A;  3S14 J;  2D5V A;  1OCT C;  2EBI A;  5IYB J;  1HDD C;  3G1M A;  1WI3 A;  2EQR A;  3QPS A;  3B6C A;  5F08 A;  3S2D J;  2LVS A;  5C4X J;  1TWF J;  4JX6 A;  1BW5 A;  3O8H A;  2FX0 A;  1QVT A;  2IEK A;  2R7Z J;  5EGO B;  2H1K A;  1MBF A;  2FD5 A;  3D1N I;  5J1R A;  3QPL A;  2L0K A;  2P81 A;  2DMQ A;  1B72 A;  3BG5 A;  5F0C A;  4S0H B;  1TWH J;  2HQ5 A;  1MBJ A;  2EZI A;  4QTR A;  3PO3 J;  2L9R A;  2NVT J;  1JKO C;  5GP9 A;  1FEX A;  1DU0 A;  3H3V K;  2L7Z A;  1MBH A;  4A93 J;  3FK7 A;  2LLK A;  4QSH A;  1HF0 A;  5IP6 A;  4M3E A;  1RET A;  3FIS A;  9ANT A;  2CRG A;  5J3L A;  1FIP A;  2ID6 A;  1HOM A;  2W48 A;  3OSG A;  2MSY A;  2HI3 A;  3DEW A;  5K7Z A;  4B1R A;  2HOA A;  2L7F P;  2N8G A;  4JX4 A;  1RKW A;  3ZOB A;  2DN0 A;  1GV2 A;  1OCP A;  1RR7 A;  2EH3 A;  4JP0 A;  5F0F A;  4FTH A;  1ZGW A;  4A3D J;  1ETX A;  2M0C A;  4D7N A;  1JGG A;  3A02 A;  2VUM J;  2EZL A;  1ETO A;  1U9O A;  4XRM A;  3PO2 J;  4C3I J;  1JKP C;  1S7E A;  1NTC A;  4D5F A;  5IYC J;  4A3M J;  1Z0X A;  1Q1V A;  2R5Y B;  2ME0 A;  5FKL A;  4X6A J;  1P7J A;  3MKL A;  4XRS A;  1W0U A;  2Y31 A;  4GFB A;  3BTI A;  3FK6 A;  2WB1 N;  2R92 J;  2VKE A;  1RKT A;  3A03 A;  1B8I B;  3O8G A;  4V2G A;  3ZQI A;  1ZKG A;  4BY7 J;  1QVU A;  4MO7 A;  5JLX A;  3BQY A;  4ABZ A;  3BTL A;  2E2J J;  1VFC A;  2E1O A;  3HBL A;  4A3E J;  1H88 C;  1IG7 A;  2EZK A;  1GUU A;  2X6O A;  1ETW A;  3S1Q J;  3JR9 A;  3LSG A;  1XC5 A;  3GTL J;  4W1U A;  1JKR C;  5IOY A;  3GTG J;  3HGY A;  2JA5 J;  3W6V A;  4BKX A;  1IUF A;  5IPA A;  3CCY A;  2JK3 A;  1B72 B;  3S17 J;  4D7M A;  1W0T A;  2DA4 A;  1X2N A;  2MG4 A;  1AHD P;  2XB5 A;  3JRB A;  1LFU P;  2COB A;  2CUF A;  4HNV A;  4BY1 J;  5E3L A;  2AHQ A;  1FTZ A;  2MGQ A;  5IYD J;  5FLV A;  1IC8 A;  2G0E A;  4XRS G;  1AKH A;  2JN6 A;  2GLO A;  3CQZ J;  1BJZ A;  1GV5 A;  3IV5 A;  2HOT A;  2XRL A;  3VPR A;  1F43 A;  1HCR A;  1IGN A;  2L7M P;  5IP9 J;  2HYJ A;  2XGE A;  2JWT A;  2TCT A;  1MBK A;  2YUS A;  3I4M J;  1D5Y A;  2VI6 A;  1NK2 P;  3BQZ A;  1LE8 A;  5EYR A;  1UG2 A;  4DZJ A;  3LSJ A;  3JRF A;  4M3D A;  2NVX J;  1WPK A;  1DU6 A;  4B4C A;  1MBG A;  1XG1 A;  2M9H A;  1IDY A;  3S16 J;  3BR1 A;  3SDG A;  3RQI A;  5GPA A;  5JLW A;  1BW6 A;  2JA8 J;  1P7I A;  4UUT A;  1JT0 A;  1IV6 A;  1ITY A;  2CU7 A;  1H89 C;  1WH5 A;  2GBY A;  2X9D A;  4EEF G;  4FIS A;  3LNQ A;  1JUM A;  2QF7 A;  2HXO A;  5K7F A;  2NVY J;  3NAR A;  2DA6 A;  5FJ8 J;  2DMP A;  3A01 A;  3TW6 A;  1GT0 C;  1MSE C;  1TC3 C;  3S2H J;  2YS9 A;  4BBR J;  5C3E J;  2DMT A;  4MFD A;  3G1L A;  2M2E A;  3BR5 A;  1RPW A;  1H8A C;  5E3M A;  2LY9 A;  3HOU J;  5C44 J;  2Y0S N;  3IH3 A;  2DMN A;  4XID A;  2HOS A;  1VF9 A;  4JYK A;  2LD5 A;  2Y2Z A;  3JRH A;  4I76 A;  3CMY A;  1ZQ3 P;  3BR2 A;  1TWC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...