3S1RK

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1rK00
4BBRC 4A3KK 4GZYA 3M4OK 4C3JK 3K7AC 4Y7NK 3S14C 3M3YC 4ZH4A 3FKIK 1WCMC 5C4JC 2E2JC 3I4NC 2JA7C 4A3JK 3K7AK 4G7HA 4A3LC 4A3IC 4A3DK 4A3FC 2B63C 5D4DA 3S2HK 4BBSC 4A3MK 3I4NK 3S16C 3HOYK 3GTJK 2YU9K 4AYBL 5C4JK 4LK1A 3RZDC 4X6AK 1TWGC 5IYBK 2A68A 4C3IK 2A6EA 1R9TC 3GTLC 3S17C 1Y1VK 2Y0SD 2VUMK 2R7ZK 3H0GK 4QJVB 2WAQL 4YFXA 3HOWC 4Q4ZA 3H0GC 3DXJA 3HKZD 3GTPC 3HOXC 3GTGC 3S1NC 1I3QK 5IP7C 4A93C 2R93C 1WCMK 2WB1D 5IYBC 4G7OA 4XSZA 4XLNA 1I50C 2PMZL 2CW0A 4Y7NC 3GTMK 3S14K 3M3YK 3GTOC 4YFNA 1HQMA 1BDFA 3S2HC 4BBSK 1YNNA 2NVTK 2R92K 5C3EC 5M5YK 4OINA 3GTJC 3GTQC 4OIPA 4JK1A 2NVXK 2E2HC 3S15K 1Y1WC 4C3HK 5C44C 1TWHK 4NOIA 4C2MK 4A3EK 1SFOK 3GTLK 3GTOK 3HOZC 3S17K 3HKZL 3I4MC 5C44K 4YG2A 5IYCC 4BY1C 3HOUK 4A3KC 3PO2C 4A3CC 2VUMC 4BY7K 2E2IC 2JA8C 3S1RK 2JA6C 3I4MK 3CQZK 4KMUA 1SMYA 2NVTC 1SFOC 3GTPK 4QIWD 3HOVC 3S2DK 4BXXC 1TWGK 5M3MK 3H3VD 3PO3C 2NVYK 4A3MC 4A3BK 3PO2K 4MQ9A 4A3FK 4AYBD 2B63K 2NVQC 2PA8L 5TMFA 3RZOC 2JA5K 2Y0SL 3GTKC 3GTMC 4BY1K 3HOUC 4BY7C 4X6AC 4MEYA 4BBRK 4XSXA 1IW7A 2WAQD 5M5XK 4BXXK 2NVQK 4OIQA 1K83K 4Y52K 2JA7K 1I6HK 2NVYC 3HOWK 3H3VL 4YFKA 4Q5SA 4LLGA 1K83C 4A3GK 1I6VA 3S16K 1I6HC 3S1NK 1I50K 2PA8D 2E2HK 2E2IK 2JA6K 4LJZA 4A3DC 1R9TK 2R93K 5IYDC 5FLMC 3WODA 4G7ZA 4MEXA 5TMCA 1XPPA 3HOYC 3GTQK 4QJVA 5IP9C 4A3GC 2A6HA 3S1QK 4KN7A 4LK0A 4A3JC 2JA8K 3RZOK 2NVXC 1TWFC 5C4XC 5IYDK 2O5JA 2O5IA 3GTGK 3S1MC 1TWCC 3S2DC 1I3QC 4A93K 2PPBA 2YU9C 5IP9K 2WB1L 1ZYRA 3S1RC 4OIRA 4QIWL 1TWCK 1TWAC 4OIOA 5IYCK 4A3CK 5M3FK 1TWFK 2PMZD 1Y1VC 5C4XK 5IP7K 5M5WK 2JA5C 4Y52C 2R7ZC 3S15C 2R92C 1TWAK 1YNJA 1TWHC 4A3EC 3HOVK 3HOZK 4A3BC 4A3LK 1Y1WK 3PO3K 2A69A 3FKIC 5FLMK 3S1MK 3EQLA 4XLPA 3RZDK 4KN4A 5C3EK 3GTKK 3M4OC 4A3IK 2BE5A 3CQZC 5FJ8K 3HOXK 2E2JK 3S1QC
chains in the Genus database with same CATH superfamily
4A3KK 4Y7NK 2P8TA 3K7AC 2RGRA 3FKIK 1WCMC 3SZZA 4A3DK 3S2HK 3S16C 2YU9K 3RZDC 4LK1A 5JVOA 4X6AK 1TWGC 5IYBK 4P5AA 4C3IK 3S17C 1TWHA 1INNA 3ERED 2R7ZK 1O27A 1DD5A 4QJVB 2WAQL 4Q4ZA 1O26A 2P5MA 2W7VA 4A93C 5IP7C 4M1XA 1ZVUA 4LOWA 4XSZA 1I50C 1XZPA 2PMZL 4C3JC 2ZUFA 1IQ0A 4G0UA 3GTMK 1HQMA 1O2FB 4BBSK 5C3EC 3FOFA 2XCRB 5L46A 2E2HC 2EBBA 5C44C 2GAGC 1TWHK 3GTLK 4C2MK 3I4MC 4GT9A 5C44K 5IYCC 3A8KA 2E2IC 3S1RK 3GIRA 1SFOC 3IPJA 1O29A 4QIWD 4G0VA 4RMFA 1TWGK 5M3MK 3L4JA 1O2BA 4KC6A 4KDDA 3PO2K 4MQ9A 1V5VA 1XXAA 1WQHA 4BY7C 1IW7A 4KMDA 1DCOA 1EQRA 1XZQA 1WOPA 2NVYA 4Q5SA 3TFIA 3AQOA 3S16K 2PA8D 4A3DC 1AB4A 1F9NA 2ZUEA 1L0WA 5TMCA 1XPPA 3LAJA 3GTJA 3HOYC 3GTQK 1J6XA 2A6HA 3QX3A 4GTLA 3T02A 4A3JC 1O25A 1USMA 2NVXC 5C4XC 2R93A 4LR2A 2O5IA 4PABA 1TWCC 1IL2A 3GTGA 4LQYA 2CFAB 4OIRA 1TWCK 2VUMA 3GEEA 4OIOA 3NUHA 1TWFK 2JA5C 1TWAK 4A3LK 3MMLB 3HOZK 1R9TA 4XLPA 3M4OC 3GTQA 5CJ9A 3G4CA 3N0BA 2E2JK 3S1QC 2B63A 3S14C 1C0AA 2JA7A 3M3YC 3I4NC 2JA7C 4A3FC 2B63C 5D4DA 3GTPA 4FZBA 4KB2A 5HL8A 4BBSC 4BKWA 4KATA 3I4NK 4WJ3M 3GTJK 1IS1A 1G51A 1R9TC 2A6EA 3GTLC 2Y0SD 2V6SA 2JA5A 1EK8A 4GTCA 1WSVA 1ZBSA 1EH1A 2GSUA 3HOXC 3GTGC 3S1NC 1I3QK 3AD8C 2R93C 5IYBC 4G7OA 3T01A 1HI9A 3S14K 1VLOA 2ZFZA 4J3NA 3M3YK 4YFNA 4G0WA 3S2HC 1YNNA 4PAAA 2FQOA 3GTJC 2NVXK 3S15K 4C3HK 3AQPA 1O24A 3HOZC 3S17K 4YG2A 4BY1C 3SZYA 2GSNA 1VH2A 3TFJA 1J98A 3GTPK 5IORA 4BXXC 3HOVC 1I3QA 3TFHA 1JVIA 1O28A 1EI6A 4A3MC 1JQWA 5TMFA 2JA5K 1WOSA 3HOUC 1YX2A 4X6AC 1WIHA 4XSXA 2V6TA 4BXXK 3JSTA 2E2IA 3HOWK 1J6VA 4ILDA 4LLGA 1I6VA 1WQFA 3S1NK 2E2IK 5FLMC 3WODA 4MEXA 4P5BA 4QJVA 3N3YA 1B4BA 5IOSA 4KN7A 1USOA 1WOOA 3AH5A 3N0CA 3GTGK 3GSIA 1I3QC 5IP9K 4GTBA 3S1RC 5IYCK 1WQGA 5M5WK 3S15C 4KASA 5IP7K 1ZQ1C 4Y52C 3OEPA 1YNJA 1TWHC 4GTAA 3ADAC 4GTEA 3S1MK 5C3EK 3GTKK 2CFAA 3BP3A 3HOXK 4BBRC 4GZYA 4C3JK 5E68A 2E2JC 3S0XA 4C45A 4GTDA 4WJ4A 3FHZA 3FKIA 2V6UA 1KQ4A 2A68A 3GEHA 1ISEA 3LAPA 3FOEA 1JOEA 4KAWX 3GTLA 2VUMK 1Y1VA 3HOWC 4DDQA 3H0GC 3DXJA 3HKZD 3GTPC 2D6FC 1J6WA 1WCMK 1XZQB 2WB1D 1WORA 4XLNA 4Y7NC 2CW0A 4KM8A 3GTOC 1XXCA 1BDFA 2NVTK 2Y3PA 4C3HC 3BP8C 3GTQC 4BLAA 4OIPA 1F7UA 3A8IA 1PJ5A 3G4AA 4NOIA 1YCLA 1EFWA 3HOUK 4A3CC 3GDZA 4A3KC 3PO2C 2VUMC 2XCOA 1SMYA 3LPXA 2NVTC 5IOTA 1TWCA 1RU0A 3PO3C 2NVXA 4A3BK 1XXBA 1B4AA 3VA7A 3RZOC 1F93A 4BY1K 4BBRK 4XCHA 5M5XK 2NVQK 4OIQA 4BLBA 1O2AA 2JA7K 2JA6A 2NVYC 1WSRA 3CAGA 4YFKA 1BS2A 1K83C 1I6HC 2E2HK 2JA6K 1R9TK 1Y1WA 2R93K 5IYDC 5TJ3A 5IP9C 4A3GC 1IBAA 4LK0A 4WILA 5IOQA 3OPFA 4FM9A 1TWFC 2RH6A 5IYDK 3S1MC 3S2DC 4A93K 2YU9C 1SFOA 1F7VA 2WB1L 4KMHA 1ZYRA 1VGXA 4QIWL 5M3FK 5C4XK 2PMZD 2R7ZC 3V4GA 4A3EC 2FQTA 1Y1WK 1IE0A 2A69A 2E2HA 3HXAA 3RZDK 1PJ7A 5FJ8K 3CQZC 1DCHA 3M4OK 5EGHA 1I50A 3OREA 4O2DA 4ZH4A 5C4JC 3Q3QA 4A3JK 3K7AK 4G7HA 4A3LC 4A3IC 3CQZA 4A3MK 3HOYK 4KMAA 4AYBL 5C4JK 5EGEA 1Y1VK 3A8JA 3H0GK 1TWGA 4YFXA 2R7ZA 4KB4A 1DCPA 2PHCB 2YU9A 4KARA 2GAHC 1WCMA 1TWFA 3BUEA 4GFQA 1X31C 2R92K 5M5YK 4OINA 1BGWA 4JK1A 1Y1WC 3AD9C 4A3EK 1SFOK 3GTOK 2GSOA 3HKZL 2R92A 1K83A 1XZPB 5JFEA 3TTGA 4BY7K 1TWAA 2JA6C 2JA8C 3I4MK 3CQZK 4KMUA 1UV7A 1GE9A 4C2MC 3S2DK 4AH6A 3H3VD 2NVYK 3T00A 4A3FK 4AYBD 2B63K 2NVQC 2PA8L 1VRQC 1BJTA 2Y0SL 3GTKC 3GTMC 4MEYA 2WAQD 1K83K 4Y52K 2JH3A 1I6HK 3H3VL 4A3GK 1I50K 1ZXOA 4LJZA 4C3IC 4G7ZA 3GTMA 3GTKA 5CHPA 3GTOA 3S1QK 4KM9A 2XCQA 1PJ6A 1VJEA 2JA8K 3RZOK 4P9SA 3AD7C 2O5JA 2PPBA 2KWAA 3H0GA 1TWAC 4A3CK 1Y1VC 2R92C 4GTFA 3HOVK 4A3BC 3L4KA 3PO3K 3FKIC 5FLMK 3EQLA 4KN4A 4A3IK 2BE5A 3GEIA
chains in the Genus database with same CATH topology
4BBRC 4A3KK 4GZYA 3M4OK 4C3JK 3K7AC 4Y7NK 3S14C 3M3YC 4ZH4A 3FKIK 1WCMC 5C4JC 2E2JC 3I4NC 2JA7C 4A3JK 3K7AK 4G7HA 4A3LC 4A3IC 4A3DK 4A3FC 2B63C 5D4DA 3S2HK 4BBSC 4A3MK 3I4NK 3S16C 3HOYK 3GTJK 2YU9K 4AYBL 5C4JK 4LK1A 3RZDC 4X6AK 1TWGC 5IYBK 2A68A 4C3IK 2A6EA 1R9TC 3GTLC 3S17C 1Y1VK 2Y0SD 2VUMK 2R7ZK 3H0GK 4QJVB 2WAQL 4YFXA 3HOWC 4Q4ZA 3H0GC 3DXJA 3HKZD 3GTPC 3HOXC 3GTGC 3S1NC 1I3QK 5IP7C 4A93C 2R93C 1WCMK 2WB1D 5IYBC 4G7OA 4XSZA 4XLNA 1I50C 2PMZL 2CW0A 4Y7NC 3GTMK 3S14K 3M3YK 3GTOC 4YFNA 1HQMA 1BDFA 3S2HC 4BBSK 1YNNA 2NVTK 2R92K 5C3EC 5M5YK 4OINA 3GTJC 3GTQC 4OIPA 4JK1A 2NVXK 2E2HC 3S15K 1Y1WC 4C3HK 5C44C 1TWHK 4NOIA 4C2MK 4A3EK 1SFOK 3GTLK 3GTOK 3HOZC 3S17K 3HKZL 3I4MC 5C44K 4YG2A 5IYCC 4BY1C 3HOUK 4A3KC 3PO2C 4A3CC 2VUMC 4BY7K 2E2IC 2JA8C 3S1RK 2JA6C 3I4MK 3CQZK 4KMUA 1SMYA 2NVTC 1SFOC 3GTPK 4QIWD 3HOVC 3S2DK 4BXXC 1TWGK 5M3MK 3H3VD 3PO3C 2NVYK 4A3MC 4A3BK 3PO2K 4MQ9A 4A3FK 4AYBD 2B63K 2NVQC 2PA8L 5TMFA 3RZOC 2JA5K 2Y0SL 3GTKC 3GTMC 4BY1K 3HOUC 4BY7C 4X6AC 4MEYA 4BBRK 4XSXA 1IW7A 2WAQD 5M5XK 4BXXK 2NVQK 4OIQA 1K83K 4Y52K 2JA7K 1I6HK 2NVYC 3HOWK 3H3VL 4YFKA 4Q5SA 4LLGA 1K83C 4A3GK 1I6VA 3S16K 1I6HC 3S1NK 1I50K 2PA8D 2E2HK 2E2IK 2JA6K 4LJZA 4A3DC 1R9TK 2R93K 5IYDC 5FLMC 3WODA 4G7ZA 4MEXA 5TMCA 1XPPA 3HOYC 3GTQK 4QJVA 5IP9C 4A3GC 2A6HA 3S1QK 4KN7A 4LK0A 4A3JC 2JA8K 3RZOK 2NVXC 1TWFC 5C4XC 5IYDK 2O5JA 2O5IA 3GTGK 3S1MC 1TWCC 3S2DC 1I3QC 4A93K 2PPBA 2YU9C 5IP9K 2WB1L 1ZYRA 3S1RC 4OIRA 4QIWL 1TWCK 1TWAC 4OIOA 5IYCK 4A3CK 5M3FK 1TWFK 2PMZD 1Y1VC 5C4XK 5IP7K 5M5WK 2JA5C 4Y52C 2R7ZC 3S15C 2R92C 1TWAK 1YNJA 1TWHC 4A3EC 3HOVK 3HOZK 4A3BC 4A3LK 1Y1WK 3PO3K 2A69A 3FKIC 5FLMK 3S1MK 3EQLA 4XLPA 3RZDK 4KN4A 5C3EK 3GTKK 3M4OC 4A3IK 2BE5A 3CQZC 5FJ8K 3HOXK 2E2JK 3S1QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBR C;  4A3K K;  4GZY A;  3M4O K;  4C3J K;  3K7A C;  4Y7N K;  3S14 C;  3M3Y C;  4ZH4 A;  3FKI K;  1WCM C;  5C4J C;  2E2J C;  3I4N C;  2JA7 C;  4A3J K;  3K7A K;  4G7H A;  4A3L C;  4A3I C;  4A3D K;  4A3F C;  2B63 C;  5D4D A;  3S2H K;  4BBS C;  4A3M K;  3I4N K;  3S16 C;  3HOY K;  3GTJ K;  2YU9 K;  4AYB L;  5C4J K;  4LK1 A;  3RZD C;  4X6A K;  1TWG C;  5IYB K;  2A68 A;  4C3I K;  2A6E A;  1R9T C;  3GTL C;  3S17 C;  1Y1V K;  2Y0S D;  2VUM K;  2R7Z K;  3H0G K;  4QJV B;  2WAQ L;  4YFX A;  3HOW C;  4Q4Z A;  3H0G C;  3DXJ A;  3HKZ D;  3GTP C;  3HOX C;  3GTG C;  3S1N C;  1I3Q K;  5IP7 C;  4A93 C;  2R93 C;  1WCM K;  2WB1 D;  5IYB C;  4G7O A;  4XSZ A;  4XLN A;  1I50 C;  2PMZ L;  2CW0 A;  4Y7N C;  3GTM K;  3S14 K;  3M3Y K;  3GTO C;  4YFN A;  1HQM A;  1BDF A;  3S2H C;  4BBS K;  1YNN A;  2NVT K;  2R92 K;  5C3E C;  5M5Y K;  4OIN A;  3GTJ C;  3GTQ C;  4OIP A;  4JK1 A;  2NVX K;  2E2H C;  3S15 K;  1Y1W C;  4C3H K;  5C44 C;  1TWH K;  4NOI A;  4C2M K;  4A3E K;  1SFO K;  3GTL K;  3GTO K;  3HOZ C;  3S17 K;  3HKZ L;  3I4M C;  5C44 K;  4YG2 A;  5IYC C;  4BY1 C;  3HOU K;  4A3K C;  3PO2 C;  4A3C C;  2VUM C;  4BY7 K;  2E2I C;  2JA8 C;  3S1R K;  2JA6 C;  3I4M K;  3CQZ K;  4KMU A;  1SMY A;  2NVT C;  1SFO C;  3GTP K;  4QIW D;  3HOV C;  3S2D K;  4BXX C;  1TWG K;  5M3M K;  3H3V D;  3PO3 C;  2NVY K;  4A3M C;  4A3B K;  3PO2 K;  4MQ9 A;  4A3F K;  4AYB D;  2B63 K;  2NVQ C;  2PA8 L;  5TMF A;  3RZO C;  2JA5 K;  2Y0S L;  3GTK C;  3GTM C;  4BY1 K;  3HOU C;  4BY7 C;  4X6A C;  4MEY A;  4BBR K;  4XSX A;  1IW7 A;  2WAQ D;  5M5X K;  4BXX K;  2NVQ K;  4OIQ A;  1K83 K;  4Y52 K;  2JA7 K;  1I6H K;  2NVY C;  3HOW K;  3H3V L;  4YFK A;  4Q5S A;  4LLG A;  1K83 C;  4A3G K;  1I6V A;  3S16 K;  1I6H C;  3S1N K;  1I50 K;  2PA8 D;  2E2H K;  2E2I K;  2JA6 K;  4LJZ A;  4A3D C;  1R9T K;  2R93 K;  5IYD C;  5FLM C;  3WOD A;  4G7Z A;  4MEX A;  5TMC A;  1XPP A;  3HOY C;  3GTQ K;  4QJV A;  5IP9 C;  4A3G C;  2A6H A;  3S1Q K;  4KN7 A;  4LK0 A;  4A3J C;  2JA8 K;  3RZO K;  2NVX C;  1TWF C;  5C4X C;  5IYD K;  2O5J A;  2O5I A;  3GTG K;  3S1M C;  1TWC C;  3S2D C;  1I3Q C;  4A93 K;  2PPB A;  2YU9 C;  5IP9 K;  2WB1 L;  1ZYR A;  3S1R C;  4OIR A;  4QIW L;  1TWC K;  1TWA C;  4OIO A;  5IYC K;  4A3C K;  5M3F K;  1TWF K;  2PMZ D;  1Y1V C;  5C4X K;  5IP7 K;  5M5W K;  2JA5 C;  4Y52 C;  2R7Z C;  3S15 C;  2R92 C;  1TWA K;  1YNJ A;  1TWH C;  4A3E C;  3HOV K;  3HOZ K;  4A3B C;  4A3L K;  1Y1W K;  3PO3 K;  2A69 A;  3FKI C;  5FLM K;  3S1M K;  3EQL A;  4XLP A;  3RZD K;  4KN4 A;  5C3E K;  3GTK K;  3M4O C;  4A3I K;  2BE5 A;  3CQZ C;  5FJ8 K;  3HOX K;  2E2J K;  3S1Q C; 
#chains in the Genus database with same CATH topology
 4A3K K;  4Y7N K;  2P8T A;  3K7A C;  2RGR A;  3FKI K;  1WCM C;  3SZZ A;  4A3D K;  3S2H K;  3S16 C;  2YU9 K;  3RZD C;  4LK1 A;  5JVO A;  4X6A K;  1TWG C;  5IYB K;  4P5A A;  4C3I K;  3S17 C;  1TWH A;  1INN A;  3ERE D;  2R7Z K;  1O27 A;  1DD5 A;  4QJV B;  2WAQ L;  4Q4Z A;  1O26 A;  2P5M A;  2W7V A;  4A93 C;  5IP7 C;  4M1X A;  1ZVU A;  4LOW A;  4XSZ A;  1I50 C;  1XZP A;  2PMZ L;  4C3J C;  2ZUF A;  1IQ0 A;  4G0U A;  3GTM K;  1HQM A;  1O2F B;  4BBS K;  5C3E C;  3FOF A;  2XCR B;  5L46 A;  2E2H C;  2EBB A;  5C44 C;  2GAG C;  1TWH K;  3GTL K;  4C2M K;  3I4M C;  4GT9 A;  5C44 K;  5IYC C;  3A8K A;  2E2I C;  3S1R K;  3GIR A;  1SFO C;  3IPJ A;  1O29 A;  4QIW D;  4G0V A;  4RMF A;  1TWG K;  5M3M K;  3L4J A;  1O2B A;  4KC6 A;  4KDD A;  3PO2 K;  4MQ9 A;  1V5V A;  1XXA A;  1WQH A;  4BY7 C;  1IW7 A;  4KMD A;  1DCO A;  1EQR A;  1XZQ A;  1WOP A;  2NVY A;  4Q5S A;  3TFI A;  3AQO A;  3S16 K;  2PA8 D;  4A3D C;  1AB4 A;  1F9N A;  2ZUE A;  1L0W A;  5TMC A;  1XPP A;  3LAJ A;  3GTJ A;  3HOY C;  3GTQ K;  1J6X A;  2A6H A;  3QX3 A;  4GTL A;  3T02 A;  4A3J C;  1O25 A;  1USM A;  2NVX C;  5C4X C;  2R93 A;  4LR2 A;  2O5I A;  4PAB A;  1TWC C;  1IL2 A;  3GTG A;  4LQY A;  2CFA B;  4OIR A;  1TWC K;  2VUM A;  3GEE A;  4OIO A;  3NUH A;  1TWF K;  2JA5 C;  1TWA K;  4A3L K;  3MML B;  3HOZ K;  1R9T A;  4XLP A;  3M4O C;  3GTQ A;  5CJ9 A;  3G4C A;  3N0B A;  2E2J K;  3S1Q C;  2B63 A;  3S14 C;  1C0A A;  2JA7 A;  3M3Y C;  3I4N C;  2JA7 C;  4A3F C;  2B63 C;  5D4D A;  3GTP A;  4FZB A;  4KB2 A;  5HL8 A;  4BBS C;  4BKW A;  4KAT A;  3I4N K;  4WJ3 M;  3GTJ K;  1IS1 A;  1G51 A;  1R9T C;  2A6E A;  3GTL C;  2Y0S D;  2V6S A;  2JA5 A;  1EK8 A;  4GTC A;  1WSV A;  1ZBS A;  1EH1 A;  2GSU A;  3HOX C;  3GTG C;  3S1N C;  1I3Q K;  3AD8 C;  2R93 C;  5IYB C;  4G7O A;  3T01 A;  1HI9 A;  3S14 K;  1VLO A;  2ZFZ A;  4J3N A;  3M3Y K;  4YFN A;  4G0W A;  3S2H C;  1YNN A;  4PAA A;  2FQO A;  3GTJ C;  2NVX K;  3S15 K;  4C3H K;  3AQP A;  1O24 A;  3HOZ C;  3S17 K;  4YG2 A;  4BY1 C;  3SZY A;  2GSN A;  1VH2 A;  3TFJ A;  1J98 A;  3GTP K;  5IOR A;  4BXX C;  3HOV C;  1I3Q A;  3TFH A;  1JVI A;  1O28 A;  1EI6 A;  4A3M C;  1JQW A;  5TMF A;  2JA5 K;  1WOS A;  3HOU C;  1YX2 A;  4X6A C;  1WIH A;  4XSX A;  2V6T A;  4BXX K;  3JST A;  2E2I A;  3HOW K;  1J6V A;  4ILD A;  4LLG A;  1I6V A;  1WQF A;  3S1N K;  2E2I K;  5FLM C;  3WOD A;  4MEX A;  4P5B A;  4QJV A;  3N3Y A;  1B4B A;  5IOS A;  4KN7 A;  1USO A;  1WOO A;  3AH5 A;  3N0C A;  3GTG K;  3GSI A;  1I3Q C;  5IP9 K;  4GTB A;  3S1R C;  5IYC K;  1WQG A;  5M5W K;  3S15 C;  4KAS A;  5IP7 K;  1ZQ1 C;  4Y52 C;  3OEP A;  1YNJ A;  1TWH C;  4GTA A;  3ADA C;  4GTE A;  3S1M K;  5C3E K;  3GTK K;  2CFA A;  3BP3 A;  3HOX K;  4BBR C;  4GZY A;  4C3J K;  5E68 A;  2E2J C;  3S0X A;  4C45 A;  4GTD A;  4WJ4 A;  3FHZ A;  3FKI A;  2V6U A;  1KQ4 A;  2A68 A;  3GEH A;  1ISE A;  3LAP A;  3FOE A;  1JOE A;  4KAW X;  3GTL A;  2VUM K;  1Y1V A;  3HOW C;  4DDQ A;  3H0G C;  3DXJ A;  3HKZ D;  3GTP C;  2D6F C;  1J6W A;  1WCM K;  1XZQ B;  2WB1 D;  1WOR A;  4XLN A;  4Y7N C;  2CW0 A;  4KM8 A;  3GTO C;  1XXC A;  1BDF A;  2NVT K;  2Y3P A;  4C3H C;  3BP8 C;  3GTQ C;  4BLA A;  4OIP A;  1F7U A;  3A8I A;  1PJ5 A;  3G4A A;  4NOI A;  1YCL A;  1EFW A;  3HOU K;  4A3C C;  3GDZ A;  4A3K C;  3PO2 C;  2VUM C;  2XCO A;  1SMY A;  3LPX A;  2NVT C;  5IOT A;  1TWC A;  1RU0 A;  3PO3 C;  2NVX A;  4A3B K;  1XXB A;  1B4A A;  3VA7 A;  3RZO C;  1F93 A;  4BY1 K;  4BBR K;  4XCH A;  5M5X K;  2NVQ K;  4OIQ A;  4BLB A;  1O2A A;  2JA7 K;  2JA6 A;  2NVY C;  1WSR A;  3CAG A;  4YFK A;  1BS2 A;  1K83 C;  1I6H C;  2E2H K;  2JA6 K;  1R9T K;  1Y1W A;  2R93 K;  5IYD C;  5TJ3 A;  5IP9 C;  4A3G C;  1IBA A;  4LK0 A;  4WIL A;  5IOQ A;  3OPF A;  4FM9 A;  1TWF C;  2RH6 A;  5IYD K;  3S1M C;  3S2D C;  4A93 K;  2YU9 C;  1SFO A;  1F7V A;  2WB1 L;  4KMH A;  1ZYR A;  1VGX A;  4QIW L;  5M3F K;  5C4X K;  2PMZ D;  2R7Z C;  3V4G A;  4A3E C;  2FQT A;  1Y1W K;  1IE0 A;  2A69 A;  2E2H A;  3HXA A;  3RZD K;  1PJ7 A;  5FJ8 K;  3CQZ C;  1DCH A;  3M4O K;  5EGH A;  1I50 A;  3ORE A;  4O2D A;  4ZH4 A;  5C4J C;  3Q3Q A;  4A3J K;  3K7A K;  4G7H A;  4A3L C;  4A3I C;  3CQZ A;  4A3M K;  3HOY K;  4KMA A;  4AYB L;  5C4J K;  5EGE A;  1Y1V K;  3A8J A;  3H0G K;  1TWG A;  4YFX A;  2R7Z A;  4KB4 A;  1DCP A;  2PHC B;  2YU9 A;  4KAR A;  2GAH C;  1WCM A;  1TWF A;  3BUE A;  4GFQ A;  1X31 C;  2R92 K;  5M5Y K;  4OIN A;  1BGW A;  4JK1 A;  1Y1W C;  3AD9 C;  4A3E K;  1SFO K;  3GTO K;  2GSO A;  3HKZ L;  2R92 A;  1K83 A;  1XZP B;  5JFE A;  3TTG A;  4BY7 K;  1TWA A;  2JA6 C;  2JA8 C;  3I4M K;  3CQZ K;  4KMU A;  1UV7 A;  1GE9 A;  4C2M C;  3S2D K;  4AH6 A;  3H3V D;  2NVY K;  3T00 A;  4A3F K;  4AYB D;  2B63 K;  2NVQ C;  2PA8 L;  1VRQ C;  1BJT A;  2Y0S L;  3GTK C;  3GTM C;  4MEY A;  2WAQ D;  1K83 K;  4Y52 K;  2JH3 A;  1I6H K;  3H3V L;  4A3G K;  1I50 K;  1ZXO A;  4LJZ A;  4C3I C;  4G7Z A;  3GTM A;  3GTK A;  5CHP A;  3GTO A;  3S1Q K;  4KM9 A;  2XCQ A;  1PJ6 A;  1VJE A;  2JA8 K;  3RZO K;  4P9S A;  3AD7 C;  2O5J A;  2PPB A;  2KWA A;  3H0G A;  1TWA C;  4A3C K;  1Y1V C;  2R92 C;  4GTF A;  3HOV K;  4A3B C;  3L4K A;  3PO3 K;  3FKI C;  5FLM K;  3EQL A;  4KN4 A;  4A3I K;  2BE5 A;  3GEI A; 
#chains in the Genus database with same CATH homology
 4BBR C;  4A3K K;  4GZY A;  3M4O K;  4C3J K;  3K7A C;  4Y7N K;  3S14 C;  3M3Y C;  4ZH4 A;  3FKI K;  1WCM C;  5C4J C;  2E2J C;  3I4N C;  2JA7 C;  4A3J K;  3K7A K;  4G7H A;  4A3L C;  4A3I C;  4A3D K;  4A3F C;  2B63 C;  5D4D A;  3S2H K;  4BBS C;  4A3M K;  3I4N K;  3S16 C;  3HOY K;  3GTJ K;  2YU9 K;  4AYB L;  5C4J K;  4LK1 A;  3RZD C;  4X6A K;  1TWG C;  5IYB K;  2A68 A;  4C3I K;  2A6E A;  1R9T C;  3GTL C;  3S17 C;  1Y1V K;  2Y0S D;  2VUM K;  2R7Z K;  3H0G K;  4QJV B;  2WAQ L;  4YFX A;  3HOW C;  4Q4Z A;  3H0G C;  3DXJ A;  3HKZ D;  3GTP C;  3HOX C;  3GTG C;  3S1N C;  1I3Q K;  5IP7 C;  4A93 C;  2R93 C;  1WCM K;  2WB1 D;  5IYB C;  4G7O A;  4XSZ A;  4XLN A;  1I50 C;  2PMZ L;  2CW0 A;  4Y7N C;  3GTM K;  3S14 K;  3M3Y K;  3GTO C;  4YFN A;  1HQM A;  1BDF A;  3S2H C;  4BBS K;  1YNN A;  2NVT K;  2R92 K;  5C3E C;  5M5Y K;  4OIN A;  3GTJ C;  3GTQ C;  4OIP A;  4JK1 A;  2NVX K;  2E2H C;  3S15 K;  1Y1W C;  4C3H K;  5C44 C;  1TWH K;  4NOI A;  4C2M K;  4A3E K;  1SFO K;  3GTL K;  3GTO K;  3HOZ C;  3S17 K;  3HKZ L;  3I4M C;  5C44 K;  4YG2 A;  5IYC C;  4BY1 C;  3HOU K;  4A3K C;  3PO2 C;  4A3C C;  2VUM C;  4BY7 K;  2E2I C;  2JA8 C;  3S1R K;  2JA6 C;  3I4M K;  3CQZ K;  4KMU A;  1SMY A;  2NVT C;  1SFO C;  3GTP K;  4QIW D;  3HOV C;  3S2D K;  4BXX C;  1TWG K;  5M3M K;  3H3V D;  3PO3 C;  2NVY K;  4A3M C;  4A3B K;  3PO2 K;  4MQ9 A;  4A3F K;  4AYB D;  2B63 K;  2NVQ C;  2PA8 L;  5TMF A;  3RZO C;  2JA5 K;  2Y0S L;  3GTK C;  3GTM C;  4BY1 K;  3HOU C;  4BY7 C;  4X6A C;  4MEY A;  4BBR K;  4XSX A;  1IW7 A;  2WAQ D;  5M5X K;  4BXX K;  2NVQ K;  4OIQ A;  1K83 K;  4Y52 K;  2JA7 K;  1I6H K;  2NVY C;  3HOW K;  3H3V L;  4YFK A;  4Q5S A;  4LLG A;  1K83 C;  4A3G K;  1I6V A;  3S16 K;  1I6H C;  3S1N K;  1I50 K;  2PA8 D;  2E2H K;  2E2I K;  2JA6 K;  4LJZ A;  4A3D C;  1R9T K;  2R93 K;  5IYD C;  5FLM C;  3WOD A;  4G7Z A;  4MEX A;  5TMC A;  1XPP A;  3HOY C;  3GTQ K;  4QJV A;  5IP9 C;  4A3G C;  2A6H A;  3S1Q K;  4KN7 A;  4LK0 A;  4A3J C;  2JA8 K;  3RZO K;  2NVX C;  1TWF C;  5C4X C;  5IYD K;  2O5J A;  2O5I A;  3GTG K;  3S1M C;  1TWC C;  3S2D C;  1I3Q C;  4A93 K;  2PPB A;  2YU9 C;  5IP9 K;  2WB1 L;  1ZYR A;  3S1R C;  4OIR A;  4QIW L;  1TWC K;  1TWA C;  4OIO A;  5IYC K;  4A3C K;  5M3F K;  1TWF K;  2PMZ D;  1Y1V C;  5C4X K;  5IP7 K;  5M5W K;  2JA5 C;  4Y52 C;  2R7Z C;  3S15 C;  2R92 C;  1TWA K;  1YNJ A;  1TWH C;  4A3E C;  3HOV K;  3HOZ K;  4A3B C;  4A3L K;  1Y1W K;  3PO3 K;  2A69 A;  3FKI C;  5FLM K;  3S1M K;  3EQL A;  4XLP A;  3RZD K;  4KN4 A;  5C3E K;  3GTK K;  3M4O C;  4A3I K;  2BE5 A;  3CQZ C;  5FJ8 K;  3HOX K;  2E2J K;  3S1Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...