3S1RK

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1rK00
4A3EC 3GTMK 2A68A 3S15C 4Y7NK 2NVQC 4GZYA 2WB1D 1TWGK 4MEXA 3RZDK 2E2JK 3PO2K 2PA8L 2JA6C 3GTPK 4QJVA 3S1QC 3HOUK 4MQ9A 2R93C 2PA8D 3GTJK 3GTMC 4BY1K 2PMZL 4Y7NC 3I4NK 3S16K 1Y1VK 4AYBD 1TWHK 2PMZD 1IW7A 1TWGC 3CQZK 2A69A 4G7HA 2NVXK 2E2JC 3PO2C 4BBSC 3GTPC 2BE5A 3H0GK 5IYDK 1TWFK 3GTJC 4BY1C 4A3EK 4XSXA 1Y1VC 4OINA 3S16C 5TMCA 1TWHC 3HOXK 3S15K 3CQZC 2NVXC 3S1RK 4LLGA 1HQMA 2VUMK 4MEYA 3S14K 4A3MK 3H0GC 1K83K 5IYDC 1TWFC 3S1QK 3HKZL 4LJZA 4A93C 4QIWL 4KN4A 3GTKC 4KMUA 4OIOA 5M5YK 3HOXC 4ZH4A 4C2MK 4QIWD 5IYBK 3S1RC 2PPBA 2VUMC 3S1NK 2CW0A 1YNJA 3S14C 4Y52K 4A3MC 3HOWK 1K83C 4BBSK 5D4DA 4A3JK 4C3IK 1R9TC 2E2IK 3GTGC 1SFOK 1BDFA 2A6EA 5IYBC 4BXXK 3S1NC 5TMFA 4OIQA 4Y52C 2B63K 3HOWC 3WODA 4A3JC 2YU9K 3M4OK 4QJVB 4Q5SA 5FLMK 2E2IC 4JK1A 3HOYK 1SFOC 2E2HC 4A93K 1I6HK 3GTKK 1TWCK 3PO3C 4BXXC 3S1MK 2B63C 3H3VL 4YFNA 5M3MK 2YU9C 3M4OC 3H3VD 1XPPA 5FLMC 3DXJA 3S2DC 3HOYC 5IP7K 1R9TK 1WCMK 4Q4ZA 1I6HC 2Y0SL 1TWCC 3GTGK 3I4MC 3HKZD 4YG2A 3S1MC 3HOZC 1I3QK 4G7OA 3M3YK 1Y1WK 3S2HC 4BY7K 4XLNA 3K7AK 4LK1A 4A3GK 3HOVK 5IP7C 1WCMC 4A3IK 3GTOK 1YNNA 5C4XK 2E2HK 3PO3K 1I3QC 4X6AK 3M3YC 4OIPA 1Y1WC 4BY7C 3RZOK 3K7AC 4A3KK 5IYCK 4OIRA 4A3GC 4A3FC 3HOVC 3GTQK 2R7ZC 4LK0A 4A3IC 3GTOC 3S2DK 5C4XC 3S17K 1I6VA 1TWAK 3FKIK 3I4MK 4X6AC 3HOZK 4NOIA 3RZOC 4A3CK 4A3KC 2WB1L 5IYCC 3S2HK 4YFXA 4A3DC 2O5JA 3GTQC 3EQLA 4BBRK 2JA7K 2NVTK 4A3LK 4A3BC 5C4JK 5M5WK 3S17C 1TWAC 3FKIC 5IP9K 4YFKA 4G7ZA 2NVYC 2JA8K 2Y0SD 4AYBL 4A3CC 2R92K 5M5XK 2JA5K 5C3EK 4BBRC 2JA7C 3GTLK 2NVTC 2WAQL 4A3FK 3RZDC 1I50K 5C4JC 4C3HK 5M3FK 2R7ZK 4A3LC 5IP9C 2JA8C 2WAQD 4C3JK 5FJ8K 3HOUC 4XLPA 2A6HA 5C44K 2R92C 3I4NC 2JA5C 5C3EC 3GTLC 4KN7A 2NVQK 4A3DK 4XSZA 1I50C 4A3BK 2O5IA 1ZYRA 1SMYA 2JA6K 2NVYK 2R93K 5C44C
chains in the Genus database with same CATH superfamily
2KWAA 4A3EC 1XZQA 3GTMK 2WB1D 1TWGK 5IOQA 4MEXA 3GTJA 2R92A 4QJVA 4MQ9A 1G51A 1AB4A 3GTJK 3CQZA 3GTMC 4BY1K 3AQPA 3SZZA 3LAJA 3GDZA 1TWGC 3CQZK 3GTJC 4BY1C 2W7VA 1IL2A 1RU0A 4OINA 3CQZC 3S1RK 2V6SA 3S14K 3CAGA 3AD8C 3GTKC 3TTGA 3S1RC 3ADAC 3S14C 3LPXA 2NVXA 1HI9A 1XZQB 1TWFA 4G0VA 5CJ9A 3M4OK 4QJVB 3G4CA 4JK1A 2GSNA 4KC6A 4A93K 1TWCK 4YFNA 3M4OC 1WOPA 3S2DC 1WCMK 2Y0SL 4DDQA 1TWCC 3HKZD 4YG2A 3HOZC 2V6UA 3IPJA 1J6XA 1IE0A 3S2HC 1WSRA 4LK1A 4A3GK 3A8IA 1WCMC 3GTOK 2B63A 3OREA 4LQYA 4KB2A 3PO3K 2YU9A 1PJ7A 4OIPA 4OIRA 2ZUEA 4A3GC 1V5VA 3GTOC 3FKIK 1JQWA 4A3CK 1DCPA 3OPFA 1Y1WA 3FKIC 4G7ZA 3GEHA 2NVYC 4A3CC 2V6TA 1J6VA 5EGHA 2R7ZA 1J98A 1WQFA 4M1XA 2WAQL 3RZDC 2R7ZK 2WAQD 3T01A 4C3JK 4KM8A 2Y3PA 5C44K 1IS1A 1BS2A 3AD7C 1O25A 4A3BK 2JA6K 1YCLA 1O2AA 2R93K 5C44C 2JA7A 3TFHA 3S15C 4Y7NK 3GSIA 1EK8A 4KM9A 1KQ4A 4BLAA 4G0UA 3PO2K 3MMLB 2JA6C 1EI6A 2XCOA 3S1QC 3HOUK 1WIHA 2JA5A 2R93C 2XCRB 3GTLA 4GTAA 1EQRA 4Y7NC 3I4NK 4C2MC 1Y1VK 4AYBD 1O2FB 4KAWX 4BBSC 3PO2C 3N3YA 1BGWA 1VRQC 1XXAA 2RH6A 5L46A 4A3EK 1Y1VC 2ZUFA 3HOXK 1VLOA 4A3MK 3GTMA 1WOSA 3GEEA 4QIWL 4PABA 4KMUA 4BLBA 3HOXC 4QIWD 3S1NK 3BP8C 1YNJA 4A3MC 1SFOA 5D4DA 1B4AA 3GTGC 1SFOK 2GAHC 4BXXK 3S1NC 4OIQA 4GTDA 3WODA 3GTKA 4Q5SA 4O2DA 3TFJA 1SFOC 2E2HC 1I6HK 3GTKK 4BXXC 2P5MA 1F7VA 1F7UA 1F93A 3DXJA 1O2BA 5IP7K 1I6HC 1XXBA 4XCHA 4XLNA 4FZBA 4FM9A 2RGRA 1VJEA 5IP7C 3GEIA 3RZOK 4A3KK 5IYCK 1TWCA 1TWAA 4A3FC 2FQTA 3GTQK 3S2DK 3S17K 1TWAK 3HOZK 3RZOC 4A3KC 1WCMA 5IYCC 1O29A 4GTLA 4YFXA 3S2HK 4A3DC 2O5JA 3GTQC 4BBRK 3OEPA 5C4JK 1ZVUA 3S17C 1TWAC 4GFQA 2Y0SD 3GTOA 5C3EK 4BBRC 1I50K 5C4JC 4C3HK 5M3FK 5C3EC 3FKIA 3BP3A 1I50C 2NVYA 3V4GA 4C3HC 3QX3A 2NVYK 3NUHA 3RZDK 1EFWA 4P5AA 4GT9A 2PMZL 3H0GA 1TWHK 2PMZD 2A69A 4G7HA 5IOTA 1JVIA 1X31C 2BE5A 3H0GK 4C3IC 3LAPA 3FOFA 4LOWA 1O28A 5TMCA 1TWHC 1K83A 3S15K 2JA6A 1HQMA 2R93A 4BKWA 4PAAA 3H0GC 1K83K 5E68A 3S1QK 4ILDA 4LJZA 3T00A 4KN4A 1DCHA 4OIOA 5M5YK 4C2MK 5IYBK 1J6WA 2D6FC 4BBSK 1K83C 4A3JK 1Y1VA 1R9TC 2E2IK 3T02A 1EH1A 5IYBC 5TMFA 3A8KA 4GTBA 4A3JC 2GSOA 5FLMK 2E2IC 4WJ3M 3L4KA 3S1MK 3N0CA 5M3MK 3GTGA 1XPPA 5FLMC 1B4BA 4Q4ZA 4GTFA 3GTGK 3I4MC 3S1MC 1WQHA 1I3QK 3M3YK 2E2HA 1ISEA 4A3IK 1YNNA 4KB4A 2E2HK 3FOEA 1I3QC 3M3YC 1L0WA 4WJ4A 4C45A 1PJ6A 4LK0A 4LR2A 5JVOA 4A3IC 1I6VA 4NOIA 1XXCA 2WB1L 1F9NA 2CFAA 5HL8A 5IP9K 4YFKA 2JA8K 5EGEA 2R92K 2PHCB 3AH5A 5M5XK 1C0AA 3TFIA 4A3FK 4J3NA 5IP9C 2JA8C 4KDDA 5FJ8K 2A6HA 3GIRA 3GTQA 2ZFZA 2R92C 1XZPA 2NVQK 4A3DK 2O5IA 4P5BA 2EBBA 2A68A 1GE9A 2NVQC 3GTPA 4GZYA 3N0BA 2E2JK 2PA8L 3GTPK 1VGXA 2PA8D 1I50A 5JFEA 3S16K 2CFAB 4KMHA 1IW7A 2NVXK 2E2JC 3AD9C 3GTPC 5IOSA 1USMA 5IYDK 1TWFK 2VUMA 4GTEA 4XSXA 3S16C 3BUEA 2NVXC 4LLGA 2VUMK 4MEYA 1PJ5A 5IYDC 1TWFC 3HKZL 4A93C 1XZPB 4ZH4A 3ERED 1ZXOA 2PPBA 2VUMC 2CW0A 1WORA 4Y52K 3HOWK 1WOOA 1VH2A 4C3IK 1TWHA 1BDFA 2A6EA 3S0XA 3JSTA 4Y52C 5TJ3A 2B63K 4KMAA 3HOWC 2YU9K 2GAGC 3HOYK 4KARA 3PO3C 1DD5A 2B63C 3H3VL 2XCQA 1R9TA 2YU9C 3AQOA 4RMFA 3H3VD 3HOYC 4P9SA 1R9TK 1YX2A 4WILA 2FQOA 4KMDA 4G7OA 1IBAA 2P8TA 4KATA 1Y1WK 2E2IA 4BY7K 2JH3A 3K7AK 1WQGA 3HOVK 5CHPA 5C4XK 4AH6A 4X6AK 1Y1WC 4BY7C 1DCOA 3K7AC 1WSVA 1INNA 3HOVC 5IORA 2R7ZC 5C4XC 4C3JC 1O27A 3A8JA 3I4MK 4X6AC 2GSUA 1JOEA 3FHZA 3EQLA 2JA7K 2NVTK 4A3LK 4A3BC 1I3QA 3HXAA 5M5WK 3L4JA 1UV7A 1USOA 1ZQ1C 3Q3QA 4AYBL 4KASA 2JA5K 3GTLK 1O26A 2JA7C 3VA7A 4GTCA 2NVTC 4A3LC 3G4AA 3SZYA 3HOUC 1BJTA 1O24A 4XLPA 3I4NC 2JA5C 3GTLC 4KN7A 4XSZA 1ZBSA 4G0WA 1ZYRA 1SMYA 1IQ0A 1TWGA
chains in the Genus database with same CATH topology
4A3EC 3GTMK 2A68A 3S15C 4Y7NK 2NVQC 4GZYA 2WB1D 1TWGK 4MEXA 3RZDK 2E2JK 3PO2K 2PA8L 2JA6C 3GTPK 4QJVA 3S1QC 3HOUK 4MQ9A 2R93C 2PA8D 3GTJK 3GTMC 4BY1K 2PMZL 4Y7NC 3I4NK 3S16K 1Y1VK 4AYBD 1TWHK 2PMZD 1IW7A 1TWGC 3CQZK 2A69A 4G7HA 2NVXK 2E2JC 3PO2C 4BBSC 3GTPC 2BE5A 3H0GK 5IYDK 1TWFK 3GTJC 4BY1C 4A3EK 4XSXA 1Y1VC 4OINA 3S16C 5TMCA 1TWHC 3HOXK 3S15K 3CQZC 2NVXC 3S1RK 4LLGA 1HQMA 2VUMK 4MEYA 3S14K 4A3MK 3H0GC 1K83K 5IYDC 1TWFC 3S1QK 3HKZL 4LJZA 4A93C 4QIWL 4KN4A 3GTKC 4KMUA 4OIOA 5M5YK 3HOXC 4ZH4A 4C2MK 4QIWD 5IYBK 3S1RC 2PPBA 2VUMC 3S1NK 2CW0A 1YNJA 3S14C 4Y52K 4A3MC 3HOWK 1K83C 4BBSK 5D4DA 4A3JK 4C3IK 1R9TC 2E2IK 3GTGC 1SFOK 1BDFA 2A6EA 5IYBC 4BXXK 3S1NC 5TMFA 4OIQA 4Y52C 2B63K 3HOWC 3WODA 4A3JC 2YU9K 3M4OK 4QJVB 4Q5SA 5FLMK 2E2IC 4JK1A 3HOYK 1SFOC 2E2HC 4A93K 1I6HK 3GTKK 1TWCK 3PO3C 4BXXC 3S1MK 2B63C 3H3VL 4YFNA 5M3MK 2YU9C 3M4OC 3H3VD 1XPPA 5FLMC 3DXJA 3S2DC 3HOYC 5IP7K 1R9TK 1WCMK 4Q4ZA 1I6HC 2Y0SL 1TWCC 3GTGK 3I4MC 3HKZD 4YG2A 3S1MC 3HOZC 1I3QK 4G7OA 3M3YK 1Y1WK 3S2HC 4BY7K 4XLNA 3K7AK 4LK1A 4A3GK 3HOVK 5IP7C 1WCMC 4A3IK 3GTOK 1YNNA 5C4XK 2E2HK 3PO3K 1I3QC 4X6AK 3M3YC 4OIPA 1Y1WC 4BY7C 3RZOK 3K7AC 4A3KK 5IYCK 4OIRA 4A3GC 4A3FC 3HOVC 3GTQK 2R7ZC 4LK0A 4A3IC 3GTOC 3S2DK 5C4XC 3S17K 1I6VA 1TWAK 3FKIK 3I4MK 4X6AC 3HOZK 4NOIA 3RZOC 4A3CK 4A3KC 2WB1L 5IYCC 3S2HK 4YFXA 4A3DC 2O5JA 3GTQC 3EQLA 4BBRK 2JA7K 2NVTK 4A3LK 4A3BC 5C4JK 5M5WK 3S17C 1TWAC 3FKIC 5IP9K 4YFKA 4G7ZA 2NVYC 2JA8K 2Y0SD 4AYBL 4A3CC 2R92K 5M5XK 2JA5K 5C3EK 4BBRC 2JA7C 3GTLK 2NVTC 2WAQL 4A3FK 3RZDC 1I50K 5C4JC 4C3HK 5M3FK 2R7ZK 4A3LC 5IP9C 2JA8C 2WAQD 4C3JK 5FJ8K 3HOUC 4XLPA 2A6HA 5C44K 2R92C 3I4NC 2JA5C 5C3EC 3GTLC 4KN7A 2NVQK 4A3DK 4XSZA 1I50C 4A3BK 2O5IA 1ZYRA 1SMYA 2JA6K 2NVYK 2R93K 5C44C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E C;  3GTM K;  2A68 A;  3S15 C;  4Y7N K;  2NVQ C;  4GZY A;  2WB1 D;  1TWG K;  4MEX A;  3RZD K;  2E2J K;  3PO2 K;  2PA8 L;  2JA6 C;  3GTP K;  4QJV A;  3S1Q C;  3HOU K;  4MQ9 A;  2R93 C;  2PA8 D;  3GTJ K;  3GTM C;  4BY1 K;  2PMZ L;  4Y7N C;  3I4N K;  3S16 K;  1Y1V K;  4AYB D;  1TWH K;  2PMZ D;  1IW7 A;  1TWG C;  3CQZ K;  2A69 A;  4G7H A;  2NVX K;  2E2J C;  3PO2 C;  4BBS C;  3GTP C;  2BE5 A;  3H0G K;  5IYD K;  1TWF K;  3GTJ C;  4BY1 C;  4A3E K;  4XSX A;  1Y1V C;  4OIN A;  3S16 C;  5TMC A;  1TWH C;  3HOX K;  3S15 K;  3CQZ C;  2NVX C;  3S1R K;  4LLG A;  1HQM A;  2VUM K;  4MEY A;  3S14 K;  4A3M K;  3H0G C;  1K83 K;  5IYD C;  1TWF C;  3S1Q K;  3HKZ L;  4LJZ A;  4A93 C;  4QIW L;  4KN4 A;  3GTK C;  4KMU A;  4OIO A;  5M5Y K;  3HOX C;  4ZH4 A;  4C2M K;  4QIW D;  5IYB K;  3S1R C;  2PPB A;  2VUM C;  3S1N K;  2CW0 A;  1YNJ A;  3S14 C;  4Y52 K;  4A3M C;  3HOW K;  1K83 C;  4BBS K;  5D4D A;  4A3J K;  4C3I K;  1R9T C;  2E2I K;  3GTG C;  1SFO K;  1BDF A;  2A6E A;  5IYB C;  4BXX K;  3S1N C;  5TMF A;  4OIQ A;  4Y52 C;  2B63 K;  3HOW C;  3WOD A;  4A3J C;  2YU9 K;  3M4O K;  4QJV B;  4Q5S A;  5FLM K;  2E2I C;  4JK1 A;  3HOY K;  1SFO C;  2E2H C;  4A93 K;  1I6H K;  3GTK K;  1TWC K;  3PO3 C;  4BXX C;  3S1M K;  2B63 C;  3H3V L;  4YFN A;  5M3M K;  2YU9 C;  3M4O C;  3H3V D;  1XPP A;  5FLM C;  3DXJ A;  3S2D C;  3HOY C;  5IP7 K;  1R9T K;  1WCM K;  4Q4Z A;  1I6H C;  2Y0S L;  1TWC C;  3GTG K;  3I4M C;  3HKZ D;  4YG2 A;  3S1M C;  3HOZ C;  1I3Q K;  4G7O A;  3M3Y K;  1Y1W K;  3S2H C;  4BY7 K;  4XLN A;  3K7A K;  4LK1 A;  4A3G K;  3HOV K;  5IP7 C;  1WCM C;  4A3I K;  3GTO K;  1YNN A;  5C4X K;  2E2H K;  3PO3 K;  1I3Q C;  4X6A K;  3M3Y C;  4OIP A;  1Y1W C;  4BY7 C;  3RZO K;  3K7A C;  4A3K K;  5IYC K;  4OIR A;  4A3G C;  4A3F C;  3HOV C;  3GTQ K;  2R7Z C;  4LK0 A;  4A3I C;  3GTO C;  3S2D K;  5C4X C;  3S17 K;  1I6V A;  1TWA K;  3FKI K;  3I4M K;  4X6A C;  3HOZ K;  4NOI A;  3RZO C;  4A3C K;  4A3K C;  2WB1 L;  5IYC C;  3S2H K;  4YFX A;  4A3D C;  2O5J A;  3GTQ C;  3EQL A;  4BBR K;  2JA7 K;  2NVT K;  4A3L K;  4A3B C;  5C4J K;  5M5W K;  3S17 C;  1TWA C;  3FKI C;  5IP9 K;  4YFK A;  4G7Z A;  2NVY C;  2JA8 K;  2Y0S D;  4AYB L;  4A3C C;  2R92 K;  5M5X K;  2JA5 K;  5C3E K;  4BBR C;  2JA7 C;  3GTL K;  2NVT C;  2WAQ L;  4A3F K;  3RZD C;  1I50 K;  5C4J C;  4C3H K;  5M3F K;  2R7Z K;  4A3L C;  5IP9 C;  2JA8 C;  2WAQ D;  4C3J K;  5FJ8 K;  3HOU C;  4XLP A;  2A6H A;  5C44 K;  2R92 C;  3I4N C;  2JA5 C;  5C3E C;  3GTL C;  4KN7 A;  2NVQ K;  4A3D K;  4XSZ A;  1I50 C;  4A3B K;  2O5I A;  1ZYR A;  1SMY A;  2JA6 K;  2NVY K;  2R93 K;  5C44 C; 
#chains in the Genus database with same CATH topology
 2KWA A;  4A3E C;  1XZQ A;  3GTM K;  2WB1 D;  1TWG K;  5IOQ A;  4MEX A;  3GTJ A;  2R92 A;  4QJV A;  4MQ9 A;  1G51 A;  1AB4 A;  3GTJ K;  3CQZ A;  3GTM C;  4BY1 K;  3AQP A;  3SZZ A;  3LAJ A;  3GDZ A;  1TWG C;  3CQZ K;  3GTJ C;  4BY1 C;  2W7V A;  1IL2 A;  1RU0 A;  4OIN A;  3CQZ C;  3S1R K;  2V6S A;  3S14 K;  3CAG A;  3AD8 C;  3GTK C;  3TTG A;  3S1R C;  3ADA C;  3S14 C;  3LPX A;  2NVX A;  1HI9 A;  1XZQ B;  1TWF A;  4G0V A;  5CJ9 A;  3M4O K;  4QJV B;  3G4C A;  4JK1 A;  2GSN A;  4KC6 A;  4A93 K;  1TWC K;  4YFN A;  3M4O C;  1WOP A;  3S2D C;  1WCM K;  2Y0S L;  4DDQ A;  1TWC C;  3HKZ D;  4YG2 A;  3HOZ C;  2V6U A;  3IPJ A;  1J6X A;  1IE0 A;  3S2H C;  1WSR A;  4LK1 A;  4A3G K;  3A8I A;  1WCM C;  3GTO K;  2B63 A;  3ORE A;  4LQY A;  4KB2 A;  3PO3 K;  2YU9 A;  1PJ7 A;  4OIP A;  4OIR A;  2ZUE A;  4A3G C;  1V5V A;  3GTO C;  3FKI K;  1JQW A;  4A3C K;  1DCP A;  3OPF A;  1Y1W A;  3FKI C;  4G7Z A;  3GEH A;  2NVY C;  4A3C C;  2V6T A;  1J6V A;  5EGH A;  2R7Z A;  1J98 A;  1WQF A;  4M1X A;  2WAQ L;  3RZD C;  2R7Z K;  2WAQ D;  3T01 A;  4C3J K;  4KM8 A;  2Y3P A;  5C44 K;  1IS1 A;  1BS2 A;  3AD7 C;  1O25 A;  4A3B K;  2JA6 K;  1YCL A;  1O2A A;  2R93 K;  5C44 C;  2JA7 A;  3TFH A;  3S15 C;  4Y7N K;  3GSI A;  1EK8 A;  4KM9 A;  1KQ4 A;  4BLA A;  4G0U A;  3PO2 K;  3MML B;  2JA6 C;  1EI6 A;  2XCO A;  3S1Q C;  3HOU K;  1WIH A;  2JA5 A;  2R93 C;  2XCR B;  3GTL A;  4GTA A;  1EQR A;  4Y7N C;  3I4N K;  4C2M C;  1Y1V K;  4AYB D;  1O2F B;  4KAW X;  4BBS C;  3PO2 C;  3N3Y A;  1BGW A;  1VRQ C;  1XXA A;  2RH6 A;  5L46 A;  4A3E K;  1Y1V C;  2ZUF A;  3HOX K;  1VLO A;  4A3M K;  3GTM A;  1WOS A;  3GEE A;  4QIW L;  4PAB A;  4KMU A;  4BLB A;  3HOX C;  4QIW D;  3S1N K;  3BP8 C;  1YNJ A;  4A3M C;  1SFO A;  5D4D A;  1B4A A;  3GTG C;  1SFO K;  2GAH C;  4BXX K;  3S1N C;  4OIQ A;  4GTD A;  3WOD A;  3GTK A;  4Q5S A;  4O2D A;  3TFJ A;  1SFO C;  2E2H C;  1I6H K;  3GTK K;  4BXX C;  2P5M A;  1F7V A;  1F7U A;  1F93 A;  3DXJ A;  1O2B A;  5IP7 K;  1I6H C;  1XXB A;  4XCH A;  4XLN A;  4FZB A;  4FM9 A;  2RGR A;  1VJE A;  5IP7 C;  3GEI A;  3RZO K;  4A3K K;  5IYC K;  1TWC A;  1TWA A;  4A3F C;  2FQT A;  3GTQ K;  3S2D K;  3S17 K;  1TWA K;  3HOZ K;  3RZO C;  4A3K C;  1WCM A;  5IYC C;  1O29 A;  4GTL A;  4YFX A;  3S2H K;  4A3D C;  2O5J A;  3GTQ C;  4BBR K;  3OEP A;  5C4J K;  1ZVU A;  3S17 C;  1TWA C;  4GFQ A;  2Y0S D;  3GTO A;  5C3E K;  4BBR C;  1I50 K;  5C4J C;  4C3H K;  5M3F K;  5C3E C;  3FKI A;  3BP3 A;  1I50 C;  2NVY A;  3V4G A;  4C3H C;  3QX3 A;  2NVY K;  3NUH A;  3RZD K;  1EFW A;  4P5A A;  4GT9 A;  2PMZ L;  3H0G A;  1TWH K;  2PMZ D;  2A69 A;  4G7H A;  5IOT A;  1JVI A;  1X31 C;  2BE5 A;  3H0G K;  4C3I C;  3LAP A;  3FOF A;  4LOW A;  1O28 A;  5TMC A;  1TWH C;  1K83 A;  3S15 K;  2JA6 A;  1HQM A;  2R93 A;  4BKW A;  4PAA A;  3H0G C;  1K83 K;  5E68 A;  3S1Q K;  4ILD A;  4LJZ A;  3T00 A;  4KN4 A;  1DCH A;  4OIO A;  5M5Y K;  4C2M K;  5IYB K;  1J6W A;  2D6F C;  4BBS K;  1K83 C;  4A3J K;  1Y1V A;  1R9T C;  2E2I K;  3T02 A;  1EH1 A;  5IYB C;  5TMF A;  3A8K A;  4GTB A;  4A3J C;  2GSO A;  5FLM K;  2E2I C;  4WJ3 M;  3L4K A;  3S1M K;  3N0C A;  5M3M K;  3GTG A;  1XPP A;  5FLM C;  1B4B A;  4Q4Z A;  4GTF A;  3GTG K;  3I4M C;  3S1M C;  1WQH A;  1I3Q K;  3M3Y K;  2E2H A;  1ISE A;  4A3I K;  1YNN A;  4KB4 A;  2E2H K;  3FOE A;  1I3Q C;  3M3Y C;  1L0W A;  4WJ4 A;  4C45 A;  1PJ6 A;  4LK0 A;  4LR2 A;  5JVO A;  4A3I C;  1I6V A;  4NOI A;  1XXC A;  2WB1 L;  1F9N A;  2CFA A;  5HL8 A;  5IP9 K;  4YFK A;  2JA8 K;  5EGE A;  2R92 K;  2PHC B;  3AH5 A;  5M5X K;  1C0A A;  3TFI A;  4A3F K;  4J3N A;  5IP9 C;  2JA8 C;  4KDD A;  5FJ8 K;  2A6H A;  3GIR A;  3GTQ A;  2ZFZ A;  2R92 C;  1XZP A;  2NVQ K;  4A3D K;  2O5I A;  4P5B A;  2EBB A;  2A68 A;  1GE9 A;  2NVQ C;  3GTP A;  4GZY A;  3N0B A;  2E2J K;  2PA8 L;  3GTP K;  1VGX A;  2PA8 D;  1I50 A;  5JFE A;  3S16 K;  2CFA B;  4KMH A;  1IW7 A;  2NVX K;  2E2J C;  3AD9 C;  3GTP C;  5IOS A;  1USM A;  5IYD K;  1TWF K;  2VUM A;  4GTE A;  4XSX A;  3S16 C;  3BUE A;  2NVX C;  4LLG A;  2VUM K;  4MEY A;  1PJ5 A;  5IYD C;  1TWF C;  3HKZ L;  4A93 C;  1XZP B;  4ZH4 A;  3ERE D;  1ZXO A;  2PPB A;  2VUM C;  2CW0 A;  1WOR A;  4Y52 K;  3HOW K;  1WOO A;  1VH2 A;  4C3I K;  1TWH A;  1BDF A;  2A6E A;  3S0X A;  3JST A;  4Y52 C;  5TJ3 A;  2B63 K;  4KMA A;  3HOW C;  2YU9 K;  2GAG C;  3HOY K;  4KAR A;  3PO3 C;  1DD5 A;  2B63 C;  3H3V L;  2XCQ A;  1R9T A;  2YU9 C;  3AQO A;  4RMF A;  3H3V D;  3HOY C;  4P9S A;  1R9T K;  1YX2 A;  4WIL A;  2FQO A;  4KMD A;  4G7O A;  1IBA A;  2P8T A;  4KAT A;  1Y1W K;  2E2I A;  4BY7 K;  2JH3 A;  3K7A K;  1WQG A;  3HOV K;  5CHP A;  5C4X K;  4AH6 A;  4X6A K;  1Y1W C;  4BY7 C;  1DCO A;  3K7A C;  1WSV A;  1INN A;  3HOV C;  5IOR A;  2R7Z C;  5C4X C;  4C3J C;  1O27 A;  3A8J A;  3I4M K;  4X6A C;  2GSU A;  1JOE A;  3FHZ A;  3EQL A;  2JA7 K;  2NVT K;  4A3L K;  4A3B C;  1I3Q A;  3HXA A;  5M5W K;  3L4J A;  1UV7 A;  1USO A;  1ZQ1 C;  3Q3Q A;  4AYB L;  4KAS A;  2JA5 K;  3GTL K;  1O26 A;  2JA7 C;  3VA7 A;  4GTC A;  2NVT C;  4A3L C;  3G4A A;  3SZY A;  3HOU C;  1BJT A;  1O24 A;  4XLP A;  3I4N C;  2JA5 C;  3GTL C;  4KN7 A;  4XSZ A;  1ZBS A;  4G0W A;  1ZYR A;  1SMY A;  1IQ0 A;  1TWG A; 
#chains in the Genus database with same CATH homology
 4A3E C;  3GTM K;  2A68 A;  3S15 C;  4Y7N K;  2NVQ C;  4GZY A;  2WB1 D;  1TWG K;  4MEX A;  3RZD K;  2E2J K;  3PO2 K;  2PA8 L;  2JA6 C;  3GTP K;  4QJV A;  3S1Q C;  3HOU K;  4MQ9 A;  2R93 C;  2PA8 D;  3GTJ K;  3GTM C;  4BY1 K;  2PMZ L;  4Y7N C;  3I4N K;  3S16 K;  1Y1V K;  4AYB D;  1TWH K;  2PMZ D;  1IW7 A;  1TWG C;  3CQZ K;  2A69 A;  4G7H A;  2NVX K;  2E2J C;  3PO2 C;  4BBS C;  3GTP C;  2BE5 A;  3H0G K;  5IYD K;  1TWF K;  3GTJ C;  4BY1 C;  4A3E K;  4XSX A;  1Y1V C;  4OIN A;  3S16 C;  5TMC A;  1TWH C;  3HOX K;  3S15 K;  3CQZ C;  2NVX C;  3S1R K;  4LLG A;  1HQM A;  2VUM K;  4MEY A;  3S14 K;  4A3M K;  3H0G C;  1K83 K;  5IYD C;  1TWF C;  3S1Q K;  3HKZ L;  4LJZ A;  4A93 C;  4QIW L;  4KN4 A;  3GTK C;  4KMU A;  4OIO A;  5M5Y K;  3HOX C;  4ZH4 A;  4C2M K;  4QIW D;  5IYB K;  3S1R C;  2PPB A;  2VUM C;  3S1N K;  2CW0 A;  1YNJ A;  3S14 C;  4Y52 K;  4A3M C;  3HOW K;  1K83 C;  4BBS K;  5D4D A;  4A3J K;  4C3I K;  1R9T C;  2E2I K;  3GTG C;  1SFO K;  1BDF A;  2A6E A;  5IYB C;  4BXX K;  3S1N C;  5TMF A;  4OIQ A;  4Y52 C;  2B63 K;  3HOW C;  3WOD A;  4A3J C;  2YU9 K;  3M4O K;  4QJV B;  4Q5S A;  5FLM K;  2E2I C;  4JK1 A;  3HOY K;  1SFO C;  2E2H C;  4A93 K;  1I6H K;  3GTK K;  1TWC K;  3PO3 C;  4BXX C;  3S1M K;  2B63 C;  3H3V L;  4YFN A;  5M3M K;  2YU9 C;  3M4O C;  3H3V D;  1XPP A;  5FLM C;  3DXJ A;  3S2D C;  3HOY C;  5IP7 K;  1R9T K;  1WCM K;  4Q4Z A;  1I6H C;  2Y0S L;  1TWC C;  3GTG K;  3I4M C;  3HKZ D;  4YG2 A;  3S1M C;  3HOZ C;  1I3Q K;  4G7O A;  3M3Y K;  1Y1W K;  3S2H C;  4BY7 K;  4XLN A;  3K7A K;  4LK1 A;  4A3G K;  3HOV K;  5IP7 C;  1WCM C;  4A3I K;  3GTO K;  1YNN A;  5C4X K;  2E2H K;  3PO3 K;  1I3Q C;  4X6A K;  3M3Y C;  4OIP A;  1Y1W C;  4BY7 C;  3RZO K;  3K7A C;  4A3K K;  5IYC K;  4OIR A;  4A3G C;  4A3F C;  3HOV C;  3GTQ K;  2R7Z C;  4LK0 A;  4A3I C;  3GTO C;  3S2D K;  5C4X C;  3S17 K;  1I6V A;  1TWA K;  3FKI K;  3I4M K;  4X6A C;  3HOZ K;  4NOI A;  3RZO C;  4A3C K;  4A3K C;  2WB1 L;  5IYC C;  3S2H K;  4YFX A;  4A3D C;  2O5J A;  3GTQ C;  3EQL A;  4BBR K;  2JA7 K;  2NVT K;  4A3L K;  4A3B C;  5C4J K;  5M5W K;  3S17 C;  1TWA C;  3FKI C;  5IP9 K;  4YFK A;  4G7Z A;  2NVY C;  2JA8 K;  2Y0S D;  4AYB L;  4A3C C;  2R92 K;  5M5X K;  2JA5 K;  5C3E K;  4BBR C;  2JA7 C;  3GTL K;  2NVT C;  2WAQ L;  4A3F K;  3RZD C;  1I50 K;  5C4J C;  4C3H K;  5M3F K;  2R7Z K;  4A3L C;  5IP9 C;  2JA8 C;  2WAQ D;  4C3J K;  5FJ8 K;  3HOU C;  4XLP A;  2A6H A;  5C44 K;  2R92 C;  3I4N C;  2JA5 C;  5C3E C;  3GTL C;  4KN7 A;  2NVQ K;  4A3D K;  4XSZ A;  1I50 C;  4A3B K;  2O5I A;  1ZYR A;  1SMY A;  2JA6 K;  2NVY K;  2R93 K;  5C44 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...