3S1RJ

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s1rJ00
2ECCA 3HEFA 5JLWA 4A3IJ 1FIAA 2LVSA 4UUSB 1FTZA 1RETA 2EZIA 1GUUA 2O7OA 5K7FA 1JKPC 3S14J 2CU7A 1BA5A 3WHCA 3D1NI 1MSFC 5GPAA 1AHDP 2ME0A 2XPUA 2DA7A 4B4CA 4BBRJ 3IV5A 4JX6A 1QPIA 4DYQA 5EDNA 1YRNB 1Z0XA 1VFCA 3A02A 2COBA 1DU0A 3BR0A 1CQTA 5FKNA 3GTGJ 2LR8A 4BY7J 5E3NA 2TCTA 1K83J 1RKWA 5C44J 9ANTA 2R5YB 3JREA 1MSEC 3BR3A 2VPRA 2O9LA 1OFCX 5EZHA 1TWFJ 2HI3A 2YS9A 2NS8A 4DZPA 1Z77A 1H88C 1RPWA 1Y1VJ 3QPLA 4JX4A 1LFBA 1LE8B 3SJMA 1ETXA 1X58A 3W6VA 3G1MA 1GV2A 1ENHA 3BR5A 3OSGA 4NDLA 4A3EJ 3HBLA 3HOWJ 4LOCA 1GV5A 1WGXA 1ZGWA 2JA8J 2M9HA 4D7MA 3A01B 5F0HA 1TWHJ 2R0QC 4XIDA 5FKMA 2DA6A 1UMQA 2CUEA 1I3QJ 4QTRA 2MSYA 3CCYA 2R92J 3HOZJ 2LP0A 2Y9YA 1P7JA 2NVXJ 4QSHA 3G1OA 1TWAJ 4M6VA 2DA4A 1JJ8C 2MGQA 5IP6A 2LKXA 2L0KA 2FJ1A 4A3MJ 2JN6A 3S16J 3B6AA 4UUSA 1UHSA 2MW8A 1ITYA 1BW5A 5M5WJ 3MVPA 2DMTA 3F0CA 4AUXA 5E3OA 4HNVA 1POGA 2XGEA 2VUMJ 2XB5A 2H1KA 2X6OA 5J1UA 4MFDA 1ETOA 1IUFA 1ETYA 5F08A 2EH3A 3BG9A 2KT0A 4M3EA 4C3HJ 4A3FJ 1JKQC 2YUSA 3ZQHA 3JRAA 2MG4A 5IPAA 2E2JJ 2K9SA 2E2IJ 2EZKA 2XPWA 3HDDA 3S1RJ 3BTIA 2JMWA 2NOGA 1FJLA 1XS9A 2L7MP 2FQ4A 1JKOC 3HB9A 4FCYA 5EF6A 2DA5A 5FKKA 1U9NA 1A5JA 1F43A 3TEDA 1QVUA 3GTMJ 2ID3A 2LK2A 2K9NA 4D5FA 3HOXJ 3JRIA 2K40A 1OCTC 1B72A 2JA6J 1Q1VA 3ZQCA 1B72B 1MBJA 3JRDA 3E7LA 2EQRA 3PO3J 3A01A 3M3YJ 1ZKGA 1I50J 3B6CA 3VPRA 3FKIJ 1IG7A 4M3FA 5DS9A 2HYJA 1BJZA 1LE8A 5F0FA 5DTDA 3JRBA 1R9TJ 2RAEA 1ZTRA 3IH3A 4S0HB 1MH3A 1JUSA 1VI0A 3HGGA 2R93J 3S1MJ 1F36A 4B3AA 1RR7A 1G2HA 3MKLA 4GFBA 1BL0A 4CYCA 2X9DA 3FIWA 3TW6A 2TRTA 2OF7A 4A3DJ 5EG0B 1IJWC 5M5XJ 1PUFA 1GDTA 5F27A 2M34A 2R5ZA 2VKEA 2CQQA 2OPTA 2WAQN 1HDPA 2E1OA 2G0EA 2ECBA 3PM1A 1OJLA 5JLXA 5IOYA 5FJ8J 2Y31A 3DCFA 3Q3SA 5IOZA 4CYCB 3Q0UA 2ZB9A 3OSFA 5EG0A 2L7ZA 1HF0A 3JRCA 1PUFB 3SDGA 3JR9A 3FK6A 3LNQA 3LSRA 1GT0C 2XSDC 3O8HA 2PMZN 5F0CA 2IEKA 3S15J 1ETQA 1D5YA 4A69C 2NVQJ 1WCMJ 3GTQJ 3RZOJ 2ME6A 3HKZN 2DMQA 5EGOA 4IHXA 2QF7A 5EGOB 5FKOA 3JRHA 2XPVA 3FISA 5EZGA 1IDYA 4MIMA 4DW6A 1GVDA 5M5YJ 3Q0VA 3NARA 3GTLJ 1LFUP 3BR6A 3RQIA 4MLOA 5IP7J 2DA1A 2W48A 3BTJA 1TWGJ 2DA3A 3BG5A 3BTCA 1ZR4A 2NVYJ 1U8BA 4XICA 3HGYA 3JRGA 1HLVA 2DTZA 1MBFA 1VNDA 1K61A 3TP0A 2X48A 2M2EA 4A3BJ 3TP3A 1UG2A 2O8KA 3QPSA 4FE4A 1QRYA 2KDZA 3ZQLA 3IH4A 4B1RA 3M4OJ 1XG1A 3BT9A 2JA7J 1WH7A 2CJJA 2M8GX 4JX5A 4M3BA 2WB1N 4BY1J 4C3JJ 3G1LA 4RDUA 1SFOJ 5EYRA 1JT0A 2H8RA 4JP0A 3FK7A 3HOVJ 1IGNA 3O8GA 5E3MA 5BNGA 3LOCA 1RKTA 3L1PA 2HQ5A 2R5YA 1DU6A 2DMPA 4Y52J 4IEJA 1AKHB 3S2HJ 2L7FP 4L5EA 2E2HJ 4V2FA 3GTPJ 1VF9A 1IV6A 4XRMA 4EEFG 5C4XJ 5F1JA 4C3IJ 1B8IA 2XGCA 4A3KJ 3S1QJ 4DZJA 1WH5A 3PO2J 3WHBA 1W0TA 2NVTJ 4FISA 3A03A 1O4XA 3GTKJ 1BW6A 2VKVA 3ZOBA 2B63J 3TW7A 5C4JJ 5EEAA 1JUMA 4MO7A 1NK3P 4IHVA 2FX0A 2M0CA 4XRSG 3I4MJ 4BKXA 3RZDJ 3MN2A 1WI3A 4Y7NJ 4XK4A 2DA2A 2XRLA 5J1YA 2IBDA 3LSPA 1U78A 2DN0A 1FEXA 1ZQ3P 2IAIA 4I6ZA 1X2MA 2XB0X 3ZQFA 4J19A 2QCOA 4RBOA 3S2DJ 5FLVA 1ETKA 2HOAA 4XRSA 3OIOA 2HXOA 3GTJJ 4V2GA 1A6IA 2CRGA 1HDDC 1XC5A 4I76A 1I6HJ 1EF4A 1ORKA 2DMUA 2Y30A 2FD5A 1YRNA 1T56A 3S17J 5E3LA 5IYBJ 2XGDA 5GPCA 3K7AJ 3HM5A 2AHQA 2R7ZJ 1MBHA 5K7ZA 4A3GJ 1MH4A 4X1EA 1MBEA 2GM4A 1JJ6C 5IYCJ 4BXXJ 3C2BA 2EZLA 4FE7A 4M3GA 1E3OC 5C3EJ 4A93J 2Y0SN 3CQZJ 3GBGA 3HOYJ 1AU7A 3BR2A 1B8IB 3QQAA 3LSJA 3K2AA 5J3LA 5J1RA 1OCPA 1JGGA 5F04A 5IP9J 1IC8A 1ETVA 5IYDJ 2JK3A 1JT6A 1AKHA 3S1NJ 4D5CA 2EBIA 4C2MJ 4W97A 5HODA 1JTYA 1TWCJ 1SANA 3UKGA 4X6AJ 4AC0A 5M3MJ 2GBYA 1MBKA 3DEWA 3BQYA 1U9OA 3ZQIA 4JYKA 4DYCA 2D5VA 3BG3A 2LD5A 3BQZA 3CMYA 1ZK8A 4G12A 1ETWA 3OOUA 1RESA 1MBGA 1H8AC 3NAUA 1NK2P 2ID6A 4BBSJ 5FKLA 1MNMC 2VI6A 3SFIA 2AO9A 2HOTA 3I4NJ 2HXIA 4IHYA 2I10A 1IDZA 4ABZA 5K7HA 2GLOA 2E19A 1HCRA 4A3JJ 1NTCA 3JRFA 5GP9A 2JA5J 3IH2A 3H3VK 3CDLA 4DYRA 5M3FJ 3H0GJ 1FTTA 1P7IA 1FIPA 1X2NA 2L9RA 3BR1A 1JUPA 1WPKA 2HOSA 2YU9J 2JWTA 1Y1WJ 2CQXA 3LSGA 2R5ZB 4A3CJ 4MFEA 1ZR2A 4QIWN 2NS7A 2P81A 4M3DA 2K9QA 5FLMJ 1IRZA 2LTPA 1H89C 1JKRC 2ELKA 3BTLA 2N8GA 1JTXA 2Y9ZA 3Q0WA 2LY9A 1S7EA 4UUTA 2DJNA 4AYBN 1APLC 3RKQA 2LLKA 2CUFA 2LFBA 4D7NA 1TC3C 1HOMA 2WV1A 4W1UA 1T33A 2Y2ZA 4FTHA 2HDDA 3GTOJ 2DMNA 3HOUJ 3ZQGA 4A3LJ 4IHWA 1W0UA 2EZHA 2JJ7A 1QVTA
chains in the Genus database with same CATH superfamily
5J8CA 1S72I 3HEFA 2KKOA 1BIAA 1FYKA 1FIAA 2LVSA 3GZ6A 2A5WA 4L9JA 1TT0A 2EZIA 3RTRA 2XAJA 4RB2C 3OYLA 3VODA 3CD6I 2K7LA 1CF7B 3V8LA 2ME0A 2XPUA 1E3HA 4B4CA 4JX6A 1QPIA 3F6VA 3BZKA 2E35A 1VFCA 1MJAA 2VE8A 1UHMA 3P9IA 3H9QA 1A6QA 1B9NA 4EQQA 1XGSA 3KYDB 1RKWA 4EATA 4E7SA 5C44J 3OS0A 3EUKL 4XN0A 2STTA 1MSEC 3BR3A 1SAXA 2TDXA 1RNLA 1VQ4I 4E7JA 1XDUA 3QYFA 5EZHA 1UJ8A 4A3DJ 1FLIA 4G6DA 3BDDA 2D1HA 4EM2A 3JSPA 2HU9A 3AG3H 1RPWA 1Y1VJ 4BXFA 1XCBA 3OV8A 1LFBA 4HZFA 4JX4A 4HNTA 1LE8B 3HYIA 1Y56A 3KPHA 2PBIA 1U0JA 3W6VA 2JSPA 1V5FA 2XKPA 3JAMZ 3E5XA 2R7WA 4BQQA 3PIPF 3HBLA 4ITVA 3HOWJ 3CUQA 3K1PA 1ZGWA 4ZYDA 2CQ7A 2R0QC 2GZWA 3EUHC 5FKMA 2L4MA 1IN5A 4KT6A 2UWMA 2MSYA 2IVMA 1D8KA 1REPC 2HTSA 3QYEA 3HOZJ 2LP0A 4EVIA 3J81K 2NVXJ 2XDVA 1TW3A 3DKYA 3VYSB 1TNTA 2L0KA 3ABTA 3PL8A 4G6TB 4XR6A 4KISA 2ESNA 4BS9A 3CTAA 5HLIA 1Y8RB 3D5LA 2Q0OA 3HPGA 3TGNA 3OYMA 3S16J 1FPQA 3C2GA 3FMRA 4UUSA 1K7AA 2IW5A 1ITYA 4YIIA 4ENKA 5A2QZ 1P6RA 2DMTA 2IGKA 2RQQA 4AUXA 3ZRGA 1VQNI 3ZMDA 1IO2A 3TL4X 4IRIA 3BWGA 2LY2A 2QEXI 2VUMJ 1WFXA 1YI2I 3MMYB 2K4JA 3PQJA 1XTAA 3VFZA 2W84A 1R22A 2DPUA 2ZXWH 2XSJC 3I58A 1VQOI 2EFNA 1IUFA 3TO7A 5IT3A 5IT9K 3LSKA 4KMFA 1J09A 2NXNB 3VYUB 3J80Z 3PUFA 2YUSA 5AONA 4G7OF 5IPAA 2NNYA 2XPWA 1U3EM 2EIKH 5H20A 4PK4A 2JMWA 1X1CA 2NOGA 4HSRA 2ZXIA 1XS9A 2A61A 2YSRA 2MLKA 3BJOA 1FSHA 2OUMA 4FCYA 1R4MB 4F7ZA 3ZP5A 3A4CA 2QLZA 1A5JA 4YIFA 2DT7B 1R5HA 1WZ2A 1QVUA 4M6YA 4F92B 3RPQA 3GTMJ 3CCMI 4BL0B 3HOXJ 3JRIA 4ETSA 1ZAOA 4LB5A 1KYZA 5L3FA 2IS4A 1TP4A 2GIZA 2FQ3A 4UXNA 3JRDA 2QSFX 5ICEA 3C2HA 1ZREA 3A01A 3M3YJ 4JQFA 4EV0A 1ZKGA 4BUPA 3DU5A 1BR4A 2LRDA 3V7CA 2AXLA 5DTDA 1OYWA 2MC3A 3K4NA 1MH3A 1JUSA 3MKWB 3QU6A 4BJTA 1QGPA 3MKLA 3DV8A 1W4MA 3DEUA 5BPDA 2ZKZA 5LGNA 3Q9VA 1JHHA 2OBPA 3JSOA 2L9NA 4CYCA 1H0MA 4XONA 3FIWA 1EH8A 5HDNA 3K1NA 2K5CA 4KN4X 2K85A 1V5EA 4BEHB 3J7ZI 2W7NA 2M34A 4EMSA 4BXUA 3CMEI 5E17F 4Y15A 1WJFA 2E1OA 1J9IA 1ZG1A 2ECBA 1YS6A 5FJ8J 1WJEA 3HJEA 4II3A 1Z05A 2RVCA 2D45A 4FX0A 3OSFA 3WTVC 4L5JA 1D1AA 2LF8A 4HF2A 3GTLJ 3SDGA 1IZ1A 4AVPA 5DCMA 4O3MA 3ESWB 3E5UA 3K10A 2M7BA 3PNTA 2V9PA 3S15J 1IXRC 3AKZA 1ETQA 3T1BA 1D5YA 3E1SA 2NVQJ 2G9WA 3GTQJ 3RZOJ 2ME6A 4GYGA 4HBLA 2QKMB 3HKZN 5FB2A 2Y0MA 2R7OA 1YE9A 3FMSA 4N4OB 5EZGA 1A04A 4DW6A 4CXFA 3DTKA 5M5YJ 4RB1A 2XKOA 2FE3A 1HW5A 1DQUA 5CVJA 2HGCA 1QBJA 2I5UA 3BR6A 4MLOA 3UNGC 1L0OC 2HYGD 2W48A 3PJRA 5GADJ 1LUJB 1FYMA 1NHAA 2DTZA 4GO1A 2KIUA 2M3AA 5DM7F 1CGPA 3COAC 5JHUA 1X3WB 3KP5A 1YHQI 4A3BJ 1R6RA 3D5RC 3CDIA 2NRAC 5CYVA 4M6XA 1SFUA 3CC7I 1R1UA 2BE5F 4B48A 5D5WB 1WH7A 5HVQC 1MDMB 2M8GX 2CO5A 4JX5A 4M3BA 1WVRA 2RNJA 4C3JJ 3S3NA 2KPMA 3F8BA 4Z2YA 5EYRA 3FK7A 3LSIA 3D5SC 5BNGA 1SAUA 2DOFA 3CCRI 1RKTA 1W5CC 3FZVA 1QHHD 3KCCA 2VQLA 1F9NA 2GOMA 1R58A 2IJLA 2X1CA 4Y52J 4IEJA 4M9SA 1AKHB 3FKJA 4WF2A 3U1DA 3GTPJ 2IA2A 3MQ0A 2DDAA 4ESJA 2RQPA 3C1DA 3QRFF 3GFJA 4C3IJ 3ZN0A 2WAQA 2FNAA 4DZJA 3PO2J 3WHBA 1MKMA 2ICWG 2GWRA 1O3QA 2CUJA 2KDOA 1MMDA 2XF5A 4UB6C 1VTNC 2NVTJ 1O4XA 3ZOBA 2DT5A 3OR1C 2NOJB 3OYEA 1J2XA 5D5XB 4XOPA 2HS5A 2H8WA 3SFZA 5C4JJ 2HWVA 3HXLA 4E6KG 1FBQA 4MO7A 1NK3P 4S05A 4IHVA 4XRSG 1SVLA 3I4MJ 2YX7A 3CDHA 3ZMTA 3HRSA 2V6CA 3MN2A 4BYYA 2F4IA 4NNJA 2RDPA 2XAQA 4CYDA 3R61A 2XRLA 3ZN1A 1KQ8A 2M1BA 3OY9A 5H6RA 3K70C 1YITI 2QCOA 2P4WA 3F21A 1HSJA 1QQIA 5FLVA 3R60A 3RPUA 2QVOA 3ONQA 1V55H 4LJZF 1HXDA 2Y48A 3WTXC 3OS2A 3K9TA 2ZSIB 4E4HA 2RREA 4ZDOA 1ON2A 1T98A 1I6HJ 2DMUA 2K4BA 1YQAA 5E3LA 1X1AA 1MBHA 4FETA 3SEQA 2EWNA 3OYCA 3HIFA 1P9QC 1K6OA 4IVNA 2GM4A 1BI1A 1ODDA 1XD7A 2EZLA 4MQVA 2E5ZA 2VT2A 4BHCA 2G7HA 3DBRB 2IA1A 2MD0A 3BR2A 1OMIA 1B8IB 4KA4A 2V6EA 4BNCA 4DNCA 2VC0A 3CC2I 3HHHA 1D0YA 5IP9J 4LIVA 4RGUA 2CSOA 2FUG2 1OYYA 3ABKH 4KITB 1E3PA 1WWXA 2JK3A 3CCVI 5BMZA 2M4KA 3MKZA 1TWCJ 4Q5SF 3P7NA 2H1LA 2VT3A 4ESBA 2F5FA 2Z33A 1TTYA 3KZIC 5EJCA 4AC0A 1BC7C 3WTTC 1FNNA 2FBIA 2GBYA 2A69F 4GGGA 1YJWI 1L3LA 3BG3A 2WBMA 2Z2SB 2ELHA 1ZK8A 4B47A 1DPRA 4DIQA 5FRMA 4NB5A 3V7RA 1NK2P 2ID6A 4C2UA 4WXCA 1BI0A 3BPVA 3RCOA 4AM3A 2E1MC 3FHZA 1ZYRF 3AG2H 2AO9A 2J5OA 3I4NJ 2YR2A 4ZTFA 2CW8A 1Z1DA 2E19A 1B9MA 4WK8F 4ZC3A 1KZHA 4PZJA 2PX9A 5GP9A 4CCMA 2JA5J 1J59A 3GCMA 2QM3A 5DV5A 2QQ8A 2KIMA 3W2WA 4CH7A 2OJED 1FTTA 3ZPLA 1FIPA 3CP8A 1JUPA 1WPKA 2YU9J 2LKSA 2CQXA 2UXNA 1G59A 3ISPA 1ERDA 1BIBA 3CF5F 4BE2A 2ZFUA 3DEEA 4I0AA 2K9QA 5FLMJ 1IRZA 2JT1A 1IN8A 2F5EA 5HOOA 4A6DA 2E1NA 1XDSA 3GYHX 3Q0WA 2FNPA 2LY9A 3F23A 1EV7A 1XX5A 1ZARA 1HC8A 1X4OA 1FZPB 4UUTA 3OYNA 2GA1A 4AYBN 4J00A 3RKQA 4KNYA 2KRHA 1EA3A 4CCLA 5J6XA 1S7AA 4PFOA 1HSTA 1PDNC 3BY6A 4XBFA 1P4XA 2HDDA 1GVJA 1ZG5A 1A31A 3ZMSA 3FXJA 5LHGA 4MTDA 2JJ7A 4YG2F 3DBHB 3RJPA 1M1EB 4XLFA 1J5YA 3M8JA 4EJUA 4U0VA 3Q5FA 1F4KA 4A3IJ 3DLLF 3HOSA 1FTZA 2BY0A 3TMOA 5ED4A 4IF4A 4X0GA 2O7OA 1BA5A 1V3FA 3KX2A 2Y0SA 1MSFC 1AHDP 2A07F 2DA7A 3GEZA 3R6SA 3HSRA 1QPMA 4DYQA 1UG0A 4DBQA 1DPUA 4AU7A 2OCCH 1Z0XA 4WXDA 2O5RA 2BXZA 4E7HA 2E34A 3RKYA 2ZFWA 3GTGJ 1SFKA 1U8RA 4JOMA 3O6BB 2CS3A 2LR8A 4BY7J 1QO0D 2TCTA 1K83J 4OIQF 1ACIA 1XMXA 3JREA 4MEXF 1ZN2A 1SC7A 2O9LA 1TWFJ 1XB4A 2HI3A 4HEA2 3U9GA 1E17A 2NS8A 3FXKA 1Z77A 1H88C 3LFKA 4PJNA 2XRNA 2QQ9A 3HHGA 3OYBA 5DCMB 2DODA 4ZTJA 4RB0A 4XLHA 5CKTA 2JVGA 5FO5A 2LMDA 5EEGA 3OSGA 2VQHA 2A6HF 2LKPA 3F3XA 4NDLA 3CO7C 1K6YA 3B02A 5CJ9A 3CUQC 5CVRA 4ZDPA 1TT5B 3K69A 2JA8J 3CF2A 4O6JA 4IHSA 1TWHJ 4XIDA 1Z91A 1UMQA 4BACA 3DU6A 4O5VA 4EJWA 4KFCA 4QTRA 3REOA 4RGRA 3HC7A 4CDGA 1U2WA 3CCQI 4BHBA 2WV0A 2V1UA 4XKBA 3G1OA 4WX9A 4M6VA 4HNUA 2MGQA 2HQNA 3PIOF 2ZNZA 4WCGA 4R79A 2V1XA 2QQBA 5CVVA 4UVAA 1G3SA 1R5ID 5M5WJ 3MVPA 2VODA 1DGRM 4J01A 3ERED 1EH6A 3H3UA 4BU2A 1KONA 4AIJA 1WI9A 2X6OA 3E3VA 2H94A 2QQAA 2GIVA 2W4SA 3OYFA 3EUAA 2PMZA 3SZTA 1ETYA 3P9CA 4N0BA 1JKQC 1Z7LA 4KJZA 3JRAA 4BGDA 2E2JJ 4OINF 3IUOA 1OR7A 2WWYA 3S1RJ 3BTIA 4BQNA 3I5UA 2L7MP 2FQ4A 3H92A 2F6CA 2DK5A 3IWFA 2BV6A 2HR3A 5EF6A 3I3LA 2QSHX 1TQIA 3G71I 1F43A 3WU1B 4B3XA 2ID3A 2LK2A 1WSUA 1IXSB 3IRQA 2K40A 1ZRDA 2P5LC 3H0DA 1B72A 1Q1VA 4E70A 2HEOA 1MBJA 3GZ5A 3QP6A 2H27A 3PO3J 4ON0A 4I99C 3B6CA 1IG7A 3FKIJ 3TDZC 4M3FA 3FXUA 2HYJA 1S9HA 2Q8KA 3DP7A 5F0FA 2G7UA 1R9TJ 4NC8A 2RAEA 1ZTRA 2HYFA 2EA4A 2WA0A 3IH3A 4UNOA 2R93J 5AIPA 1F36A 2DYSH 4B3AA 2EINH 5LLQA 3VEPA 4U0YA 1XGNA 4HQMA 1Z3XA 1TL8A 4GFBA 1BL0A 3CUOA 1MMSA 4LITA 5F1RA 4HX8A 1WRJA 2MBFA 1DGWY 1OISA 2GOXB 2TRTA 3OIPA 4XNFA 5K5QA 2ZNYA 1MNDA 2L9SA 2V4JC 2NAZA 5EG0B 1FOWA 1V4RA 1IJWC 2C6YA 1YS7A 4PDKA 2WAQN 1FYLA 1HDPA 3E6CC 5JLXA 3RQ4A 5IOYA 2Y31A 2LH9A 4BQOA 1K78A 3VSKA 3Q3SA 1MGTA 5IOZA 3V8KA 3PUBA 3Q0UA 2VE9A 2R7VA 3A2KA 5EG0A 1Y8QB 3FM3A 4I02A 1HF0A 5JVTA 4XSXF 5J4YA 4U7DA 1KGSA 2KHMA 3LNQA 2X4HA 1GT0C 1FMVA 3H1CA 2P7VB 2OA4A 2V1DA 5D5UB 3HUGA 3O8HA 2FMYA 5L3GA 1K78B 2L02A 2PMHA 3K4KA 4HYEA 2AXTC 4XRFA 3WTZA 1ONVA 4OU0A 3A1YA 5FKOA 2R7UA 3WGHA 4UV8A 5DM6F 1YJ9I 3KP3A 3I55I 1LQ1A 1GHCA 4IPAA 1I6XA 3CMMA 3RQIA 1LFUP 2MLGA 3TDUC 1N75A 4XLNF 4L0ZB 2VJ4A 4OMYA 3BZ6A 5B1AH 4KMUX 2VBZA 4XICA 2KZVA 3HGYA 3JRGA 1G6NA 1MMNA 3QWLA 3WE3A 4AIDA 1I1GA 4LIUA 3TP3A 1IRGA 3RI4A 2VOPA 2IS6A 1K4SA 3QPSA 5J40A 5JHFA 1QRYA 3ZQLA 4RGSA 3FXMA 2X51A 1ZH5A 1XG1A 4D9JA 5JVGF 4JK1X 2JA7J 2EB7A 2WB1N 3G1LA 2BY1A 3MZ8A 1T38A 1OCZH 1E2XA 3HOVJ 2ZXJA 4MQ9F 1IGNA 2PEXA 4QLCU 2ZCWA 2WC2A 3LMMA 5DD8A 2BVMA 3HRMA 3RIRA 3LQRA 2FRHA 4HSTA 2HQ5A 2VBXA 1G3TA 3ZCOA 2R5YA 2PN6A 2A68F 2ZMEA 4ANJA 4HQEA 1DU6A 5ERIA 2AQEA 3S2HJ 2LSOA 1S3JA 5L3CA 5FGMA 2CUZA 3MEXA 1IV6A 4CO8A 4XKWA 4XRMA 5C4XJ 2ZC2A 3AAFA 5DDGA 1LKXA 4R1HA 1R4NB 2WTEA 5KVRA 4HPQA 1K4TA 3K4BA 3WTUC 2QUFA 3WG7H 4IL6C 2KZGA 3IP4B 2RV8A 4UVBA 4P5OA 3A03A 3CLOA 4KYWA 2Z9OA 4KT5C 3SDBA 2KRFA 4IZZA 1AOYA 1FOYA 1FOXA 5LGTA 1JUMA 4M72A 2ISZA 3L00A 3OYJA 4HAMA 1R23A 2VQCA 1DP3A 4XMYA 2FX0A 2XAUA 2K9LA 2ACJA 3KLOA 2FBKA 5H6QA 2XV4S 4ZYAA 3G4SI 2DFEA 4XN3A 1VQ5I 5KCMA 3CESA 1WI3A 4Y7NJ 4XK4A 3AL0B 3G3ZA 2GQQA 5J1YA 3HL2A 5KNLA 4U87A 5GTIC 3PSIA 2X0LA 5J4VA 1U78A 3I64A 2F4MB 4IRGA 3ZQFA 2EFOA 2BHYA 1I39A 1VQ6I 4UB8C 3NQOA 1RC9A 1ETKA 5DYMA 3N4MA 5FD5A 3OIOA 2CW0F 3L2CA 3GTJJ 3OL4A 1O3RA 2FMLA 1IW7F 4CCOA 3PQKA 2VB6A 5ICFA 3QP5A 4UUVA 2Y30A 1FT9A 1LFPA 1SMTA 5D8LB 4P9FA 2JZYA 3WU0A 3S17J 5LFAA 4RAZA 5IYBJ 2DPDA 4G94A 4E7ZA 5K7ZA 2MD5A 3PNVA 4Z6YA 3CZ6A 2LYCA 3S93A 3LWFA 2CV0A 2OZ6A 4I98B 1TZLA 1LDJA 3IWZA 5B66C 2VASA 2OD5A 1MDMA 1T6SA 2M30A 2Y0SN 3FXLA 4PGHA 5IT9Z 4BAYA 1USSA 5J1RA 4EJTA 2CQKA 3I53A 3QYBA 3GFMA 4M74A 2DCEA 3DWLE 4ZJZA 4ZYHA 1ETVA 5IYDJ 1IF1A 1YW9A 3S1NJ 1JT6A 2EBIA 3ZQ7A 4XLAA 4X6AJ 1B59A 3BCBA 5A2QK 2DI3A 1YX3A 2CGPA 3OYDA 2ETHA 3KETA 4PSXA 1MBKA 3P5JA 3DEWA 3T0YA 3E6DA 3ZQIA 4DYCA 2RNGA 4JYKA 3OOPA 5E1ZB 3ASOH 3BQZA 1Z9CA 3FXOA 4L9VA 1RRJA 1MIJA 4AIHA 4K2EA 2IT0A 1R49A 2CFXA 3I0TA 3NAUA 4ZYGA 1WKMA 3NRVA 3OYKA 2H6CA 3SZPA 4BDYA 5FKLA 4CHUA 4PJLA 3ZMZA 2FU4A 2K86A 4EM0B 3TKYA 3WTSC 5F64A 1HW1A 3R4KA 2H09A 2HXIA 2LREA 3KEYA 1YFHA 4IHYA 3QOEA 2I10A 3V4GA 4ABZA 3CCSI 2GLOA 1I5ZA 1IDZA 2ELJA 4A3JJ 1D5VA 3RYPA 2R7XA 3K4CA 3IH2A 4QWQA 3GWZA 2EA2A 3H3VK 4LK0F 4P1WA 5M3FJ 1LVAA 1VQ8I 3F8CA 2HVQA 3AG1H 1EJ9A 3HTSB 1ZELA 2L9RA 2HOSA 1PYVA 1USTA 2L9VA 1W5TA 1T2KA 3L2WA 2IGMA 1ZR2A 4QIWN 1QZEA 2KJBA 4PJ0C 2BY2A 2NS7A 2DJIA 3WTWC 4E7KA 4BE0A 2GAUA 2K9MA 1H89C 1MJBA 1JKRC 2ELKA 3BTLA 1JTXA 1S5LC 1Z67A 3HRTA 2WADA 2X6XA 2XGXA 4FQGA 3DKXA 4NQWB 2H6BA 5FD6A 2CUFA 3OYHA 2BBYA 3CC4I 2KQRA 3KZYA 2LFBA 4I09A 3L7WA 4XLPF 3KP6A 1SFXA 5DCFA 1BOBA 1T33A 2GXGA 1UB9A 1E0EA 2EJRA 3HOUJ 4C30A 2QBYA 2O0YA 1LNWA 2X85A 5BOXA 1FP2A 2ECCA 5HS9A 1F5TA 4NQWA 4KIGA 4KN7X 4RLQA 4ESFA 4NC6A 3L2QA 3KZZA 2XF6A 1P2FA 5K7FA 2CU7A 1JKPC 1ZHFA 3S14J 3D1NI 1SMYF 4YELA 2A6EF 4ZH4F 1JI8A 4U88A 2I8DA 4N4NB 5EDNA 1YRNB 2LY1A 3A02A 3SQNA 3I56I 3K4MA 1T39A 3L2VA 3QOPA 4HOBA 5FKNA 1LDDA 4OAZA 3WE2A 1D0XA 3PFYA 3W6JB 2O03A 3K70D 4JBAA 2W85A 1WJAA 4HDVA 3IC7A 3GMEA 2ZJ2A 1X3ZB 2VPRA 4FT8A 2HZTA 3GLXA 1XSDA 4HG2A 1WHUA 4R8HA 3OL3A 4DZPA 3SEZA 3AL0C 4L18B 2JA2A 1R5GA 1Y6IA 1ETXA 1X58A 2YX4A 2W82A 1IN6A 2HDCA 4DQ2A 3CP2A 1GV2A 1KYWA 2XHKA 1ENHA 4DOZA 5KK1A 2UUZA 4EGYA 4LOCA 1IRFA 1GV5A 1WGXA 2PJPA 3LL7A 2LOOA 2QGUA 2V9KA 4D7MA 3A01B 2VXZA 5F0HA 5LHIA 1OQYA 3CMAI 2DA6A 2DOAA 4PFPA 3PNYA 3I54A 1MMAA 2BEOA 3M07A 1I3QJ 2F5CA 3N97A 1B4AA 4LG0A 3CCYA 3T8RA 4L9TA 2Q2EA 3G73A 2R7FA 3K2ZA 1P7JA 1JE8A 5GAGJ 4QSHA 5B5EC 1OYIA 1TWAJ 4ZZLA 1J75A 2BY3A 5CVIA 5ILUA 1X19A 4E7LA 3D0SA 5JR3A 1AA7A 1S29A 2X6YA 5IP6A 2FJ1A 1KQ0A 5DUIA 1MD0A 4IXAA 4KIFA 1KU2A 4PCQA 3VOEA 3W2VA 4A3MJ 3MD2A 2JN6A 2QYOA 4OWRB 3B6AA 1B6AA 2DO7A 4Y33A 5K5RA 1BW5A 5ILSA 5F6FA 3F6OA 3RYRA 3K0LA 1UFMA 2EFQA 1N77A 2W57A 1POGA 1HKTA 2KISA 4XOTA 2VONA 1PP8F 2XB5A 5FRNA 1MJ9A 3GLLA 5J1UA 4IQ4A 2MH9A 3LA3A 1SD5A 2JRMA 2FXAA 2LC2A 2DQRA 1X1BA 3HPHA 4RS8A 4A0ZA 4HLXA 5F08A 4DJAA 3OYAA 2EH3A 3BG9A 2KT0A 4C3HJ 2QZ8A 4A3FJ 1DUXC 2VL8A 2EIMH 2K9SA 4GXOA 4XLCA 2EZKA 4P55A 1NG7A 2E2IJ 2HNHA 1XSVA 1FJLA 2E60A 3M7GA 2HKOA 1ZGJA 3LSHA 6PAXA 4PJMA 1JKOC 3HB9A 2DA5A 1T08B 3RKXA 1UHWA 5FKKA 4B8XA 3HSFA 3BG7A 4EJOA 2K9NA 1W36C 5BS6A 1TBXA 2PFBA 3ZQQA 3MCZA 1OCTC 3ZQCA 1H9TA 1KU9A 1B72B 3E7LA 2EQRA 3GX4X 4G7HF 3NWSA 3LSTA 2O8XA 3MKYB 2X6WA 2QKLB 5FFZA 2OCEA 1OR7C 1K79A 1LE8A 3JRBA 1N25A 3S1MJ 3H5RA 1VI0A 3E97A 1Y0UA 3HGGA 1RR7A 1TQPA 3DTEA 3F8NA 2Z3YA 4II2A 1DP7P 3L9FA 5AIQA 2K02A 4MNUA 1H9GA 2X9DA 2OAZA 2JPBA 3TW6A 3CCLI 2DLLA 2OF7A 1YIJI 1UCRA 3T8TA 4ASNA 5M5XJ 3WG9A 1GDTA 2VJIA 3BG6A 5F27A 2P5VA 2IS2A 4YFXF 4MHGA 2R5ZA 2CQQA 2OPTA 3VYTB 3OWTA 2VLAA 5DEQA 3HUGB 3PM1A 1OJLA 3MWMA 1BM9A 1BR2A 2B0LA 3DCFA 4QPOA 1IN7A 2XAFA 3PSFA 1EH7A 1VQ9I 2ZXHA 1KQ9A 2PQ8A 2A5YB 1PUFB 1BN5A 3JR9A 5D5VB 3FK6A 5BPIA 1BI3A 4EJVA 1YTYA 4LLNA 4MTEA 2KFDA 1X3UA 2PMZN 2E1MB 2HVRA 2Z1DA 2W1OA 3O3KA 2IPQX 1UELB 1WCMJ 2HFHA 2BW3A 4IOAF 2BYVE 2DMQA 3JTGA 4B43A 2WY8Q 3GZNB 1YIOA 4IHTA 2ZJPF 3FISA 1IDYA 4MIMA 4NBQA 1GVDA 1FC3A 1KA8A 2Z5UA 3S32A 2VIXA 3JTHA 2VBWA 4AWXB 5IP7J 1IAWA 4NUBA 2DA1A 1LB2A 2R4GA 3F8MA 3TO6A 3BTCA 1ZR4A 2NVYJ 3H36A 2AS5F 1HLVA 3O2PE 2VPLA 1T0FA 2E71A 1FWZA 1QZZA 2WAEA 2X48A 2M2EA 3GW2A 3KFWX 3H5AA 1UG2A 2DAOA 2VJJA 4XORA 1YG2A 3JCUC 2NYXA 4QPQA 4CICA 4FE4A 2R7DA 2KDZA 3V42A 3IH4A 4B1RA 2IRFG 4H0EA 2BOLA 2CJJA 1Z7UA 4RDUA 1SFOJ 4NC7A 1JT0A 2H8RA 3DKWA 4JP0A 1GXPA 5ICGA 2MH2A 3QODA 2CV1A 2PJRB 3L1PA 3FF5A 4OAYA 2VN2A 2DMPA 3JAMK 2WB1A 4L9NA 1WQ2A 4L5EA 2E2HJ 4V2FA 4ZYEA 4AD9A 5K1YA 2DW4A 1VQLI 4CSWA 3K1MA 1D0ZA 1B8IA 2XAGA 3KP2A 4UHTA 2XGCA 3BC8A 1ZRFA 3HTUA 3M1CA 3S1QJ 4PGGA 1Y39A 4LG3A 4CZZA 4HV6A 2X1DA 2R7RA 1HKQA 1W0TA 1TQMA 3J7AY 3EQLF 4FISA 2L2OA 3GTKJ 2DYRH 1WJ5A 3I9V2 2OTLI 1I1SA 3WGIA 3TW7A 4LGWA 3I59A 5EEAA 4D0PA 4ZZDA 2HDWA 2Z99A 3M8FA 2FOKA 2M5WA 2M0CA 3BCAA 3SYTA 1X1PA 1FSEA 3RZDJ 1IUYA 1ZLJA 3DF8A 1GXQA 4B44A 2HPIA 3VB2A 3GFIA 2DA2A 4UV9A 3QPTA 1U5TC 4L0YB 3I59B 4NHJA 1FEXA 3C18A 1OCRH 2L3DA 3ECOA 1R36A 1ZQ3P 2IAIA 2XB0X 1YW8A 3DBLB 4PUSA 4KUMA 3LSMA 4RBOA 2MFZA 3AG4H 4M73A 1U5TB 5E79C 3TBIA 4CUGA 3S2DJ 2GA2A 4XRSA 4Y3OA 1R00A 1J0RA 1RUOA 3NEUA 2XAHA 2UV1A 4LB6B 4XKVA 1HW2A 3BPXA 3J7AO 2P6TA 2R7QA 3A0BC 4GRIA 5HDGA 3SZGA 2LBFA 2QA4I 1XC5A 1BBYA 1EF4A 1BJAA 2K3FA 1W7PA 4ZDLA 2FD5A 1YRNA 1T56A 1W7PB 2XUBA 5KHDA 2GXAA 4RA2A 4UVCA 3M9AA 5GPCA 3K7AJ 2R7ZJ 2QWWA 3ELKA 4TV7A 2JVHA 4X1EA 4U7BA 3S3OA 2V79A 2Z16A 4YRVA 1DDNA 1MBEA 2ZJQF 3ABMH 2EK5A 4FHTA 1OKRA 1BI2A 2HPMA 4BXXJ 4M3GA 4FE7A 1E3OC 4LK1F 1D8JA 4A93J 1PP7U 5BQTA 3GBGA 3HOYJ 1AU7A 2E7WA 3KEOA 3QQAA 3LSJA 2L4AA 5J3LA 5JI6A 2NNNA 1UZCA 4IJAA 1IC8A 1AKHA 4D5CA 4W97A 1D1BA 5HODA 4G9YA 2XC7A 3UKGA 1R7JA 1TLHB 5M3MJ 4RAYA 1F1ZA 2PJRA 3E6BA 3BQYA 3W2AA 1U9OA 3V7SA 2VKHA 5J47A 4ENJA 1PUEE 2X1EA 1XMKA 3K4JA 3CMYA 1ETWA 4LG0B 1ULYA 1MBGA 4G8XA 1LEAA 1H8AC 5GAHJ 4BBSJ 3RPUD 1QHGA 3P9KA 2AQFA 2VI6A 2V1NA 3KLNA 3LAPA 4CCJA 2HOTA 3GUDA 1C0WA 3ML6A 1HCRA 1LPQA 3JRFA 5HNHA 1W1WE 2KJCA 3HSEA 3KYCB 4BJ6C 4IKFA 1SFEA 2RGVA 1OCCH 4DYRA 3TQNA 3H0GJ 1Z6TA 4BQAA 1T8IA 2HKXA 1X2NA 2IS1A 3BR1A 1R1TA 2EPFA 2JWTA 2W00A 4F93B 1QZYA 2R5ZB 2DOEA 4MFEA 2P81A 1G3YA 4M3DA 5FFXA 4XM3A 1LJ9A 4YEJA 1A36A 2JTVA 4RLFA 2N8GA 2Y9ZA 1FOKA 5L3EA 2PLYA 1HKSA 5GAEJ 2KIQA 3HKZA 1MZBA 2VXDA 1ON1A 2F2EA 2CYYA 2DTRA 2ZO4A 1APLC 2IGNA 2LLKA 4D7NA 3TO9A 3CCJI 1IRXA 4EGZA 3OYGA 2M45A 4W1UA 5CQGA 1I3AA 2BW3B 4ENNA 2KIFA 3MFKA 1VZ0A 4A3LJ 3BJ6A 4GYIA 1FY7A 1FBSA 4HRIA 1QVTA 4A2UA 1YLFA 3EYIA 1JXSA 2DFFA 5EEHA 5JLWA 3M1EA 4UUSB 1YOVB 2OZUA 3ULQB 1RETA 2W24A 1GUUA 2DFHA 4RAFA 1YYVA 2DQLA 4N9IA 1X4PA 3WHCA 1ZGAA 3OIQA 5DD4A 5L3DA 4Y13A 5GPAA 5D4SA 2A05A 2OTJI 3IV5A 4BBRJ 2MC4A 3BLYA 3CJTB 5FROA 5FLXZ 2COBA 3RKWA 1DU0A 3BR0A 1CQTA 2VKDA 2V26A 3N05A 5E3NA 3CCUI 4BE1A 2K27A 9ANTA 2R5YB 1VQKI 3LAJA 1OLTA 2JUGA 1N78A 1OFCX 3WODF 2YS9A 1OCOH 3W3CA 1ZLKA 1G8XA 3F9KA 3QPLA 1QNTA 1LEBA 3SJMA 3FM5A 3IRRA 1R71A 1SD6A 2FBHA 3G1MA 3S3MA 1LDKB 2LNBA 3BR5A 3EETA 4HA8A 4RM3A 4A3EJ 2ESHA 3L2RA 5IY5H 2XIGA 1XN7A 2R7SA 3E0JB 2EIJH 2M9HA 3GO5A 3ABUA 1W36D 2K3PA 3ZR8X 2WY7Q 2CUEA 2P8TA 3K4LA 4WXHA 2FF4A 2E7XA 3G6EI 1FMWA 1JHFA 3EDPA 2OQRA 2R92J 4CA0A 2Y9YA 4MEYF 3HOTA 2IXSA 3PFIA 3JW4A 2HQAA 3IHUA 2DA4A 2M8EA 3E5QA 1JJ8C 3WTYC 2LKXA 1HA8A 1Z21A 3BOQA 1G4DA 3FX3A 3DPTA 4LFUA 1G3WA 3KE2A 3U2RA 4L5IA 5LEJA 2XVCA 1XSXA 1UHSA 2MW8A 2M0MA 2DU9A 2D1VA 3FXRA 2UXXA 3F0CA 2CQNA 1JGSA 1XGOA 5E3OA 3KEQA 3LQQA 1NH3A 4HNVA 2XGEA 4D1QA 1OPCA 4KDPA 2LDUA 4HX7A 4PJJA 3QAHA 2H1KA 2BHZA 2ZJRF 2HVSA 3H9GA 4MFDA 2IP2A 4XL9A 1O7LA 1ETOA 1T95A 3J7YJ 2KRCA 4GCVA 2Q1ZB 4M3EA 4DGWB 2F5VA 3WU2C 4HX4A 2MG4A 3ZQHA 4HV5A 1P4WA 5L3BA 4WWCA 3ZMUA 5LRSA 1Q1HA 3HZJA 3HDDA 2L7KA 4XQFA 4CCKA 2ISYA 4S04A 2F4OB 4XKCA 2NS0A 2OQGA 3H5NA 3GFLA 2KL4A 1U9NA 4MGRA 3DPLC 5D8KB 2KMUA 3TEDA 1YJNI 2DBBA 4KICA 5E1WA 4D5FA 1KU3A 1SD7A 1P92A 2Y75A 2JA6J 2STWA 1TW2A 2A6TA 1O57A 4I0BA 3HG9A 4IOCF 2EILH 3EUHA 1I50J 2ADUA 3IAM2 3VPRA 1J7KA 5DS9A 1BJZA 4M71A 2L54A 1FP1D 4XLEA 2B9SA 4GDFA 3VYRB 4S0HB 1D3YA 2O3FA 3ECHA 5FLXK 1G2HA 2UZKA 1BR1A 1CF7A 4LMYA 3TOBA 5LD2C 3CJRB 3E6MA 2FEZA 2E36A 2CMPA 2HOEA 4H4KC 4C9YA 2M7AA 3FHNA 1SEUA 5TRDA 1KU7A 4Q48A 1PUFA 2JSCA 4BEHA 4XSZF 3S2WA 1MW7A 5JFRA 2VKEA 2BVLA 1IV8A 3R0AA 2G0EA 5CLSA 4RAGA 4G6QA 2FSWA 1XGMA 2P7CB 4CYCB 2B7EA 3BP8A 4FASD 4FX4A 4A5NA 2IA0A 3DTIA 2ZB9A 3QPHA 5E18F 5CQEA 2L7ZA 3DLAA 3JRCA 2W25A 2MYSA 4P96A 3LSRA 2LF7A 1P4AA 3FBNB 2BXYA 2XSDC 1BC8C 3VSLA 4M9ZA 5F0CA 4RB3C 5D6EA 2IEKA 4LLLA 2VBYA 4ENMA 2NVUB 4A69C 3AFHA 1I27A 1RI7A 3CUQB 3DFGA 5EGOA 4IHXA 2MABA 2QF7A 1ZRCA 5EGOB 3I4PA 2E5NA 3JRHA 3ZGKA 2XPVA 4A6EA 2VJ5A 4U0WA 2L01A 4Y4RA 1ZG3A 1XMAA 1PVEA 3Q0VA 3CO6C 4F52A 4BHPA 1S7OA 4IQJA 3NARA 5J8FA 3G2BA 3IKVA 3VDXA 4A5MA 4CCNA 2P5KA 1SD4A 1FX7A 3BTJA 3C7JA 4LLGF 1TWGJ 2DA3A 3BG5A 4Y17A 3MZHA 1U8BA 4YIRX 5D4RA 3IAS2 4C2TA 3FDYA 3FXQA 3ZXSA 1MBFA 1VNDA 5CVUA 1YO5C 3TP0A 1K61A 1QU3A 5E8GA 5LEKA 2O8KA 4V19K 1IXCA 3KIOA 3ABLH 4AIKA 1YW7A 2GXBA 2WAFA 3M4OJ 1W5SA 3BT9A 2JUCA 3CJQB 4BY1J 2R3SA 4Q47A 5K5OA 3Q9SA 2J5PA 2QBYB 1NG6A 3O8GA 5E3MA 1B1BA 2OU2A 4RMNA 3IL2A 3LOCA 2CWEA 4I01A 1TNSA 3U21A 3I71A 2EV5A 1O3TA 2L7FP 4LD5A 2BZTA 4HDUA 2DK8A 1VF9A 2V7FA 2QSGX 4A0XA 4EEFG 2R7TA 4OIPF 5F1JA 4A3KJ 4BH9A 2LG4A 2CW7A 4YFNF 5HLHA 3V8JA 1WH5A 4F55A 3KP7A 2RN7A 5ILVA 3RDIA 2XF7A 2EFWA 2XROA 4RGXA 3UR3C 4I2OA 2YPRA 3DXJF 5LGUA 3M8EA 2V9VA 1BW6A 4BJ5C 2VKVA 1VQ7I 2OC6A 4UY8I 2B63J 2EV0A 1YX5A 5B1BH 3NWTA 3L2UA 4OOIA 2HZDA 3RSNA 2P0WA 2FA5A 5HDKA 1MNEA 4G7ZF 3DPUA 5E20A 1A35A 4BKXA 1FBUA 1WJBA 3H35A 2Y69H 2P6SA 4F3QA 1RZ4A 2M87A 1IN4A 4OIOF 1STZA 3MZYA 2F5DA 1BOAA 5KAIC 3SHFA 3CJNA 1EKEA 2IBDA 3LSPA 2LBFB 2DN0A 3IKTA 3CLQA 1PJRA 4P9UA 5H2FC 4I6ZA 1X2MA 4J19A 1S8NA 3C3WA 3KYLA 3CCEI 4CGZA 3LFUA 3A0HC 3EPZA 5HS8A 2O61A 2HOAA 1S6LA 3LA2A 4AYBA 5GTHC 1Y0NA 2HXOA 4V2GA 1A6IA 2CRGA 1HDDC 3QU3A 3J81Z 1D1CA 3S8PA 4DBRA 4I76A 1XCVA 2ZMEC 1ORKA 2D2WA 3GXOA 2FOWA 5B3SH 2DT6A 3J80K 3U1KA 4KIBA 2XGDA 1VQPI 3HM5A 2AHQA 4CZCA 2COMA 4A3GJ 3HRUA 4PSWA 2JQ7A 2KLOA 3ROUA 2HQRA 1MH4A 1GLNA 1Z6RA 2DFIA 2RKHA 2VQGA 4EM1A 2VOOA 2ZMEB 4HF0A 1JJ6C 5IYCJ 5HNFA 1WJCA 3C2BA 5E1XA 4E7IA 1MMGA 3ERMA 5C3EJ 4A0YA 3CQZJ 5D6FA 4F91B 5CPRB 2CG4A 1X1DA 4I7HA 3GF2A 2A3SA 1UAAA 3BZCA 3K2AA 3FMQA 1OCPA 1JGGA 1RIOH 1O7FA 5TISC 1VQMI 4OMZA 5F04A 3OMYA 2EFPA 4YFKF 3WGGA 1RR8C 4C2MJ 3K6GA 2HTJA 1JTYA 2OV7A 1Z3YA 5ICCA 1SANA 5LBQA 3R0JA 5DUKA 1XPXA 3GVAA 3EYYA 1HQCA 2DDBA 2PI0A 2D5VA 2KP6A 1U6GA 2LD5A 3H9JA 2CH0A 3OYIA 4G12A 4B09A 3OOUA 1RESA 5HS7A 2PMUA 2ZSHB 4N9HA 1AWCA 2DXIA 3VWBA 2E1CA 3LA7A 2JRTA 1MNMC 3SFIA 2JPCA 3F22A 3MAJA 3X2QH 3SXYA 5K7HA 1RUNA 1NTCA 2CV2A 4IX7A 1SVMA 5LRRA 2YU3A 1SVOA 2EV6A 2O6GE 4M9XA 5TGTA 3CDLA 5TJJA 2PG4A 1QA6A 3ASNH 2QENA 3FBIB 1LVKA 3BROA 4AVZA 3ZMVA 1P7IA 4HF1A 1T0FC 2L5QA 3FWEA 2VC1A 1Y1WJ 3W6KB 3F72A 3LSGA 1HBXG 1O3SA 4A3CJ 2Q2EB 1U5TA 4IRHA 1V54H 4OIRF 2ZBKA 5HLTA 2IGOA 2LTPA 1W7PD 2MA3A 3TOAA 2XASA 2BGCA 3L09A 1V5GA 2F48A 3DQVC 3KP4A 2RC4A 2M4GA 2CFOA 1S7EA 4HW0A 5E8IA 2DJNA 4RM2A 4BDZA 5LHHA 1TC3C 1HOMA 3OR2C 2WV1A 3T5XA 1R1VA 3OS1A 5HLGA 2Y2ZA 3BJAA 4HLYA 4A12A 3H3ZA 4FTHA 3GTOJ 4Q4ZF 2DMNA 3ZQGA 5KAFC 3F8FA 4IHWA 1WJDA 3B73A 1W0UA 2EZHA 4IO9F
chains in the Genus database with same CATH topology
2ECCA 3HEFA 5JLWA 4A3IJ 1FIAA 2LVSA 4UUSB 1FTZA 1RETA 2EZIA 1GUUA 2O7OA 5K7FA 1JKPC 3S14J 2CU7A 1BA5A 3WHCA 3D1NI 1MSFC 5GPAA 1AHDP 2ME0A 2XPUA 2DA7A 4B4CA 4BBRJ 3IV5A 4JX6A 1QPIA 4DYQA 5EDNA 1YRNB 1Z0XA 1VFCA 3A02A 2COBA 1DU0A 3BR0A 1CQTA 5FKNA 3GTGJ 2LR8A 4BY7J 5E3NA 2TCTA 1K83J 1RKWA 5C44J 9ANTA 2R5YB 3JREA 1MSEC 3BR3A 2VPRA 2O9LA 1OFCX 5EZHA 1TWFJ 2HI3A 2YS9A 2NS8A 4DZPA 1Z77A 1H88C 1RPWA 1Y1VJ 3QPLA 4JX4A 1LFBA 1LE8B 3SJMA 1ETXA 1X58A 3W6VA 3G1MA 1GV2A 1ENHA 3BR5A 3OSGA 4NDLA 4A3EJ 3HBLA 3HOWJ 4LOCA 1GV5A 1WGXA 1ZGWA 2JA8J 2M9HA 4D7MA 3A01B 5F0HA 1TWHJ 2R0QC 4XIDA 5FKMA 2DA6A 1UMQA 2CUEA 1I3QJ 4QTRA 2MSYA 3CCYA 2R92J 3HOZJ 2LP0A 2Y9YA 1P7JA 2NVXJ 4QSHA 3G1OA 1TWAJ 4M6VA 2DA4A 1JJ8C 2MGQA 5IP6A 2LKXA 2L0KA 2FJ1A 4A3MJ 2JN6A 3S16J 3B6AA 4UUSA 1UHSA 2MW8A 1ITYA 1BW5A 5M5WJ 3MVPA 2DMTA 3F0CA 4AUXA 5E3OA 4HNVA 1POGA 2XGEA 2VUMJ 2XB5A 2H1KA 2X6OA 5J1UA 4MFDA 1ETOA 1IUFA 1ETYA 5F08A 2EH3A 3BG9A 2KT0A 4M3EA 4C3HJ 4A3FJ 1JKQC 2YUSA 3ZQHA 3JRAA 2MG4A 5IPAA 2E2JJ 2K9SA 2E2IJ 2EZKA 2XPWA 3HDDA 3S1RJ 3BTIA 2JMWA 2NOGA 1FJLA 1XS9A 2L7MP 2FQ4A 1JKOC 3HB9A 4FCYA 5EF6A 2DA5A 5FKKA 1U9NA 1A5JA 1F43A 3TEDA 1QVUA 3GTMJ 2ID3A 2LK2A 2K9NA 4D5FA 3HOXJ 3JRIA 2K40A 1OCTC 1B72A 2JA6J 1Q1VA 3ZQCA 1B72B 1MBJA 3JRDA 3E7LA 2EQRA 3PO3J 3A01A 3M3YJ 1ZKGA 1I50J 3B6CA 3VPRA 3FKIJ 1IG7A 4M3FA 5DS9A 2HYJA 1BJZA 1LE8A 5F0FA 5DTDA 3JRBA 1R9TJ 2RAEA 1ZTRA 3IH3A 4S0HB 1MH3A 1JUSA 1VI0A 3HGGA 2R93J 3S1MJ 1F36A 4B3AA 1RR7A 1G2HA 3MKLA 4GFBA 1BL0A 4CYCA 2X9DA 3FIWA 3TW6A 2TRTA 2OF7A 4A3DJ 5EG0B 1IJWC 5M5XJ 1PUFA 1GDTA 5F27A 2M34A 2R5ZA 2VKEA 2CQQA 2OPTA 2WAQN 1HDPA 2E1OA 2G0EA 2ECBA 3PM1A 1OJLA 5JLXA 5IOYA 5FJ8J 2Y31A 3DCFA 3Q3SA 5IOZA 4CYCB 3Q0UA 2ZB9A 3OSFA 5EG0A 2L7ZA 1HF0A 3JRCA 1PUFB 3SDGA 3JR9A 3FK6A 3LNQA 3LSRA 1GT0C 2XSDC 3O8HA 2PMZN 5F0CA 2IEKA 3S15J 1ETQA 1D5YA 4A69C 2NVQJ 1WCMJ 3GTQJ 3RZOJ 2ME6A 3HKZN 2DMQA 5EGOA 4IHXA 2QF7A 5EGOB 5FKOA 3JRHA 2XPVA 3FISA 5EZGA 1IDYA 4MIMA 4DW6A 1GVDA 5M5YJ 3Q0VA 3NARA 3GTLJ 1LFUP 3BR6A 3RQIA 4MLOA 5IP7J 2DA1A 2W48A 3BTJA 1TWGJ 2DA3A 3BG5A 3BTCA 1ZR4A 2NVYJ 1U8BA 4XICA 3HGYA 3JRGA 1HLVA 2DTZA 1MBFA 1VNDA 1K61A 3TP0A 2X48A 2M2EA 4A3BJ 3TP3A 1UG2A 2O8KA 3QPSA 4FE4A 1QRYA 2KDZA 3ZQLA 3IH4A 4B1RA 3M4OJ 1XG1A 3BT9A 2JA7J 1WH7A 2CJJA 2M8GX 4JX5A 4M3BA 2WB1N 4BY1J 4C3JJ 3G1LA 4RDUA 1SFOJ 5EYRA 1JT0A 2H8RA 4JP0A 3FK7A 3HOVJ 1IGNA 3O8GA 5E3MA 5BNGA 3LOCA 1RKTA 3L1PA 2HQ5A 2R5YA 1DU6A 2DMPA 4Y52J 4IEJA 1AKHB 3S2HJ 2L7FP 4L5EA 2E2HJ 4V2FA 3GTPJ 1VF9A 1IV6A 4XRMA 4EEFG 5C4XJ 5F1JA 4C3IJ 1B8IA 2XGCA 4A3KJ 3S1QJ 4DZJA 1WH5A 3PO2J 3WHBA 1W0TA 2NVTJ 4FISA 3A03A 1O4XA 3GTKJ 1BW6A 2VKVA 3ZOBA 2B63J 3TW7A 5C4JJ 5EEAA 1JUMA 4MO7A 1NK3P 4IHVA 2FX0A 2M0CA 4XRSG 3I4MJ 4BKXA 3RZDJ 3MN2A 1WI3A 4Y7NJ 4XK4A 2DA2A 2XRLA 5J1YA 2IBDA 3LSPA 1U78A 2DN0A 1FEXA 1ZQ3P 2IAIA 4I6ZA 1X2MA 2XB0X 3ZQFA 4J19A 2QCOA 4RBOA 3S2DJ 5FLVA 1ETKA 2HOAA 4XRSA 3OIOA 2HXOA 3GTJJ 4V2GA 1A6IA 2CRGA 1HDDC 1XC5A 4I76A 1I6HJ 1EF4A 1ORKA 2DMUA 2Y30A 2FD5A 1YRNA 1T56A 3S17J 5E3LA 5IYBJ 2XGDA 5GPCA 3K7AJ 3HM5A 2AHQA 2R7ZJ 1MBHA 5K7ZA 4A3GJ 1MH4A 4X1EA 1MBEA 2GM4A 1JJ6C 5IYCJ 4BXXJ 3C2BA 2EZLA 4FE7A 4M3GA 1E3OC 5C3EJ 4A93J 2Y0SN 3CQZJ 3GBGA 3HOYJ 1AU7A 3BR2A 1B8IB 3QQAA 3LSJA 3K2AA 5J3LA 5J1RA 1OCPA 1JGGA 5F04A 5IP9J 1IC8A 1ETVA 5IYDJ 2JK3A 1JT6A 1AKHA 3S1NJ 4D5CA 2EBIA 4C2MJ 4W97A 5HODA 1JTYA 1TWCJ 1SANA 3UKGA 4X6AJ 4AC0A 5M3MJ 2GBYA 1MBKA 3DEWA 3BQYA 1U9OA 3ZQIA 4JYKA 4DYCA 2D5VA 3BG3A 2LD5A 3BQZA 3CMYA 1ZK8A 4G12A 1ETWA 3OOUA 1RESA 1MBGA 1H8AC 3NAUA 1NK2P 2ID6A 4BBSJ 5FKLA 1MNMC 2VI6A 3SFIA 2AO9A 2HOTA 3I4NJ 2HXIA 4IHYA 2I10A 1IDZA 4ABZA 5K7HA 2GLOA 2E19A 1HCRA 4A3JJ 1NTCA 3JRFA 5GP9A 2JA5J 3IH2A 3H3VK 3CDLA 4DYRA 5M3FJ 3H0GJ 1FTTA 1P7IA 1FIPA 1X2NA 2L9RA 3BR1A 1JUPA 1WPKA 2HOSA 2YU9J 2JWTA 1Y1WJ 2CQXA 3LSGA 2R5ZB 4A3CJ 4MFEA 1ZR2A 4QIWN 2NS7A 2P81A 4M3DA 2K9QA 5FLMJ 1IRZA 2LTPA 1H89C 1JKRC 2ELKA 3BTLA 2N8GA 1JTXA 2Y9ZA 3Q0WA 2LY9A 1S7EA 4UUTA 2DJNA 4AYBN 1APLC 3RKQA 2LLKA 2CUFA 2LFBA 4D7NA 1TC3C 1HOMA 2WV1A 4W1UA 1T33A 2Y2ZA 4FTHA 2HDDA 3GTOJ 2DMNA 3HOUJ 3ZQGA 4A3LJ 4IHWA 1W0UA 2EZHA 2JJ7A 1QVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECC A;  3HEF A;  5JLW A;  4A3I J;  1FIA A;  2LVS A;  4UUS B;  1FTZ A;  1RET A;  2EZI A;  1GUU A;  2O7O A;  5K7F A;  1JKP C;  3S14 J;  2CU7 A;  1BA5 A;  3WHC A;  3D1N I;  1MSF C;  5GPA A;  1AHD P;  2ME0 A;  2XPU A;  2DA7 A;  4B4C A;  4BBR J;  3IV5 A;  4JX6 A;  1QPI A;  4DYQ A;  5EDN A;  1YRN B;  1Z0X A;  1VFC A;  3A02 A;  2COB A;  1DU0 A;  3BR0 A;  1CQT A;  5FKN A;  3GTG J;  2LR8 A;  4BY7 J;  5E3N A;  2TCT A;  1K83 J;  1RKW A;  5C44 J;  9ANT A;  2R5Y B;  3JRE A;  1MSE C;  3BR3 A;  2VPR A;  2O9L A;  1OFC X;  5EZH A;  1TWF J;  2HI3 A;  2YS9 A;  2NS8 A;  4DZP A;  1Z77 A;  1H88 C;  1RPW A;  1Y1V J;  3QPL A;  4JX4 A;  1LFB A;  1LE8 B;  3SJM A;  1ETX A;  1X58 A;  3W6V A;  3G1M A;  1GV2 A;  1ENH A;  3BR5 A;  3OSG A;  4NDL A;  4A3E J;  3HBL A;  3HOW J;  4LOC A;  1GV5 A;  1WGX A;  1ZGW A;  2JA8 J;  2M9H A;  4D7M A;  3A01 B;  5F0H A;  1TWH J;  2R0Q C;  4XID A;  5FKM A;  2DA6 A;  1UMQ A;  2CUE A;  1I3Q J;  4QTR A;  2MSY A;  3CCY A;  2R92 J;  3HOZ J;  2LP0 A;  2Y9Y A;  1P7J A;  2NVX J;  4QSH A;  3G1O A;  1TWA J;  4M6V A;  2DA4 A;  1JJ8 C;  2MGQ A;  5IP6 A;  2LKX A;  2L0K A;  2FJ1 A;  4A3M J;  2JN6 A;  3S16 J;  3B6A A;  4UUS A;  1UHS A;  2MW8 A;  1ITY A;  1BW5 A;  5M5W J;  3MVP A;  2DMT A;  3F0C A;  4AUX A;  5E3O A;  4HNV A;  1POG A;  2XGE A;  2VUM J;  2XB5 A;  2H1K A;  2X6O A;  5J1U A;  4MFD A;  1ETO A;  1IUF A;  1ETY A;  5F08 A;  2EH3 A;  3BG9 A;  2KT0 A;  4M3E A;  4C3H J;  4A3F J;  1JKQ C;  2YUS A;  3ZQH A;  3JRA A;  2MG4 A;  5IPA A;  2E2J J;  2K9S A;  2E2I J;  2EZK A;  2XPW A;  3HDD A;  3S1R J;  3BTI A;  2JMW A;  2NOG A;  1FJL A;  1XS9 A;  2L7M P;  2FQ4 A;  1JKO C;  3HB9 A;  4FCY A;  5EF6 A;  2DA5 A;  5FKK A;  1U9N A;  1A5J A;  1F43 A;  3TED A;  1QVU A;  3GTM J;  2ID3 A;  2LK2 A;  2K9N A;  4D5F A;  3HOX J;  3JRI A;  2K40 A;  1OCT C;  1B72 A;  2JA6 J;  1Q1V A;  3ZQC A;  1B72 B;  1MBJ A;  3JRD A;  3E7L A;  2EQR A;  3PO3 J;  3A01 A;  3M3Y J;  1ZKG A;  1I50 J;  3B6C A;  3VPR A;  3FKI J;  1IG7 A;  4M3F A;  5DS9 A;  2HYJ A;  1BJZ A;  1LE8 A;  5F0F A;  5DTD A;  3JRB A;  1R9T J;  2RAE A;  1ZTR A;  3IH3 A;  4S0H B;  1MH3 A;  1JUS A;  1VI0 A;  3HGG A;  2R93 J;  3S1M J;  1F36 A;  4B3A A;  1RR7 A;  1G2H A;  3MKL A;  4GFB A;  1BL0 A;  4CYC A;  2X9D A;  3FIW A;  3TW6 A;  2TRT A;  2OF7 A;  4A3D J;  5EG0 B;  1IJW C;  5M5X J;  1PUF A;  1GDT A;  5F27 A;  2M34 A;  2R5Z A;  2VKE A;  2CQQ A;  2OPT A;  2WAQ N;  1HDP A;  2E1O A;  2G0E A;  2ECB A;  3PM1 A;  1OJL A;  5JLX A;  5IOY A;  5FJ8 J;  2Y31 A;  3DCF A;  3Q3S A;  5IOZ A;  4CYC B;  3Q0U A;  2ZB9 A;  3OSF A;  5EG0 A;  2L7Z A;  1HF0 A;  3JRC A;  1PUF B;  3SDG A;  3JR9 A;  3FK6 A;  3LNQ A;  3LSR A;  1GT0 C;  2XSD C;  3O8H A;  2PMZ N;  5F0C A;  2IEK A;  3S15 J;  1ETQ A;  1D5Y A;  4A69 C;  2NVQ J;  1WCM J;  3GTQ J;  3RZO J;  2ME6 A;  3HKZ N;  2DMQ A;  5EGO A;  4IHX A;  2QF7 A;  5EGO B;  5FKO A;  3JRH A;  2XPV A;  3FIS A;  5EZG A;  1IDY A;  4MIM A;  4DW6 A;  1GVD A;  5M5Y J;  3Q0V A;  3NAR A;  3GTL J;  1LFU P;  3BR6 A;  3RQI A;  4MLO A;  5IP7 J;  2DA1 A;  2W48 A;  3BTJ A;  1TWG J;  2DA3 A;  3BG5 A;  3BTC A;  1ZR4 A;  2NVY J;  1U8B A;  4XIC A;  3HGY A;  3JRG A;  1HLV A;  2DTZ A;  1MBF A;  1VND A;  1K61 A;  3TP0 A;  2X48 A;  2M2E A;  4A3B J;  3TP3 A;  1UG2 A;  2O8K A;  3QPS A;  4FE4 A;  1QRY A;  2KDZ A;  3ZQL A;  3IH4 A;  4B1R A;  3M4O J;  1XG1 A;  3BT9 A;  2JA7 J;  1WH7 A;  2CJJ A;  2M8G X;  4JX5 A;  4M3B A;  2WB1 N;  4BY1 J;  4C3J J;  3G1L A;  4RDU A;  1SFO J;  5EYR A;  1JT0 A;  2H8R A;  4JP0 A;  3FK7 A;  3HOV J;  1IGN A;  3O8G A;  5E3M A;  5BNG A;  3LOC A;  1RKT A;  3L1P A;  2HQ5 A;  2R5Y A;  1DU6 A;  2DMP A;  4Y52 J;  4IEJ A;  1AKH B;  3S2H J;  2L7F P;  4L5E A;  2E2H J;  4V2F A;  3GTP J;  1VF9 A;  1IV6 A;  4XRM A;  4EEF G;  5C4X J;  5F1J A;  4C3I J;  1B8I A;  2XGC A;  4A3K J;  3S1Q J;  4DZJ A;  1WH5 A;  3PO2 J;  3WHB A;  1W0T A;  2NVT J;  4FIS A;  3A03 A;  1O4X A;  3GTK J;  1BW6 A;  2VKV A;  3ZOB A;  2B63 J;  3TW7 A;  5C4J J;  5EEA A;  1JUM A;  4MO7 A;  1NK3 P;  4IHV A;  2FX0 A;  2M0C A;  4XRS G;  3I4M J;  4BKX A;  3RZD J;  3MN2 A;  1WI3 A;  4Y7N J;  4XK4 A;  2DA2 A;  2XRL A;  5J1Y A;  2IBD A;  3LSP A;  1U78 A;  2DN0 A;  1FEX A;  1ZQ3 P;  2IAI A;  4I6Z A;  1X2M A;  2XB0 X;  3ZQF A;  4J19 A;  2QCO A;  4RBO A;  3S2D J;  5FLV A;  1ETK A;  2HOA A;  4XRS A;  3OIO A;  2HXO A;  3GTJ J;  4V2G A;  1A6I A;  2CRG A;  1HDD C;  1XC5 A;  4I76 A;  1I6H J;  1EF4 A;  1ORK A;  2DMU A;  2Y30 A;  2FD5 A;  1YRN A;  1T56 A;  3S17 J;  5E3L A;  5IYB J;  2XGD A;  5GPC A;  3K7A J;  3HM5 A;  2AHQ A;  2R7Z J;  1MBH A;  5K7Z A;  4A3G J;  1MH4 A;  4X1E A;  1MBE A;  2GM4 A;  1JJ6 C;  5IYC J;  4BXX J;  3C2B A;  2EZL A;  4FE7 A;  4M3G A;  1E3O C;  5C3E J;  4A93 J;  2Y0S N;  3CQZ J;  3GBG A;  3HOY J;  1AU7 A;  3BR2 A;  1B8I B;  3QQA A;  3LSJ A;  3K2A A;  5J3L A;  5J1R A;  1OCP A;  1JGG A;  5F04 A;  5IP9 J;  1IC8 A;  1ETV A;  5IYD J;  2JK3 A;  1JT6 A;  1AKH A;  3S1N J;  4D5C A;  2EBI A;  4C2M J;  4W97 A;  5HOD A;  1JTY A;  1TWC J;  1SAN A;  3UKG A;  4X6A J;  4AC0 A;  5M3M J;  2GBY A;  1MBK A;  3DEW A;  3BQY A;  1U9O A;  3ZQI A;  4JYK A;  4DYC A;  2D5V A;  3BG3 A;  2LD5 A;  3BQZ A;  3CMY A;  1ZK8 A;  4G12 A;  1ETW A;  3OOU A;  1RES A;  1MBG A;  1H8A C;  3NAU A;  1NK2 P;  2ID6 A;  4BBS J;  5FKL A;  1MNM C;  2VI6 A;  3SFI A;  2AO9 A;  2HOT A;  3I4N J;  2HXI A;  4IHY A;  2I10 A;  1IDZ A;  4ABZ A;  5K7H A;  2GLO A;  2E19 A;  1HCR A;  4A3J J;  1NTC A;  3JRF A;  5GP9 A;  2JA5 J;  3IH2 A;  3H3V K;  3CDL A;  4DYR A;  5M3F J;  3H0G J;  1FTT A;  1P7I A;  1FIP A;  1X2N A;  2L9R A;  3BR1 A;  1JUP A;  1WPK A;  2HOS A;  2YU9 J;  2JWT A;  1Y1W J;  2CQX A;  3LSG A;  2R5Z B;  4A3C J;  4MFE A;  1ZR2 A;  4QIW N;  2NS7 A;  2P81 A;  4M3D A;  2K9Q A;  5FLM J;  1IRZ A;  2LTP A;  1H89 C;  1JKR C;  2ELK A;  3BTL A;  2N8G A;  1JTX A;  2Y9Z A;  3Q0W A;  2LY9 A;  1S7E A;  4UUT A;  2DJN A;  4AYB N;  1APL C;  3RKQ A;  2LLK A;  2CUF A;  2LFB A;  4D7N A;  1TC3 C;  1HOM A;  2WV1 A;  4W1U A;  1T33 A;  2Y2Z A;  4FTH A;  2HDD A;  3GTO J;  2DMN A;  3HOU J;  3ZQG A;  4A3L J;  4IHW A;  1W0U A;  2EZH A;  2JJ7 A;  1QVT A; 
#chains in the Genus database with same CATH topology
 5J8C A;  1S72 I;  3HEF A;  2KKO A;  1BIA A;  1FYK A;  1FIA A;  2LVS A;  3GZ6 A;  2A5W A;  4L9J A;  1TT0 A;  2EZI A;  3RTR A;  2XAJ A;  4RB2 C;  3OYL A;  3VOD A;  3CD6 I;  2K7L A;  1CF7 B;  3V8L A;  2ME0 A;  2XPU A;  1E3H A;  4B4C A;  4JX6 A;  1QPI A;  3F6V A;  3BZK A;  2E35 A;  1VFC A;  1MJA A;  2VE8 A;  1UHM A;  3P9I A;  3H9Q A;  1A6Q A;  1B9N A;  4EQQ A;  1XGS A;  3KYD B;  1RKW A;  4EAT A;  4E7S A;  5C44 J;  3OS0 A;  3EUK L;  4XN0 A;  2STT A;  1MSE C;  3BR3 A;  1SAX A;  2TDX A;  1RNL A;  1VQ4 I;  4E7J A;  1XDU A;  3QYF A;  5EZH A;  1UJ8 A;  4A3D J;  1FLI A;  4G6D A;  3BDD A;  2D1H A;  4EM2 A;  3JSP A;  2HU9 A;  3AG3 H;  1RPW A;  1Y1V J;  4BXF A;  1XCB A;  3OV8 A;  1LFB A;  4HZF A;  4JX4 A;  4HNT A;  1LE8 B;  3HYI A;  1Y56 A;  3KPH A;  2PBI A;  1U0J A;  3W6V A;  2JSP A;  1V5F A;  2XKP A;  3JAM Z;  3E5X A;  2R7W A;  4BQQ A;  3PIP F;  3HBL A;  4ITV A;  3HOW J;  3CUQ A;  3K1P A;  1ZGW A;  4ZYD A;  2CQ7 A;  2R0Q C;  2GZW A;  3EUH C;  5FKM A;  2L4M A;  1IN5 A;  4KT6 A;  2UWM A;  2MSY A;  2IVM A;  1D8K A;  1REP C;  2HTS A;  3QYE A;  3HOZ J;  2LP0 A;  4EVI A;  3J81 K;  2NVX J;  2XDV A;  1TW3 A;  3DKY A;  3VYS B;  1TNT A;  2L0K A;  3ABT A;  3PL8 A;  4G6T B;  4XR6 A;  4KIS A;  2ESN A;  4BS9 A;  3CTA A;  5HLI A;  1Y8R B;  3D5L A;  2Q0O A;  3HPG A;  3TGN A;  3OYM A;  3S16 J;  1FPQ A;  3C2G A;  3FMR A;  4UUS A;  1K7A A;  2IW5 A;  1ITY A;  4YII A;  4ENK A;  5A2Q Z;  1P6R A;  2DMT A;  2IGK A;  2RQQ A;  4AUX A;  3ZRG A;  1VQN I;  3ZMD A;  1IO2 A;  3TL4 X;  4IRI A;  3BWG A;  2LY2 A;  2QEX I;  2VUM J;  1WFX A;  1YI2 I;  3MMY B;  2K4J A;  3PQJ A;  1XTA A;  3VFZ A;  2W84 A;  1R22 A;  2DPU A;  2ZXW H;  2XSJ C;  3I58 A;  1VQO I;  2EFN A;  1IUF A;  3TO7 A;  5IT3 A;  5IT9 K;  3LSK A;  4KMF A;  1J09 A;  2NXN B;  3VYU B;  3J80 Z;  3PUF A;  2YUS A;  5AON A;  4G7O F;  5IPA A;  2NNY A;  2XPW A;  1U3E M;  2EIK H;  5H20 A;  4PK4 A;  2JMW A;  1X1C A;  2NOG A;  4HSR A;  2ZXI A;  1XS9 A;  2A61 A;  2YSR A;  2MLK A;  3BJO A;  1FSH A;  2OUM A;  4FCY A;  1R4M B;  4F7Z A;  3ZP5 A;  3A4C A;  2QLZ A;  1A5J A;  4YIF A;  2DT7 B;  1R5H A;  1WZ2 A;  1QVU A;  4M6Y A;  4F92 B;  3RPQ A;  3GTM J;  3CCM I;  4BL0 B;  3HOX J;  3JRI A;  4ETS A;  1ZAO A;  4LB5 A;  1KYZ A;  5L3F A;  2IS4 A;  1TP4 A;  2GIZ A;  2FQ3 A;  4UXN A;  3JRD A;  2QSF X;  5ICE A;  3C2H A;  1ZRE A;  3A01 A;  3M3Y J;  4JQF A;  4EV0 A;  1ZKG A;  4BUP A;  3DU5 A;  1BR4 A;  2LRD A;  3V7C A;  2AXL A;  5DTD A;  1OYW A;  2MC3 A;  3K4N A;  1MH3 A;  1JUS A;  3MKW B;  3QU6 A;  4BJT A;  1QGP A;  3MKL A;  3DV8 A;  1W4M A;  3DEU A;  5BPD A;  2ZKZ A;  5LGN A;  3Q9V A;  1JHH A;  2OBP A;  3JSO A;  2L9N A;  4CYC A;  1H0M A;  4XON A;  3FIW A;  1EH8 A;  5HDN A;  3K1N A;  2K5C A;  4KN4 X;  2K85 A;  1V5E A;  4BEH B;  3J7Z I;  2W7N A;  2M34 A;  4EMS A;  4BXU A;  3CME I;  5E17 F;  4Y15 A;  1WJF A;  2E1O A;  1J9I A;  1ZG1 A;  2ECB A;  1YS6 A;  5FJ8 J;  1WJE A;  3HJE A;  4II3 A;  1Z05 A;  2RVC A;  2D45 A;  4FX0 A;  3OSF A;  3WTV C;  4L5J A;  1D1A A;  2LF8 A;  4HF2 A;  3GTL J;  3SDG A;  1IZ1 A;  4AVP A;  5DCM A;  4O3M A;  3ESW B;  3E5U A;  3K10 A;  2M7B A;  3PNT A;  2V9P A;  3S15 J;  1IXR C;  3AKZ A;  1ETQ A;  3T1B A;  1D5Y A;  3E1S A;  2NVQ J;  2G9W A;  3GTQ J;  3RZO J;  2ME6 A;  4GYG A;  4HBL A;  2QKM B;  3HKZ N;  5FB2 A;  2Y0M A;  2R7O A;  1YE9 A;  3FMS A;  4N4O B;  5EZG A;  1A04 A;  4DW6 A;  4CXF A;  3DTK A;  5M5Y J;  4RB1 A;  2XKO A;  2FE3 A;  1HW5 A;  1DQU A;  5CVJ A;  2HGC A;  1QBJ A;  2I5U A;  3BR6 A;  4MLO A;  3UNG C;  1L0O C;  2HYG D;  2W48 A;  3PJR A;  5GAD J;  1LUJ B;  1FYM A;  1NHA A;  2DTZ A;  4GO1 A;  2KIU A;  2M3A A;  5DM7 F;  1CGP A;  3COA C;  5JHU A;  1X3W B;  3KP5 A;  1YHQ I;  4A3B J;  1R6R A;  3D5R C;  3CDI A;  2NRA C;  5CYV A;  4M6X A;  1SFU A;  3CC7 I;  1R1U A;  2BE5 F;  4B48 A;  5D5W B;  1WH7 A;  5HVQ C;  1MDM B;  2M8G X;  2CO5 A;  4JX5 A;  4M3B A;  1WVR A;  2RNJ A;  4C3J J;  3S3N A;  2KPM A;  3F8B A;  4Z2Y A;  5EYR A;  3FK7 A;  3LSI A;  3D5S C;  5BNG A;  1SAU A;  2DOF A;  3CCR I;  1RKT A;  1W5C C;  3FZV A;  1QHH D;  3KCC A;  2VQL A;  1F9N A;  2GOM A;  1R58 A;  2IJL A;  2X1C A;  4Y52 J;  4IEJ A;  4M9S A;  1AKH B;  3FKJ A;  4WF2 A;  3U1D A;  3GTP J;  2IA2 A;  3MQ0 A;  2DDA A;  4ESJ A;  2RQP A;  3C1D A;  3QRF F;  3GFJ A;  4C3I J;  3ZN0 A;  2WAQ A;  2FNA A;  4DZJ A;  3PO2 J;  3WHB A;  1MKM A;  2ICW G;  2GWR A;  1O3Q A;  2CUJ A;  2KDO A;  1MMD A;  2XF5 A;  4UB6 C;  1VTN C;  2NVT J;  1O4X A;  3ZOB A;  2DT5 A;  3OR1 C;  2NOJ B;  3OYE A;  1J2X A;  5D5X B;  4XOP A;  2HS5 A;  2H8W A;  3SFZ A;  5C4J J;  2HWV A;  3HXL A;  4E6K G;  1FBQ A;  4MO7 A;  1NK3 P;  4S05 A;  4IHV A;  4XRS G;  1SVL A;  3I4M J;  2YX7 A;  3CDH A;  3ZMT A;  3HRS A;  2V6C A;  3MN2 A;  4BYY A;  2F4I A;  4NNJ A;  2RDP A;  2XAQ A;  4CYD A;  3R61 A;  2XRL A;  3ZN1 A;  1KQ8 A;  2M1B A;  3OY9 A;  5H6R A;  3K70 C;  1YIT I;  2QCO A;  2P4W A;  3F21 A;  1HSJ A;  1QQI A;  5FLV A;  3R60 A;  3RPU A;  2QVO A;  3ONQ A;  1V55 H;  4LJZ F;  1HXD A;  2Y48 A;  3WTX C;  3OS2 A;  3K9T A;  2ZSI B;  4E4H A;  2RRE A;  4ZDO A;  1ON2 A;  1T98 A;  1I6H J;  2DMU A;  2K4B A;  1YQA A;  5E3L A;  1X1A A;  1MBH A;  4FET A;  3SEQ A;  2EWN A;  3OYC A;  3HIF A;  1P9Q C;  1K6O A;  4IVN A;  2GM4 A;  1BI1 A;  1ODD A;  1XD7 A;  2EZL A;  4MQV A;  2E5Z A;  2VT2 A;  4BHC A;  2G7H A;  3DBR B;  2IA1 A;  2MD0 A;  3BR2 A;  1OMI A;  1B8I B;  4KA4 A;  2V6E A;  4BNC A;  4DNC A;  2VC0 A;  3CC2 I;  3HHH A;  1D0Y A;  5IP9 J;  4LIV A;  4RGU A;  2CSO A;  2FUG 2;  1OYY A;  3ABK H;  4KIT B;  1E3P A;  1WWX A;  2JK3 A;  3CCV I;  5BMZ A;  2M4K A;  3MKZ A;  1TWC J;  4Q5S F;  3P7N A;  2H1L A;  2VT3 A;  4ESB A;  2F5F A;  2Z33 A;  1TTY A;  3KZI C;  5EJC A;  4AC0 A;  1BC7 C;  3WTT C;  1FNN A;  2FBI A;  2GBY A;  2A69 F;  4GGG A;  1YJW I;  1L3L A;  3BG3 A;  2WBM A;  2Z2S B;  2ELH A;  1ZK8 A;  4B47 A;  1DPR A;  4DIQ A;  5FRM A;  4NB5 A;  3V7R A;  1NK2 P;  2ID6 A;  4C2U A;  4WXC A;  1BI0 A;  3BPV A;  3RCO A;  4AM3 A;  2E1M C;  3FHZ A;  1ZYR F;  3AG2 H;  2AO9 A;  2J5O A;  3I4N J;  2YR2 A;  4ZTF A;  2CW8 A;  1Z1D A;  2E19 A;  1B9M A;  4WK8 F;  4ZC3 A;  1KZH A;  4PZJ A;  2PX9 A;  5GP9 A;  4CCM A;  2JA5 J;  1J59 A;  3GCM A;  2QM3 A;  5DV5 A;  2QQ8 A;  2KIM A;  3W2W A;  4CH7 A;  2OJE D;  1FTT A;  3ZPL A;  1FIP A;  3CP8 A;  1JUP A;  1WPK A;  2YU9 J;  2LKS A;  2CQX A;  2UXN A;  1G59 A;  3ISP A;  1ERD A;  1BIB A;  3CF5 F;  4BE2 A;  2ZFU A;  3DEE A;  4I0A A;  2K9Q A;  5FLM J;  1IRZ A;  2JT1 A;  1IN8 A;  2F5E A;  5HOO A;  4A6D A;  2E1N A;  1XDS A;  3GYH X;  3Q0W A;  2FNP A;  2LY9 A;  3F23 A;  1EV7 A;  1XX5 A;  1ZAR A;  1HC8 A;  1X4O A;  1FZP B;  4UUT A;  3OYN A;  2GA1 A;  4AYB N;  4J00 A;  3RKQ A;  4KNY A;  2KRH A;  1EA3 A;  4CCL A;  5J6X A;  1S7A A;  4PFO A;  1HST A;  1PDN C;  3BY6 A;  4XBF A;  1P4X A;  2HDD A;  1GVJ A;  1ZG5 A;  1A31 A;  3ZMS A;  3FXJ A;  5LHG A;  4MTD A;  2JJ7 A;  4YG2 F;  3DBH B;  3RJP A;  1M1E B;  4XLF A;  1J5Y A;  3M8J A;  4EJU A;  4U0V A;  3Q5F A;  1F4K A;  4A3I J;  3DLL F;  3HOS A;  1FTZ A;  2BY0 A;  3TMO A;  5ED4 A;  4IF4 A;  4X0G A;  2O7O A;  1BA5 A;  1V3F A;  3KX2 A;  2Y0S A;  1MSF C;  1AHD P;  2A07 F;  2DA7 A;  3GEZ A;  3R6S A;  3HSR A;  1QPM A;  4DYQ A;  1UG0 A;  4DBQ A;  1DPU A;  4AU7 A;  2OCC H;  1Z0X A;  4WXD A;  2O5R A;  2BXZ A;  4E7H A;  2E34 A;  3RKY A;  2ZFW A;  3GTG J;  1SFK A;  1U8R A;  4JOM A;  3O6B B;  2CS3 A;  2LR8 A;  4BY7 J;  1QO0 D;  2TCT A;  1K83 J;  4OIQ F;  1ACI A;  1XMX A;  3JRE A;  4MEX F;  1ZN2 A;  1SC7 A;  2O9L A;  1TWF J;  1XB4 A;  2HI3 A;  4HEA 2;  3U9G A;  1E17 A;  2NS8 A;  3FXK A;  1Z77 A;  1H88 C;  3LFK A;  4PJN A;  2XRN A;  2QQ9 A;  3HHG A;  3OYB A;  5DCM B;  2DOD A;  4ZTJ A;  4RB0 A;  4XLH A;  5CKT A;  2JVG A;  5FO5 A;  2LMD A;  5EEG A;  3OSG A;  2VQH A;  2A6H F;  2LKP A;  3F3X A;  4NDL A;  3CO7 C;  1K6Y A;  3B02 A;  5CJ9 A;  3CUQ C;  5CVR A;  4ZDP A;  1TT5 B;  3K69 A;  2JA8 J;  3CF2 A;  4O6J A;  4IHS A;  1TWH J;  4XID A;  1Z91 A;  1UMQ A;  4BAC A;  3DU6 A;  4O5V A;  4EJW A;  4KFC A;  4QTR A;  3REO A;  4RGR A;  3HC7 A;  4CDG A;  1U2W A;  3CCQ I;  4BHB A;  2WV0 A;  2V1U A;  4XKB A;  3G1O A;  4WX9 A;  4M6V A;  4HNU A;  2MGQ A;  2HQN A;  3PIO F;  2ZNZ A;  4WCG A;  4R79 A;  2V1X A;  2QQB A;  5CVV A;  4UVA A;  1G3S A;  1R5I D;  5M5W J;  3MVP A;  2VOD A;  1DGR M;  4J01 A;  3ERE D;  1EH6 A;  3H3U A;  4BU2 A;  1KON A;  4AIJ A;  1WI9 A;  2X6O A;  3E3V A;  2H94 A;  2QQA A;  2GIV A;  2W4S A;  3OYF A;  3EUA A;  2PMZ A;  3SZT A;  1ETY A;  3P9C A;  4N0B A;  1JKQ C;  1Z7L A;  4KJZ A;  3JRA A;  4BGD A;  2E2J J;  4OIN F;  3IUO A;  1OR7 A;  2WWY A;  3S1R J;  3BTI A;  4BQN A;  3I5U A;  2L7M P;  2FQ4 A;  3H92 A;  2F6C A;  2DK5 A;  3IWF A;  2BV6 A;  2HR3 A;  5EF6 A;  3I3L A;  2QSH X;  1TQI A;  3G71 I;  1F43 A;  3WU1 B;  4B3X A;  2ID3 A;  2LK2 A;  1WSU A;  1IXS B;  3IRQ A;  2K40 A;  1ZRD A;  2P5L C;  3H0D A;  1B72 A;  1Q1V A;  4E70 A;  2HEO A;  1MBJ A;  3GZ5 A;  3QP6 A;  2H27 A;  3PO3 J;  4ON0 A;  4I99 C;  3B6C A;  1IG7 A;  3FKI J;  3TDZ C;  4M3F A;  3FXU A;  2HYJ A;  1S9H A;  2Q8K A;  3DP7 A;  5F0F A;  2G7U A;  1R9T J;  4NC8 A;  2RAE A;  1ZTR A;  2HYF A;  2EA4 A;  2WA0 A;  3IH3 A;  4UNO A;  2R93 J;  5AIP A;  1F36 A;  2DYS H;  4B3A A;  2EIN H;  5LLQ A;  3VEP A;  4U0Y A;  1XGN A;  4HQM A;  1Z3X A;  1TL8 A;  4GFB A;  1BL0 A;  3CUO A;  1MMS A;  4LIT A;  5F1R A;  4HX8 A;  1WRJ A;  2MBF A;  1DGW Y;  1OIS A;  2GOX B;  2TRT A;  3OIP A;  4XNF A;  5K5Q A;  2ZNY A;  1MND A;  2L9S A;  2V4J C;  2NAZ A;  5EG0 B;  1FOW A;  1V4R A;  1IJW C;  2C6Y A;  1YS7 A;  4PDK A;  2WAQ N;  1FYL A;  1HDP A;  3E6C C;  5JLX A;  3RQ4 A;  5IOY A;  2Y31 A;  2LH9 A;  4BQO A;  1K78 A;  3VSK A;  3Q3S A;  1MGT A;  5IOZ A;  3V8K A;  3PUB A;  3Q0U A;  2VE9 A;  2R7V A;  3A2K A;  5EG0 A;  1Y8Q B;  3FM3 A;  4I02 A;  1HF0 A;  5JVT A;  4XSX F;  5J4Y A;  4U7D A;  1KGS A;  2KHM A;  3LNQ A;  2X4H A;  1GT0 C;  1FMV A;  3H1C A;  2P7V B;  2OA4 A;  2V1D A;  5D5U B;  3HUG A;  3O8H A;  2FMY A;  5L3G A;  1K78 B;  2L02 A;  2PMH A;  3K4K A;  4HYE A;  2AXT C;  4XRF A;  3WTZ A;  1ONV A;  4OU0 A;  3A1Y A;  5FKO A;  2R7U A;  3WGH A;  4UV8 A;  5DM6 F;  1YJ9 I;  3KP3 A;  3I55 I;  1LQ1 A;  1GHC A;  4IPA A;  1I6X A;  3CMM A;  3RQI A;  1LFU P;  2MLG A;  3TDU C;  1N75 A;  4XLN F;  4L0Z B;  2VJ4 A;  4OMY A;  3BZ6 A;  5B1A H;  4KMU X;  2VBZ A;  4XIC A;  2KZV A;  3HGY A;  3JRG A;  1G6N A;  1MMN A;  3QWL A;  3WE3 A;  4AID A;  1I1G A;  4LIU A;  3TP3 A;  1IRG A;  3RI4 A;  2VOP A;  2IS6 A;  1K4S A;  3QPS A;  5J40 A;  5JHF A;  1QRY A;  3ZQL A;  4RGS A;  3FXM A;  2X51 A;  1ZH5 A;  1XG1 A;  4D9J A;  5JVG F;  4JK1 X;  2JA7 J;  2EB7 A;  2WB1 N;  3G1L A;  2BY1 A;  3MZ8 A;  1T38 A;  1OCZ H;  1E2X A;  3HOV J;  2ZXJ A;  4MQ9 F;  1IGN A;  2PEX A;  4QLC U;  2ZCW A;  2WC2 A;  3LMM A;  5DD8 A;  2BVM A;  3HRM A;  3RIR A;  3LQR A;  2FRH A;  4HST A;  2HQ5 A;  2VBX A;  1G3T A;  3ZCO A;  2R5Y A;  2PN6 A;  2A68 F;  2ZME A;  4ANJ A;  4HQE A;  1DU6 A;  5ERI A;  2AQE A;  3S2H J;  2LSO A;  1S3J A;  5L3C A;  5FGM A;  2CUZ A;  3MEX A;  1IV6 A;  4CO8 A;  4XKW A;  4XRM A;  5C4X J;  2ZC2 A;  3AAF A;  5DDG A;  1LKX A;  4R1H A;  1R4N B;  2WTE A;  5KVR A;  4HPQ A;  1K4T A;  3K4B A;  3WTU C;  2QUF A;  3WG7 H;  4IL6 C;  2KZG A;  3IP4 B;  2RV8 A;  4UVB A;  4P5O A;  3A03 A;  3CLO A;  4KYW A;  2Z9O A;  4KT5 C;  3SDB A;  2KRF A;  4IZZ A;  1AOY A;  1FOY A;  1FOX A;  5LGT A;  1JUM A;  4M72 A;  2ISZ A;  3L00 A;  3OYJ A;  4HAM A;  1R23 A;  2VQC A;  1DP3 A;  4XMY A;  2FX0 A;  2XAU A;  2K9L A;  2ACJ A;  3KLO A;  2FBK A;  5H6Q A;  2XV4 S;  4ZYA A;  3G4S I;  2DFE A;  4XN3 A;  1VQ5 I;  5KCM A;  3CES A;  1WI3 A;  4Y7N J;  4XK4 A;  3AL0 B;  3G3Z A;  2GQQ A;  5J1Y A;  3HL2 A;  5KNL A;  4U87 A;  5GTI C;  3PSI A;  2X0L A;  5J4V A;  1U78 A;  3I64 A;  2F4M B;  4IRG A;  3ZQF A;  2EFO A;  2BHY A;  1I39 A;  1VQ6 I;  4UB8 C;  3NQO A;  1RC9 A;  1ETK A;  5DYM A;  3N4M A;  5FD5 A;  3OIO A;  2CW0 F;  3L2C A;  3GTJ J;  3OL4 A;  1O3R A;  2FML A;  1IW7 F;  4CCO A;  3PQK A;  2VB6 A;  5ICF A;  3QP5 A;  4UUV A;  2Y30 A;  1FT9 A;  1LFP A;  1SMT A;  5D8L B;  4P9F A;  2JZY A;  3WU0 A;  3S17 J;  5LFA A;  4RAZ A;  5IYB J;  2DPD A;  4G94 A;  4E7Z A;  5K7Z A;  2MD5 A;  3PNV A;  4Z6Y A;  3CZ6 A;  2LYC A;  3S93 A;  3LWF A;  2CV0 A;  2OZ6 A;  4I98 B;  1TZL A;  1LDJ A;  3IWZ A;  5B66 C;  2VAS A;  2OD5 A;  1MDM A;  1T6S A;  2M30 A;  2Y0S N;  3FXL A;  4PGH A;  5IT9 Z;  4BAY A;  1USS A;  5J1R A;  4EJT A;  2CQK A;  3I53 A;  3QYB A;  3GFM A;  4M74 A;  2DCE A;  3DWL E;  4ZJZ A;  4ZYH A;  1ETV A;  5IYD J;  1IF1 A;  1YW9 A;  3S1N J;  1JT6 A;  2EBI A;  3ZQ7 A;  4XLA A;  4X6A J;  1B59 A;  3BCB A;  5A2Q K;  2DI3 A;  1YX3 A;  2CGP A;  3OYD A;  2ETH A;  3KET A;  4PSX A;  1MBK A;  3P5J A;  3DEW A;  3T0Y A;  3E6D A;  3ZQI A;  4DYC A;  2RNG A;  4JYK A;  3OOP A;  5E1Z B;  3ASO H;  3BQZ A;  1Z9C A;  3FXO A;  4L9V A;  1RRJ A;  1MIJ A;  4AIH A;  4K2E A;  2IT0 A;  1R49 A;  2CFX A;  3I0T A;  3NAU A;  4ZYG A;  1WKM A;  3NRV A;  3OYK A;  2H6C A;  3SZP A;  4BDY A;  5FKL A;  4CHU A;  4PJL A;  3ZMZ A;  2FU4 A;  2K86 A;  4EM0 B;  3TKY A;  3WTS C;  5F64 A;  1HW1 A;  3R4K A;  2H09 A;  2HXI A;  2LRE A;  3KEY A;  1YFH A;  4IHY A;  3QOE A;  2I10 A;  3V4G A;  4ABZ A;  3CCS I;  2GLO A;  1I5Z A;  1IDZ A;  2ELJ A;  4A3J J;  1D5V A;  3RYP A;  2R7X A;  3K4C A;  3IH2 A;  4QWQ A;  3GWZ A;  2EA2 A;  3H3V K;  4LK0 F;  4P1W A;  5M3F J;  1LVA A;  1VQ8 I;  3F8C A;  2HVQ A;  3AG1 H;  1EJ9 A;  3HTS B;  1ZEL A;  2L9R A;  2HOS A;  1PYV A;  1UST A;  2L9V A;  1W5T A;  1T2K A;  3L2W A;  2IGM A;  1ZR2 A;  4QIW N;  1QZE A;  2KJB A;  4PJ0 C;  2BY2 A;  2NS7 A;  2DJI A;  3WTW C;  4E7K A;  4BE0 A;  2GAU A;  2K9M A;  1H89 C;  1MJB A;  1JKR C;  2ELK A;  3BTL A;  1JTX A;  1S5L C;  1Z67 A;  3HRT A;  2WAD A;  2X6X A;  2XGX A;  4FQG A;  3DKX A;  4NQW B;  2H6B A;  5FD6 A;  2CUF A;  3OYH A;  2BBY A;  3CC4 I;  2KQR A;  3KZY A;  2LFB A;  4I09 A;  3L7W A;  4XLP F;  3KP6 A;  1SFX A;  5DCF A;  1BOB A;  1T33 A;  2GXG A;  1UB9 A;  1E0E A;  2EJR A;  3HOU J;  4C30 A;  2QBY A;  2O0Y A;  1LNW A;  2X85 A;  5BOX A;  1FP2 A;  2ECC A;  5HS9 A;  1F5T A;  4NQW A;  4KIG A;  4KN7 X;  4RLQ A;  4ESF A;  4NC6 A;  3L2Q A;  3KZZ A;  2XF6 A;  1P2F A;  5K7F A;  2CU7 A;  1JKP C;  1ZHF A;  3S14 J;  3D1N I;  1SMY F;  4YEL A;  2A6E F;  4ZH4 F;  1JI8 A;  4U88 A;  2I8D A;  4N4N B;  5EDN A;  1YRN B;  2LY1 A;  3A02 A;  3SQN A;  3I56 I;  3K4M A;  1T39 A;  3L2V A;  3QOP A;  4HOB A;  5FKN A;  1LDD A;  4OAZ A;  3WE2 A;  1D0X A;  3PFY A;  3W6J B;  2O03 A;  3K70 D;  4JBA A;  2W85 A;  1WJA A;  4HDV A;  3IC7 A;  3GME A;  2ZJ2 A;  1X3Z B;  2VPR A;  4FT8 A;  2HZT A;  3GLX A;  1XSD A;  4HG2 A;  1WHU A;  4R8H A;  3OL3 A;  4DZP A;  3SEZ A;  3AL0 C;  4L18 B;  2JA2 A;  1R5G A;  1Y6I A;  1ETX A;  1X58 A;  2YX4 A;  2W82 A;  1IN6 A;  2HDC A;  4DQ2 A;  3CP2 A;  1GV2 A;  1KYW A;  2XHK A;  1ENH A;  4DOZ A;  5KK1 A;  2UUZ A;  4EGY A;  4LOC A;  1IRF A;  1GV5 A;  1WGX A;  2PJP A;  3LL7 A;  2LOO A;  2QGU A;  2V9K A;  4D7M A;  3A01 B;  2VXZ A;  5F0H A;  5LHI A;  1OQY A;  3CMA I;  2DA6 A;  2DOA A;  4PFP A;  3PNY A;  3I54 A;  1MMA A;  2BEO A;  3M07 A;  1I3Q J;  2F5C A;  3N97 A;  1B4A A;  4LG0 A;  3CCY A;  3T8R A;  4L9T A;  2Q2E A;  3G73 A;  2R7F A;  3K2Z A;  1P7J A;  1JE8 A;  5GAG J;  4QSH A;  5B5E C;  1OYI A;  1TWA J;  4ZZL A;  1J75 A;  2BY3 A;  5CVI A;  5ILU A;  1X19 A;  4E7L A;  3D0S A;  5JR3 A;  1AA7 A;  1S29 A;  2X6Y A;  5IP6 A;  2FJ1 A;  1KQ0 A;  5DUI A;  1MD0 A;  4IXA A;  4KIF A;  1KU2 A;  4PCQ A;  3VOE A;  3W2V A;  4A3M J;  3MD2 A;  2JN6 A;  2QYO A;  4OWR B;  3B6A A;  1B6A A;  2DO7 A;  4Y33 A;  5K5R A;  1BW5 A;  5ILS A;  5F6F A;  3F6O A;  3RYR A;  3K0L A;  1UFM A;  2EFQ A;  1N77 A;  2W57 A;  1POG A;  1HKT A;  2KIS A;  4XOT A;  2VON A;  1PP8 F;  2XB5 A;  5FRN A;  1MJ9 A;  3GLL A;  5J1U A;  4IQ4 A;  2MH9 A;  3LA3 A;  1SD5 A;  2JRM A;  2FXA A;  2LC2 A;  2DQR A;  1X1B A;  3HPH A;  4RS8 A;  4A0Z A;  4HLX A;  5F08 A;  4DJA A;  3OYA A;  2EH3 A;  3BG9 A;  2KT0 A;  4C3H J;  2QZ8 A;  4A3F J;  1DUX C;  2VL8 A;  2EIM H;  2K9S A;  4GXO A;  4XLC A;  2EZK A;  4P55 A;  1NG7 A;  2E2I J;  2HNH A;  1XSV A;  1FJL A;  2E60 A;  3M7G A;  2HKO A;  1ZGJ A;  3LSH A;  6PAX A;  4PJM A;  1JKO C;  3HB9 A;  2DA5 A;  1T08 B;  3RKX A;  1UHW A;  5FKK A;  4B8X A;  3HSF A;  3BG7 A;  4EJO A;  2K9N A;  1W36 C;  5BS6 A;  1TBX A;  2PFB A;  3ZQQ A;  3MCZ A;  1OCT C;  3ZQC A;  1H9T A;  1KU9 A;  1B72 B;  3E7L A;  2EQR A;  3GX4 X;  4G7H F;  3NWS A;  3LST A;  2O8X A;  3MKY B;  2X6W A;  2QKL B;  5FFZ A;  2OCE A;  1OR7 C;  1K79 A;  1LE8 A;  3JRB A;  1N25 A;  3S1M J;  3H5R A;  1VI0 A;  3E97 A;  1Y0U A;  3HGG A;  1RR7 A;  1TQP A;  3DTE A;  3F8N A;  2Z3Y A;  4II2 A;  1DP7 P;  3L9F A;  5AIQ A;  2K02 A;  4MNU A;  1H9G A;  2X9D A;  2OAZ A;  2JPB A;  3TW6 A;  3CCL I;  2DLL A;  2OF7 A;  1YIJ I;  1UCR A;  3T8T A;  4ASN A;  5M5X J;  3WG9 A;  1GDT A;  2VJI A;  3BG6 A;  5F27 A;  2P5V A;  2IS2 A;  4YFX F;  4MHG A;  2R5Z A;  2CQQ A;  2OPT A;  3VYT B;  3OWT A;  2VLA A;  5DEQ A;  3HUG B;  3PM1 A;  1OJL A;  3MWM A;  1BM9 A;  1BR2 A;  2B0L A;  3DCF A;  4QPO A;  1IN7 A;  2XAF A;  3PSF A;  1EH7 A;  1VQ9 I;  2ZXH A;  1KQ9 A;  2PQ8 A;  2A5Y B;  1PUF B;  1BN5 A;  3JR9 A;  5D5V B;  3FK6 A;  5BPI A;  1BI3 A;  4EJV A;  1YTY A;  4LLN A;  4MTE A;  2KFD A;  1X3U A;  2PMZ N;  2E1M B;  2HVR A;  2Z1D A;  2W1O A;  3O3K A;  2IPQ X;  1UEL B;  1WCM J;  2HFH A;  2BW3 A;  4IOA F;  2BYV E;  2DMQ A;  3JTG A;  4B43 A;  2WY8 Q;  3GZN B;  1YIO A;  4IHT A;  2ZJP F;  3FIS A;  1IDY A;  4MIM A;  4NBQ A;  1GVD A;  1FC3 A;  1KA8 A;  2Z5U A;  3S32 A;  2VIX A;  3JTH A;  2VBW A;  4AWX B;  5IP7 J;  1IAW A;  4NUB A;  2DA1 A;  1LB2 A;  2R4G A;  3F8M A;  3TO6 A;  3BTC A;  1ZR4 A;  2NVY J;  3H36 A;  2AS5 F;  1HLV A;  3O2P E;  2VPL A;  1T0F A;  2E71 A;  1FWZ A;  1QZZ A;  2WAE A;  2X48 A;  2M2E A;  3GW2 A;  3KFW X;  3H5A A;  1UG2 A;  2DAO A;  2VJJ A;  4XOR A;  1YG2 A;  3JCU C;  2NYX A;  4QPQ A;  4CIC A;  4FE4 A;  2R7D A;  2KDZ A;  3V42 A;  3IH4 A;  4B1R A;  2IRF G;  4H0E A;  2BOL A;  2CJJ A;  1Z7U A;  4RDU A;  1SFO J;  4NC7 A;  1JT0 A;  2H8R A;  3DKW A;  4JP0 A;  1GXP A;  5ICG A;  2MH2 A;  3QOD A;  2CV1 A;  2PJR B;  3L1P A;  3FF5 A;  4OAY A;  2VN2 A;  2DMP A;  3JAM K;  2WB1 A;  4L9N A;  1WQ2 A;  4L5E A;  2E2H J;  4V2F A;  4ZYE A;  4AD9 A;  5K1Y A;  2DW4 A;  1VQL I;  4CSW A;  3K1M A;  1D0Z A;  1B8I A;  2XAG A;  3KP2 A;  4UHT A;  2XGC A;  3BC8 A;  1ZRF A;  3HTU A;  3M1C A;  3S1Q J;  4PGG A;  1Y39 A;  4LG3 A;  4CZZ A;  4HV6 A;  2X1D A;  2R7R A;  1HKQ A;  1W0T A;  1TQM A;  3J7A Y;  3EQL F;  4FIS A;  2L2O A;  3GTK J;  2DYR H;  1WJ5 A;  3I9V 2;  2OTL I;  1I1S A;  3WGI A;  3TW7 A;  4LGW A;  3I59 A;  5EEA A;  4D0P A;  4ZZD A;  2HDW A;  2Z99 A;  3M8F A;  2FOK A;  2M5W A;  2M0C A;  3BCA A;  3SYT A;  1X1P A;  1FSE A;  3RZD J;  1IUY A;  1ZLJ A;  3DF8 A;  1GXQ A;  4B44 A;  2HPI A;  3VB2 A;  3GFI A;  2DA2 A;  4UV9 A;  3QPT A;  1U5T C;  4L0Y B;  3I59 B;  4NHJ A;  1FEX A;  3C18 A;  1OCR H;  2L3D A;  3ECO A;  1R36 A;  1ZQ3 P;  2IAI A;  2XB0 X;  1YW8 A;  3DBL B;  4PUS A;  4KUM A;  3LSM A;  4RBO A;  2MFZ A;  3AG4 H;  4M73 A;  1U5T B;  5E79 C;  3TBI A;  4CUG A;  3S2D J;  2GA2 A;  4XRS A;  4Y3O A;  1R00 A;  1J0R A;  1RUO A;  3NEU A;  2XAH A;  2UV1 A;  4LB6 B;  4XKV A;  1HW2 A;  3BPX A;  3J7A O;  2P6T A;  2R7Q A;  3A0B C;  4GRI A;  5HDG A;  3SZG A;  2LBF A;  2QA4 I;  1XC5 A;  1BBY A;  1EF4 A;  1BJA A;  2K3F A;  1W7P A;  4ZDL A;  2FD5 A;  1YRN A;  1T56 A;  1W7P B;  2XUB A;  5KHD A;  2GXA A;  4RA2 A;  4UVC A;  3M9A A;  5GPC A;  3K7A J;  2R7Z J;  2QWW A;  3ELK A;  4TV7 A;  2JVH A;  4X1E A;  4U7B A;  3S3O A;  2V79 A;  2Z16 A;  4YRV A;  1DDN A;  1MBE A;  2ZJQ F;  3ABM H;  2EK5 A;  4FHT A;  1OKR A;  1BI2 A;  2HPM A;  4BXX J;  4M3G A;  4FE7 A;  1E3O C;  4LK1 F;  1D8J A;  4A93 J;  1PP7 U;  5BQT A;  3GBG A;  3HOY J;  1AU7 A;  2E7W A;  3KEO A;  3QQA A;  3LSJ A;  2L4A A;  5J3L A;  5JI6 A;  2NNN A;  1UZC A;  4IJA A;  1IC8 A;  1AKH A;  4D5C A;  4W97 A;  1D1B A;  5HOD A;  4G9Y A;  2XC7 A;  3UKG A;  1R7J A;  1TLH B;  5M3M J;  4RAY A;  1F1Z A;  2PJR A;  3E6B A;  3BQY A;  3W2A A;  1U9O A;  3V7S A;  2VKH A;  5J47 A;  4ENJ A;  1PUE E;  2X1E A;  1XMK A;  3K4J A;  3CMY A;  1ETW A;  4LG0 B;  1ULY A;  1MBG A;  4G8X A;  1LEA A;  1H8A C;  5GAH J;  4BBS J;  3RPU D;  1QHG A;  3P9K A;  2AQF A;  2VI6 A;  2V1N A;  3KLN A;  3LAP A;  4CCJ A;  2HOT A;  3GUD A;  1C0W A;  3ML6 A;  1HCR A;  1LPQ A;  3JRF A;  5HNH A;  1W1W E;  2KJC A;  3HSE A;  3KYC B;  4BJ6 C;  4IKF A;  1SFE A;  2RGV A;  1OCC H;  4DYR A;  3TQN A;  3H0G J;  1Z6T A;  4BQA A;  1T8I A;  2HKX A;  1X2N A;  2IS1 A;  3BR1 A;  1R1T A;  2EPF A;  2JWT A;  2W00 A;  4F93 B;  1QZY A;  2R5Z B;  2DOE A;  4MFE A;  2P81 A;  1G3Y A;  4M3D A;  5FFX A;  4XM3 A;  1LJ9 A;  4YEJ A;  1A36 A;  2JTV A;  4RLF A;  2N8G A;  2Y9Z A;  1FOK A;  5L3E A;  2PLY A;  1HKS A;  5GAE J;  2KIQ A;  3HKZ A;  1MZB A;  2VXD A;  1ON1 A;  2F2E A;  2CYY A;  2DTR A;  2ZO4 A;  1APL C;  2IGN A;  2LLK A;  4D7N A;  3TO9 A;  3CCJ I;  1IRX A;  4EGZ A;  3OYG A;  2M45 A;  4W1U A;  5CQG A;  1I3A A;  2BW3 B;  4ENN A;  2KIF A;  3MFK A;  1VZ0 A;  4A3L J;  3BJ6 A;  4GYI A;  1FY7 A;  1FBS A;  4HRI A;  1QVT A;  4A2U A;  1YLF A;  3EYI A;  1JXS A;  2DFF A;  5EEH A;  5JLW A;  3M1E A;  4UUS B;  1YOV B;  2OZU A;  3ULQ B;  1RET A;  2W24 A;  1GUU A;  2DFH A;  4RAF A;  1YYV A;  2DQL A;  4N9I A;  1X4P A;  3WHC A;  1ZGA A;  3OIQ A;  5DD4 A;  5L3D A;  4Y13 A;  5GPA A;  5D4S A;  2A05 A;  2OTJ I;  3IV5 A;  4BBR J;  2MC4 A;  3BLY A;  3CJT B;  5FRO A;  5FLX Z;  2COB A;  3RKW A;  1DU0 A;  3BR0 A;  1CQT A;  2VKD A;  2V26 A;  3N05 A;  5E3N A;  3CCU I;  4BE1 A;  2K27 A;  9ANT A;  2R5Y B;  1VQK I;  3LAJ A;  1OLT A;  2JUG A;  1N78 A;  1OFC X;  3WOD F;  2YS9 A;  1OCO H;  3W3C A;  1ZLK A;  1G8X A;  3F9K A;  3QPL A;  1QNT A;  1LEB A;  3SJM A;  3FM5 A;  3IRR A;  1R71 A;  1SD6 A;  2FBH A;  3G1M A;  3S3M A;  1LDK B;  2LNB A;  3BR5 A;  3EET A;  4HA8 A;  4RM3 A;  4A3E J;  2ESH A;  3L2R A;  5IY5 H;  2XIG A;  1XN7 A;  2R7S A;  3E0J B;  2EIJ H;  2M9H A;  3GO5 A;  3ABU A;  1W36 D;  2K3P A;  3ZR8 X;  2WY7 Q;  2CUE A;  2P8T A;  3K4L A;  4WXH A;  2FF4 A;  2E7X A;  3G6E I;  1FMW A;  1JHF A;  3EDP A;  2OQR A;  2R92 J;  4CA0 A;  2Y9Y A;  4MEY F;  3HOT A;  2IXS A;  3PFI A;  3JW4 A;  2HQA A;  3IHU A;  2DA4 A;  2M8E A;  3E5Q A;  1JJ8 C;  3WTY C;  2LKX A;  1HA8 A;  1Z21 A;  3BOQ A;  1G4D A;  3FX3 A;  3DPT A;  4LFU A;  1G3W A;  3KE2 A;  3U2R A;  4L5I A;  5LEJ A;  2XVC A;  1XSX A;  1UHS A;  2MW8 A;  2M0M A;  2DU9 A;  2D1V A;  3FXR A;  2UXX A;  3F0C A;  2CQN A;  1JGS A;  1XGO A;  5E3O A;  3KEQ A;  3LQQ A;  1NH3 A;  4HNV A;  2XGE A;  4D1Q A;  1OPC A;  4KDP A;  2LDU A;  4HX7 A;  4PJJ A;  3QAH A;  2H1K A;  2BHZ A;  2ZJR F;  2HVS A;  3H9G A;  4MFD A;  2IP2 A;  4XL9 A;  1O7L A;  1ETO A;  1T95 A;  3J7Y J;  2KRC A;  4GCV A;  2Q1Z B;  4M3E A;  4DGW B;  2F5V A;  3WU2 C;  4HX4 A;  2MG4 A;  3ZQH A;  4HV5 A;  1P4W A;  5L3B A;  4WWC A;  3ZMU A;  5LRS A;  1Q1H A;  3HZJ A;  3HDD A;  2L7K A;  4XQF A;  4CCK A;  2ISY A;  4S04 A;  2F4O B;  4XKC A;  2NS0 A;  2OQG A;  3H5N A;  3GFL A;  2KL4 A;  1U9N A;  4MGR A;  3DPL C;  5D8K B;  2KMU A;  3TED A;  1YJN I;  2DBB A;  4KIC A;  5E1W A;  4D5F A;  1KU3 A;  1SD7 A;  1P92 A;  2Y75 A;  2JA6 J;  2STW A;  1TW2 A;  2A6T A;  1O57 A;  4I0B A;  3HG9 A;  4IOC F;  2EIL H;  3EUH A;  1I50 J;  2ADU A;  3IAM 2;  3VPR A;  1J7K A;  5DS9 A;  1BJZ A;  4M71 A;  2L54 A;  1FP1 D;  4XLE A;  2B9S A;  4GDF A;  3VYR B;  4S0H B;  1D3Y A;  2O3F A;  3ECH A;  5FLX K;  1G2H A;  2UZK A;  1BR1 A;  1CF7 A;  4LMY A;  3TOB A;  5LD2 C;  3CJR B;  3E6M A;  2FEZ A;  2E36 A;  2CMP A;  2HOE A;  4H4K C;  4C9Y A;  2M7A A;  3FHN A;  1SEU A;  5TRD A;  1KU7 A;  4Q48 A;  1PUF A;  2JSC A;  4BEH A;  4XSZ F;  3S2W A;  1MW7 A;  5JFR A;  2VKE A;  2BVL A;  1IV8 A;  3R0A A;  2G0E A;  5CLS A;  4RAG A;  4G6Q A;  2FSW A;  1XGM A;  2P7C B;  4CYC B;  2B7E A;  3BP8 A;  4FAS D;  4FX4 A;  4A5N A;  2IA0 A;  3DTI A;  2ZB9 A;  3QPH A;  5E18 F;  5CQE A;  2L7Z A;  3DLA A;  3JRC A;  2W25 A;  2MYS A;  4P96 A;  3LSR A;  2LF7 A;  1P4A A;  3FBN B;  2BXY A;  2XSD C;  1BC8 C;  3VSL A;  4M9Z A;  5F0C A;  4RB3 C;  5D6E A;  2IEK A;  4LLL A;  2VBY A;  4ENM A;  2NVU B;  4A69 C;  3AFH A;  1I27 A;  1RI7 A;  3CUQ B;  3DFG A;  5EGO A;  4IHX A;  2MAB A;  2QF7 A;  1ZRC A;  5EGO B;  3I4P A;  2E5N A;  3JRH A;  3ZGK A;  2XPV A;  4A6E A;  2VJ5 A;  4U0W A;  2L01 A;  4Y4R A;  1ZG3 A;  1XMA A;  1PVE A;  3Q0V A;  3CO6 C;  4F52 A;  4BHP A;  1S7O A;  4IQJ A;  3NAR A;  5J8F A;  3G2B A;  3IKV A;  3VDX A;  4A5M A;  4CCN A;  2P5K A;  1SD4 A;  1FX7 A;  3BTJ A;  3C7J A;  4LLG F;  1TWG J;  2DA3 A;  3BG5 A;  4Y17 A;  3MZH A;  1U8B A;  4YIR X;  5D4R A;  3IAS 2;  4C2T A;  3FDY A;  3FXQ A;  3ZXS A;  1MBF A;  1VND A;  5CVU A;  1YO5 C;  3TP0 A;  1K61 A;  1QU3 A;  5E8G A;  5LEK A;  2O8K A;  4V19 K;  1IXC A;  3KIO A;  3ABL H;  4AIK A;  1YW7 A;  2GXB A;  2WAF A;  3M4O J;  1W5S A;  3BT9 A;  2JUC A;  3CJQ B;  4BY1 J;  2R3S A;  4Q47 A;  5K5O A;  3Q9S A;  2J5P A;  2QBY B;  1NG6 A;  3O8G A;  5E3M A;  1B1B A;  2OU2 A;  4RMN A;  3IL2 A;  3LOC A;  2CWE A;  4I01 A;  1TNS A;  3U21 A;  3I71 A;  2EV5 A;  1O3T A;  2L7F P;  4LD5 A;  2BZT A;  4HDU A;  2DK8 A;  1VF9 A;  2V7F A;  2QSG X;  4A0X A;  4EEF G;  2R7T A;  4OIP F;  5F1J A;  4A3K J;  4BH9 A;  2LG4 A;  2CW7 A;  4YFN F;  5HLH A;  3V8J A;  1WH5 A;  4F55 A;  3KP7 A;  2RN7 A;  5ILV A;  3RDI A;  2XF7 A;  2EFW A;  2XRO A;  4RGX A;  3UR3 C;  4I2O A;  2YPR A;  3DXJ F;  5LGU A;  3M8E A;  2V9V A;  1BW6 A;  4BJ5 C;  2VKV A;  1VQ7 I;  2OC6 A;  4UY8 I;  2B63 J;  2EV0 A;  1YX5 A;  5B1B H;  3NWT A;  3L2U A;  4OOI A;  2HZD A;  3RSN A;  2P0W A;  2FA5 A;  5HDK A;  1MNE A;  4G7Z F;  3DPU A;  5E20 A;  1A35 A;  4BKX A;  1FBU A;  1WJB A;  3H35 A;  2Y69 H;  2P6S A;  4F3Q A;  1RZ4 A;  2M87 A;  1IN4 A;  4OIO F;  1STZ A;  3MZY A;  2F5D A;  1BOA A;  5KAI C;  3SHF A;  3CJN A;  1EKE A;  2IBD A;  3LSP A;  2LBF B;  2DN0 A;  3IKT A;  3CLQ A;  1PJR A;  4P9U A;  5H2F C;  4I6Z A;  1X2M A;  4J19 A;  1S8N A;  3C3W A;  3KYL A;  3CCE I;  4CGZ A;  3LFU A;  3A0H C;  3EPZ A;  5HS8 A;  2O61 A;  2HOA A;  1S6L A;  3LA2 A;  4AYB A;  5GTH C;  1Y0N A;  2HXO A;  4V2G A;  1A6I A;  2CRG A;  1HDD C;  3QU3 A;  3J81 Z;  1D1C A;  3S8P A;  4DBR A;  4I76 A;  1XCV A;  2ZME C;  1ORK A;  2D2W A;  3GXO A;  2FOW A;  5B3S H;  2DT6 A;  3J80 K;  3U1K A;  4KIB A;  2XGD A;  1VQP I;  3HM5 A;  2AHQ A;  4CZC A;  2COM A;  4A3G J;  3HRU A;  4PSW A;  2JQ7 A;  2KLO A;  3ROU A;  2HQR A;  1MH4 A;  1GLN A;  1Z6R A;  2DFI A;  2RKH A;  2VQG A;  4EM1 A;  2VOO A;  2ZME B;  4HF0 A;  1JJ6 C;  5IYC J;  5HNF A;  1WJC A;  3C2B A;  5E1X A;  4E7I A;  1MMG A;  3ERM A;  5C3E J;  4A0Y A;  3CQZ J;  5D6F A;  4F91 B;  5CPR B;  2CG4 A;  1X1D A;  4I7H A;  3GF2 A;  2A3S A;  1UAA A;  3BZC A;  3K2A A;  3FMQ A;  1OCP A;  1JGG A;  1RIO H;  1O7F A;  5TIS C;  1VQM I;  4OMZ A;  5F04 A;  3OMY A;  2EFP A;  4YFK F;  3WGG A;  1RR8 C;  4C2M J;  3K6G A;  2HTJ A;  1JTY A;  2OV7 A;  1Z3Y A;  5ICC A;  1SAN A;  5LBQ A;  3R0J A;  5DUK A;  1XPX A;  3GVA A;  3EYY A;  1HQC A;  2DDB A;  2PI0 A;  2D5V A;  2KP6 A;  1U6G A;  2LD5 A;  3H9J A;  2CH0 A;  3OYI A;  4G12 A;  4B09 A;  3OOU A;  1RES A;  5HS7 A;  2PMU A;  2ZSH B;  4N9H A;  1AWC A;  2DXI A;  3VWB A;  2E1C A;  3LA7 A;  2JRT A;  1MNM C;  3SFI A;  2JPC A;  3F22 A;  3MAJ A;  3X2Q H;  3SXY A;  5K7H A;  1RUN A;  1NTC A;  2CV2 A;  4IX7 A;  1SVM A;  5LRR A;  2YU3 A;  1SVO A;  2EV6 A;  2O6G E;  4M9X A;  5TGT A;  3CDL A;  5TJJ A;  2PG4 A;  1QA6 A;  3ASN H;  2QEN A;  3FBI B;  1LVK A;  3BRO A;  4AVZ A;  3ZMV A;  1P7I A;  4HF1 A;  1T0F C;  2L5Q A;  3FWE A;  2VC1 A;  1Y1W J;  3W6K B;  3F72 A;  3LSG A;  1HBX G;  1O3S A;  4A3C J;  2Q2E B;  1U5T A;  4IRH A;  1V54 H;  4OIR F;  2ZBK A;  5HLT A;  2IGO A;  2LTP A;  1W7P D;  2MA3 A;  3TOA A;  2XAS A;  2BGC A;  3L09 A;  1V5G A;  2F48 A;  3DQV C;  3KP4 A;  2RC4 A;  2M4G A;  2CFO A;  1S7E A;  4HW0 A;  5E8I A;  2DJN A;  4RM2 A;  4BDZ A;  5LHH A;  1TC3 C;  1HOM A;  3OR2 C;  2WV1 A;  3T5X A;  1R1V A;  3OS1 A;  5HLG A;  2Y2Z A;  3BJA A;  4HLY A;  4A12 A;  3H3Z A;  4FTH A;  3GTO J;  4Q4Z F;  2DMN A;  3ZQG A;  5KAF C;  3F8F A;  4IHW A;  1WJD A;  3B73 A;  1W0U A;  2EZH A;  4IO9 F; 
#chains in the Genus database with same CATH homology
 2ECC A;  3HEF A;  5JLW A;  4A3I J;  1FIA A;  2LVS A;  4UUS B;  1FTZ A;  1RET A;  2EZI A;  1GUU A;  2O7O A;  5K7F A;  1JKP C;  3S14 J;  2CU7 A;  1BA5 A;  3WHC A;  3D1N I;  1MSF C;  5GPA A;  1AHD P;  2ME0 A;  2XPU A;  2DA7 A;  4B4C A;  4BBR J;  3IV5 A;  4JX6 A;  1QPI A;  4DYQ A;  5EDN A;  1YRN B;  1Z0X A;  1VFC A;  3A02 A;  2COB A;  1DU0 A;  3BR0 A;  1CQT A;  5FKN A;  3GTG J;  2LR8 A;  4BY7 J;  5E3N A;  2TCT A;  1K83 J;  1RKW A;  5C44 J;  9ANT A;  2R5Y B;  3JRE A;  1MSE C;  3BR3 A;  2VPR A;  2O9L A;  1OFC X;  5EZH A;  1TWF J;  2HI3 A;  2YS9 A;  2NS8 A;  4DZP A;  1Z77 A;  1H88 C;  1RPW A;  1Y1V J;  3QPL A;  4JX4 A;  1LFB A;  1LE8 B;  3SJM A;  1ETX A;  1X58 A;  3W6V A;  3G1M A;  1GV2 A;  1ENH A;  3BR5 A;  3OSG A;  4NDL A;  4A3E J;  3HBL A;  3HOW J;  4LOC A;  1GV5 A;  1WGX A;  1ZGW A;  2JA8 J;  2M9H A;  4D7M A;  3A01 B;  5F0H A;  1TWH J;  2R0Q C;  4XID A;  5FKM A;  2DA6 A;  1UMQ A;  2CUE A;  1I3Q J;  4QTR A;  2MSY A;  3CCY A;  2R92 J;  3HOZ J;  2LP0 A;  2Y9Y A;  1P7J A;  2NVX J;  4QSH A;  3G1O A;  1TWA J;  4M6V A;  2DA4 A;  1JJ8 C;  2MGQ A;  5IP6 A;  2LKX A;  2L0K A;  2FJ1 A;  4A3M J;  2JN6 A;  3S16 J;  3B6A A;  4UUS A;  1UHS A;  2MW8 A;  1ITY A;  1BW5 A;  5M5W J;  3MVP A;  2DMT A;  3F0C A;  4AUX A;  5E3O A;  4HNV A;  1POG A;  2XGE A;  2VUM J;  2XB5 A;  2H1K A;  2X6O A;  5J1U A;  4MFD A;  1ETO A;  1IUF A;  1ETY A;  5F08 A;  2EH3 A;  3BG9 A;  2KT0 A;  4M3E A;  4C3H J;  4A3F J;  1JKQ C;  2YUS A;  3ZQH A;  3JRA A;  2MG4 A;  5IPA A;  2E2J J;  2K9S A;  2E2I J;  2EZK A;  2XPW A;  3HDD A;  3S1R J;  3BTI A;  2JMW A;  2NOG A;  1FJL A;  1XS9 A;  2L7M P;  2FQ4 A;  1JKO C;  3HB9 A;  4FCY A;  5EF6 A;  2DA5 A;  5FKK A;  1U9N A;  1A5J A;  1F43 A;  3TED A;  1QVU A;  3GTM J;  2ID3 A;  2LK2 A;  2K9N A;  4D5F A;  3HOX J;  3JRI A;  2K40 A;  1OCT C;  1B72 A;  2JA6 J;  1Q1V A;  3ZQC A;  1B72 B;  1MBJ A;  3JRD A;  3E7L A;  2EQR A;  3PO3 J;  3A01 A;  3M3Y J;  1ZKG A;  1I50 J;  3B6C A;  3VPR A;  3FKI J;  1IG7 A;  4M3F A;  5DS9 A;  2HYJ A;  1BJZ A;  1LE8 A;  5F0F A;  5DTD A;  3JRB A;  1R9T J;  2RAE A;  1ZTR A;  3IH3 A;  4S0H B;  1MH3 A;  1JUS A;  1VI0 A;  3HGG A;  2R93 J;  3S1M J;  1F36 A;  4B3A A;  1RR7 A;  1G2H A;  3MKL A;  4GFB A;  1BL0 A;  4CYC A;  2X9D A;  3FIW A;  3TW6 A;  2TRT A;  2OF7 A;  4A3D J;  5EG0 B;  1IJW C;  5M5X J;  1PUF A;  1GDT A;  5F27 A;  2M34 A;  2R5Z A;  2VKE A;  2CQQ A;  2OPT A;  2WAQ N;  1HDP A;  2E1O A;  2G0E A;  2ECB A;  3PM1 A;  1OJL A;  5JLX A;  5IOY A;  5FJ8 J;  2Y31 A;  3DCF A;  3Q3S A;  5IOZ A;  4CYC B;  3Q0U A;  2ZB9 A;  3OSF A;  5EG0 A;  2L7Z A;  1HF0 A;  3JRC A;  1PUF B;  3SDG A;  3JR9 A;  3FK6 A;  3LNQ A;  3LSR A;  1GT0 C;  2XSD C;  3O8H A;  2PMZ N;  5F0C A;  2IEK A;  3S15 J;  1ETQ A;  1D5Y A;  4A69 C;  2NVQ J;  1WCM J;  3GTQ J;  3RZO J;  2ME6 A;  3HKZ N;  2DMQ A;  5EGO A;  4IHX A;  2QF7 A;  5EGO B;  5FKO A;  3JRH A;  2XPV A;  3FIS A;  5EZG A;  1IDY A;  4MIM A;  4DW6 A;  1GVD A;  5M5Y J;  3Q0V A;  3NAR A;  3GTL J;  1LFU P;  3BR6 A;  3RQI A;  4MLO A;  5IP7 J;  2DA1 A;  2W48 A;  3BTJ A;  1TWG J;  2DA3 A;  3BG5 A;  3BTC A;  1ZR4 A;  2NVY J;  1U8B A;  4XIC A;  3HGY A;  3JRG A;  1HLV A;  2DTZ A;  1MBF A;  1VND A;  1K61 A;  3TP0 A;  2X48 A;  2M2E A;  4A3B J;  3TP3 A;  1UG2 A;  2O8K A;  3QPS A;  4FE4 A;  1QRY A;  2KDZ A;  3ZQL A;  3IH4 A;  4B1R A;  3M4O J;  1XG1 A;  3BT9 A;  2JA7 J;  1WH7 A;  2CJJ A;  2M8G X;  4JX5 A;  4M3B A;  2WB1 N;  4BY1 J;  4C3J J;  3G1L A;  4RDU A;  1SFO J;  5EYR A;  1JT0 A;  2H8R A;  4JP0 A;  3FK7 A;  3HOV J;  1IGN A;  3O8G A;  5E3M A;  5BNG A;  3LOC A;  1RKT A;  3L1P A;  2HQ5 A;  2R5Y A;  1DU6 A;  2DMP A;  4Y52 J;  4IEJ A;  1AKH B;  3S2H J;  2L7F P;  4L5E A;  2E2H J;  4V2F A;  3GTP J;  1VF9 A;  1IV6 A;  4XRM A;  4EEF G;  5C4X J;  5F1J A;  4C3I J;  1B8I A;  2XGC A;  4A3K J;  3S1Q J;  4DZJ A;  1WH5 A;  3PO2 J;  3WHB A;  1W0T A;  2NVT J;  4FIS A;  3A03 A;  1O4X A;  3GTK J;  1BW6 A;  2VKV A;  3ZOB A;  2B63 J;  3TW7 A;  5C4J J;  5EEA A;  1JUM A;  4MO7 A;  1NK3 P;  4IHV A;  2FX0 A;  2M0C A;  4XRS G;  3I4M J;  4BKX A;  3RZD J;  3MN2 A;  1WI3 A;  4Y7N J;  4XK4 A;  2DA2 A;  2XRL A;  5J1Y A;  2IBD A;  3LSP A;  1U78 A;  2DN0 A;  1FEX A;  1ZQ3 P;  2IAI A;  4I6Z A;  1X2M A;  2XB0 X;  3ZQF A;  4J19 A;  2QCO A;  4RBO A;  3S2D J;  5FLV A;  1ETK A;  2HOA A;  4XRS A;  3OIO A;  2HXO A;  3GTJ J;  4V2G A;  1A6I A;  2CRG A;  1HDD C;  1XC5 A;  4I76 A;  1I6H J;  1EF4 A;  1ORK A;  2DMU A;  2Y30 A;  2FD5 A;  1YRN A;  1T56 A;  3S17 J;  5E3L A;  5IYB J;  2XGD A;  5GPC A;  3K7A J;  3HM5 A;  2AHQ A;  2R7Z J;  1MBH A;  5K7Z A;  4A3G J;  1MH4 A;  4X1E A;  1MBE A;  2GM4 A;  1JJ6 C;  5IYC J;  4BXX J;  3C2B A;  2EZL A;  4FE7 A;  4M3G A;  1E3O C;  5C3E J;  4A93 J;  2Y0S N;  3CQZ J;  3GBG A;  3HOY J;  1AU7 A;  3BR2 A;  1B8I B;  3QQA A;  3LSJ A;  3K2A A;  5J3L A;  5J1R A;  1OCP A;  1JGG A;  5F04 A;  5IP9 J;  1IC8 A;  1ETV A;  5IYD J;  2JK3 A;  1JT6 A;  1AKH A;  3S1N J;  4D5C A;  2EBI A;  4C2M J;  4W97 A;  5HOD A;  1JTY A;  1TWC J;  1SAN A;  3UKG A;  4X6A J;  4AC0 A;  5M3M J;  2GBY A;  1MBK A;  3DEW A;  3BQY A;  1U9O A;  3ZQI A;  4JYK A;  4DYC A;  2D5V A;  3BG3 A;  2LD5 A;  3BQZ A;  3CMY A;  1ZK8 A;  4G12 A;  1ETW A;  3OOU A;  1RES A;  1MBG A;  1H8A C;  3NAU A;  1NK2 P;  2ID6 A;  4BBS J;  5FKL A;  1MNM C;  2VI6 A;  3SFI A;  2AO9 A;  2HOT A;  3I4N J;  2HXI A;  4IHY A;  2I10 A;  1IDZ A;  4ABZ A;  5K7H A;  2GLO A;  2E19 A;  1HCR A;  4A3J J;  1NTC A;  3JRF A;  5GP9 A;  2JA5 J;  3IH2 A;  3H3V K;  3CDL A;  4DYR A;  5M3F J;  3H0G J;  1FTT A;  1P7I A;  1FIP A;  1X2N A;  2L9R A;  3BR1 A;  1JUP A;  1WPK A;  2HOS A;  2YU9 J;  2JWT A;  1Y1W J;  2CQX A;  3LSG A;  2R5Z B;  4A3C J;  4MFE A;  1ZR2 A;  4QIW N;  2NS7 A;  2P81 A;  4M3D A;  2K9Q A;  5FLM J;  1IRZ A;  2LTP A;  1H89 C;  1JKR C;  2ELK A;  3BTL A;  2N8G A;  1JTX A;  2Y9Z A;  3Q0W A;  2LY9 A;  1S7E A;  4UUT A;  2DJN A;  4AYB N;  1APL C;  3RKQ A;  2LLK A;  2CUF A;  2LFB A;  4D7N A;  1TC3 C;  1HOM A;  2WV1 A;  4W1U A;  1T33 A;  2Y2Z A;  4FTH A;  2HDD A;  3GTO J;  2DMN A;  3HOU J;  3ZQG A;  4A3L J;  4IHW A;  1W0U A;  2EZH A;  2JJ7 A;  1QVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...