3S1RK

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1rK00
3M3YK 5C3EC 1TWAC 4G7HA 4BY1K 2WAQL 3M4OK 3HOUK 5C4JK 3HOYK 5FLMC 4BXXK 4AYBL 3K7AC 2BE5A 3S2DK 1TWCC 2R7ZC 3S1MK 1TWHC 1TWCK 3GTKC 3S14C 3CQZC 4A3LC 2A69A 4A3KC 4Q4ZA 5D4DA 1TWHK 3GTKK 4YFNA 2JA6C 3HKZL 4A3EK 4Y52C 2PA8L 3GTGC 1K83C 3HOWC 4OIQA 2YU9C 2R93K 1K83K 3S17K 1I3QK 3H3VD 3GTJK 3HOXK 2R92C 4C3HK 3H0GK 4C3JK 5IP7K 5M3FK 4JK1A 5C4XK 4LK0A 1I6HK 5TMCA 3GTPK 4OIOA 1TWGK 3RZDK 4OINA 4LLGA 2VUMK 4BBRC 4Y7NC 5C44C 3S1RC 3HOZC 3RZOC 3I4NC 5M5XK 1WCMC 5TMFA 5C3EK 5C44K 3S1RK 1TWAK 3S2HK 4KMUA 4BBSC 2Y0SD 4A3CC 2PMZD 5M3MK 5FLMK 4XLPA 2NVQC 3K7AK 4MEYA 3GTMC 2JA5C 4A3BC 3H3VL 3PO3C 4A3DC 2R7ZK 4A3BK 3S14K 3CQZK 4A3LK 1Y1VC 4A3KK 3GTOC 3FKIC 4A3JC 4QJVB 1TWFC 1Y1VK 2JA6K 4XSZA 1Y1WC 4Y52K 1YNNA 4A3JK 4LJZA 3GTGK 3HOWK 2A68A 4A3GC 1Y1WK 2YU9K 5IYBC 4KN7A 3GTLC 2R92K 1BDFA 2Y0SL 2NVYC 2PMZL 5IYDC 4XLNA 5IYCC 4A3IC 3GTLK 1I50C 2NVYK 4Q5SA 5IYDK 3S15C 5IYCK 1YNJA 4KN4A 4A3FC 2A6HA 3GTQC 4A3FK 2NVXC 4X6AC 4BBRK 4Y7NK 3RZOK 3HOZK 3I4NK 4A3MC 2E2HC 4BBSK 1WCMK 3S16C 4A3CK 3S1QC 1IW7A 3S17C 2JA7C 4A3MK 3S1NC 2JA8C 2NVQK 3HOVC 4ZH4A 3GTMK 1R9TC 2JA5K 2NVTC 3PO3K 3S2HC 1SFOC 3PO2C 4A93C 2E2JC 4GZYA 4A3DK 4OIPA 4NOIA 4YFXA 1XPPA 3I4MC 5FJ8K 3GTOK 3FKIK 4QIWD 2B63C 2CW0A 1TWFK 1ZYRA 2WB1D 4BY7C 2E2IC 3M3YC 4A3GK 3DXJA 4BY1C 3M4OC 4C3IK 2E2IK 2O5JA 3HOUC 5IYBK 5C4JC 3HOYC 4BXXC 4YFKA 3S2DC 4MQ9A 4A3IK 1I50K 3S1MC 3S15K 5M5YK 1SMYA 4MEXA 2PPBA 4LK1A 3GTQK 4A3EC 2NVXK 4X6AK 4QIWL 2WAQD 2E2HK 4G7OA 5M5WK 3S16K 2WB1L 5IP9C 4AYBD 3RZDC 3S1QK 2JA7K 3S1NK 2R93C 2JA8K 1I3QC 4XSXA 5IP9K 1I6VA 3GTJC 1HQMA 3HOXC 4G7ZA 3HOVK 1R9TK 2NVTK 4QJVA 3H0GC 4YG2A 1SFOK 3WODA 5IP7C 2E2JK 4OIRA 3PO2K 4A93K 5C4XC 3HKZD 1I6HC 3GTPC 2O5IA 3I4MK 2B63K 2PA8D 1TWGC 2A6EA 3EQLA 2VUMC 4C2MK 4BY7K
chains in the Genus database with same CATH superfamily
3FOFA 3M3YK 5C3EC 1TWAC 2NVXA 2BE5A 2W7VA 4GTDA 1TWCC 3S2DK 1TWCK 3GTKC 3CQZC 3GTKK 4YFNA 3T00A 2GSNA 4FZBA 3GTPA 3OREA 4KC6A 3HOXK 3S0XA 4KM9A 4C3JK 5IP7K 3NUHA 3A8IA 1WOOA 1WOPA 5E68A 1C0AA 1TWGK 3RZDK 4BBRC 3S1RC 1WQHA 1XZQB 1TWCA 3I4NC 4KATA 5M5XK 1WCMC 5TMFA 3S1RK 3GTKA 1DCHA 4WJ3M 3GTMC 4A3BC 2JA5C 4KARA 5L46A 3PO3C 1VRQC 4A3BK 4A3LK 1Y1VC 4KMAA 2XCQA 4QJVB 1TWFC 1Y1VK 1YNNA 3GTGK 2V6UA 1IE0A 1TWGA 2P5MA 5IYBC 3MMLB 4KN7A 1F7UA 2PMZL 5IYCC 5IOSA 5IYCK 1B4AA 1XXBA 1BGWA 1XXCA 3BP3A 4X6AC 4Y7NK 1WOSA 3TFIA 4KB4A 4A3CK 1ZQ1C 1EFWA 1Y1VA 2NVQK 3HOVC 3GTGA 4G0UA 1J6XA 3S2HC 4A3DK 3PO2C 2E2JC 1O2AA 4GTCA 2FQTA 4OIPA 3I4MC 3GTOK 2B63C 2CW0A 1DCOA 2E2IC 4KMHA 4BY1C 2O5JA 4C3IK 1F7VA 2E2IK 4BXXC 4MQ9A 4A3IK 1I50K 1EH1A 4G0WA 5M5YK 1WQFA 4KAWX 4P5BA 5IOTA 5JFEA 5CJ9A 1J6WA 3L4KA 4G0VA 3LAJA 3S1QK 1EK8A 3GTOA 1HI9A 2JA8K 1I3QC 1I6VA 1HQMA 4GFQA 3TTGA 1USOA 4LR2A 4C3HC 2E2IA 5EGEA 1I6HC 5HL8A 1I50A 4C2MK 2PHCB 3HOUK 5C4JK 3HXAA 3HOYK 3K7AC 3GEEA 1TWHC 3S14C 1BJTA 2A69A 4Q4ZA 1TWHK 2JA6C 1WQGA 4Y52C 1L0WA 3HOWC 3S17K 5IORA 3GTJK 3H0GK 2ZFZA 1EI6A 5M3FK 5C4XK 4AH6A 1YCLA 5TMCA 3LAPA 3GTPK 4OINA 2VUMK 5C44C 3RZOC 3HOZC 4O2DA 5C3EK 5C44K 1TWHA 1TWAK 2PMZD 3JSTA 4MEYA 3H3VL 1XZPA 1JOEA 5JVOA 3GTJA 3CQZK 3AQPA 3FKIC 4A3JC 3H0GA 1USMA 1Y1WC 4A3JK 4LJZA 4A3GC 4KMDA 1Y1WK 4P9SA 3AD8C 2GSUA 1O26A 3GTLC 2VUMA 1BDFA 2Y0SL 1O24A 5IYDC 1IS1A 3GTLK 1TWAA 4GTLA 5IYDK 3T02A 3S15C 1YNJA 1IL2A 1KQ4A 3GTQC 3AQOA 4BBRK 3CQZA 4A3MC 2RGRA 3I4NK 1WCMK 1IW7A 2JA7C 4A3MK 4WJ4A 2FQOA 5EGHA 4LQYA 1GE9A 3GTMK 1R9TC 2JA5K 3PO3K 1Y1WA 3ERED 1SFOC 4NOIA 4YFXA 2XCRB 2P8TA 3GTLA 1TWFK 4BY7C 3M4OC 5IYBK 1RU0A 3GTQA 1JVIA 1WCMA 3GEHA 3S1MC 3N0CA 4MEXA 1WIHA 3GTMA 2JA5A 3SZZA 4A3EC 3T01A 4X6AK 1XZPB 4QIWL 4C45A 2WB1L 2R93C 1TWFA 4XSXA 3HOVK 4DDQA 3GSIA 3S2HK 3OPFA 3PO2K 2E2JK 2D6FC 4KM8A 3FOEA 3I4MK 2O5IA 2GAGC 2B63K 3TFJA 1F9NA 5CHPA 1O27A 4BY1K 3GIRA 5FLMC 4BXXK 4AYBL 1ZBSA 1AB4A 1J6VA 1BS2A 2R7ZC 4A3KC 4ILDA 2PA8L 1K83C 4OIQA 2YU9C 4GTBA 1EQRA 2B63A 1K83K 1I3QK 3H3VD 2R92C 2CFAA 1V5VA 4C3HK 3CAGA 4JK1A 4LK0A 1I6HK 4OIOA 4GTEA 1ISEA 1F93A 4BBSC 1VH2A 2Y0SD 4XLPA 3K7AK 4KASA 1K83A 3S14K 1I3QA 1VGXA 3AH5A 3V4GA 2JA6K 3A8KA 4BKWA 4Y52K 3HOWK 2Y3PA 2GAHC 4J3NA 4GTFA 4BLAA 3QX3A 4KN4A 4A3FC 1J98A 4A3FK 2NVXC 3RZOK 3HOZK 1O28A 2E2HC 1WSRA 3S16C 1PJ5A 3S1NC 3FHZA 2JA6A 4XCHA 4WILA 4ZH4A 1WORA 4BLBA 2NVTC 4A93C 1XPPA 2CFAB 5FJ8K 3OEPA 3FKIK 4QIWD 1XXAA 1ZYRA 2WB1D 1ZXOA 3M3YC 4A3GK 3DXJA 4YFKA 4GT9A 3S2DC 4LOWA 2E2HA 2V6SA 1IBAA 3S15K 1INNA 1O25A 1SMYA 2PPBA 4LK1A 1VLOA 3GTQK 3N0BA 1DCPA 4G7OA 5M5WK 5IP9C 4AYBD 3FKIA 1O29A 2JA7K 5IP9K 3HOXC 1R9TK 4YG2A 4C3JC 3WODA 5IP7C 1SFOK 4FM9A 1VJEA 2PA8D 1TWGC 2XCOA 3EQLA 3RZDC 3SZYA 4BY7K 3G4AA 4G7HA 3M4OK 2WAQL 1PJ6A 1YX2A 2ZUEA 3BP8C 2JA7A 3S1MK 4A3LC 1PJ7A 1O2BA 3GEIA 5D4DA 1R9TA 3HKZL 4A3EK 1SFOA 1ZVUA 3GTGC 1IQ0A 4PAAA 2R93K 2GSOA 2EBBA 3GDZA 4LLGA 4Y7NC 4A3CC 3L4JA 4KMUA 2NVQC 5M3MK 5FLMK 4A3DC 2R93A 2R7ZK 1G51A 4A3KK 3GTOC 3AD7C 5TJ3A 4XSZA 1X31C 2V6TA 2A68A 2YU9K 4C3IC 2R92K 1UV7A 2NVYC 4XLNA 4A3IC 1I50C 2NVYK 4Q5SA 3TFHA 3BUEA 1O2FB 2A6HA 3ADAC 2R7ZA 3G4CA 4M1XA 3AD9C 3S1QC 4BBSK 3VA7A 2JA8C 3LPXA 2YU9A 4GZYA 2R92A 4GTAA 4KB2A 2NVYA 3Q3QA 4C2MC 5IOQA 1WSVA 1DD5A 3HOUC 5C4JC 3HOYC 1B4BA 1XZQA 2ZUFA 3N3YA 2NVXK 1JQWA 4PABA 2WAQD 2E2HK 3S16K 4P5AA 3S1NK 3S17C 3GTJC 4G7ZA 3A8JA 2RH6A 3IPJA 2NVTK 4QJVA 3H0GC 4A93K 2KWAA 4OIRA 5C4XC 4KDDA 3HKZD 3GTPC 2JH3A 4RMFA 2A6EA 2VUMC
chains in the Genus database with same CATH topology
3M3YK 5C3EC 1TWAC 4G7HA 4BY1K 2WAQL 3M4OK 3HOUK 5C4JK 3HOYK 5FLMC 4BXXK 4AYBL 3K7AC 2BE5A 3S2DK 1TWCC 2R7ZC 3S1MK 1TWHC 1TWCK 3GTKC 3S14C 3CQZC 4A3LC 2A69A 4A3KC 4Q4ZA 5D4DA 1TWHK 3GTKK 4YFNA 2JA6C 3HKZL 4A3EK 4Y52C 2PA8L 3GTGC 1K83C 3HOWC 4OIQA 2YU9C 2R93K 1K83K 3S17K 1I3QK 3H3VD 3GTJK 3HOXK 2R92C 4C3HK 3H0GK 4C3JK 5IP7K 5M3FK 4JK1A 5C4XK 4LK0A 1I6HK 5TMCA 3GTPK 4OIOA 1TWGK 3RZDK 4OINA 4LLGA 2VUMK 4BBRC 4Y7NC 5C44C 3S1RC 3HOZC 3RZOC 3I4NC 5M5XK 1WCMC 5TMFA 5C3EK 5C44K 3S1RK 1TWAK 3S2HK 4KMUA 4BBSC 2Y0SD 4A3CC 2PMZD 5M3MK 5FLMK 4XLPA 2NVQC 3K7AK 4MEYA 3GTMC 2JA5C 4A3BC 3H3VL 3PO3C 4A3DC 2R7ZK 4A3BK 3S14K 3CQZK 4A3LK 1Y1VC 4A3KK 3GTOC 3FKIC 4A3JC 4QJVB 1TWFC 1Y1VK 2JA6K 4XSZA 1Y1WC 4Y52K 1YNNA 4A3JK 4LJZA 3GTGK 3HOWK 2A68A 4A3GC 1Y1WK 2YU9K 5IYBC 4KN7A 3GTLC 2R92K 1BDFA 2Y0SL 2NVYC 2PMZL 5IYDC 4XLNA 5IYCC 4A3IC 3GTLK 1I50C 2NVYK 4Q5SA 5IYDK 3S15C 5IYCK 1YNJA 4KN4A 4A3FC 2A6HA 3GTQC 4A3FK 2NVXC 4X6AC 4BBRK 4Y7NK 3RZOK 3HOZK 3I4NK 4A3MC 2E2HC 4BBSK 1WCMK 3S16C 4A3CK 3S1QC 1IW7A 3S17C 2JA7C 4A3MK 3S1NC 2JA8C 2NVQK 3HOVC 4ZH4A 3GTMK 1R9TC 2JA5K 2NVTC 3PO3K 3S2HC 1SFOC 3PO2C 4A93C 2E2JC 4GZYA 4A3DK 4OIPA 4NOIA 4YFXA 1XPPA 3I4MC 5FJ8K 3GTOK 3FKIK 4QIWD 2B63C 2CW0A 1TWFK 1ZYRA 2WB1D 4BY7C 2E2IC 3M3YC 4A3GK 3DXJA 4BY1C 3M4OC 4C3IK 2E2IK 2O5JA 3HOUC 5IYBK 5C4JC 3HOYC 4BXXC 4YFKA 3S2DC 4MQ9A 4A3IK 1I50K 3S1MC 3S15K 5M5YK 1SMYA 4MEXA 2PPBA 4LK1A 3GTQK 4A3EC 2NVXK 4X6AK 4QIWL 2WAQD 2E2HK 4G7OA 5M5WK 3S16K 2WB1L 5IP9C 4AYBD 3RZDC 3S1QK 2JA7K 3S1NK 2R93C 2JA8K 1I3QC 4XSXA 5IP9K 1I6VA 3GTJC 1HQMA 3HOXC 4G7ZA 3HOVK 1R9TK 2NVTK 4QJVA 3H0GC 4YG2A 1SFOK 3WODA 5IP7C 2E2JK 4OIRA 3PO2K 4A93K 5C4XC 3HKZD 1I6HC 3GTPC 2O5IA 3I4MK 2B63K 2PA8D 1TWGC 2A6EA 3EQLA 2VUMC 4C2MK 4BY7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y K;  5C3E C;  1TWA C;  4G7H A;  4BY1 K;  2WAQ L;  3M4O K;  3HOU K;  5C4J K;  3HOY K;  5FLM C;  4BXX K;  4AYB L;  3K7A C;  2BE5 A;  3S2D K;  1TWC C;  2R7Z C;  3S1M K;  1TWH C;  1TWC K;  3GTK C;  3S14 C;  3CQZ C;  4A3L C;  2A69 A;  4A3K C;  4Q4Z A;  5D4D A;  1TWH K;  3GTK K;  4YFN A;  2JA6 C;  3HKZ L;  4A3E K;  4Y52 C;  2PA8 L;  3GTG C;  1K83 C;  3HOW C;  4OIQ A;  2YU9 C;  2R93 K;  1K83 K;  3S17 K;  1I3Q K;  3H3V D;  3GTJ K;  3HOX K;  2R92 C;  4C3H K;  3H0G K;  4C3J K;  5IP7 K;  5M3F K;  4JK1 A;  5C4X K;  4LK0 A;  1I6H K;  5TMC A;  3GTP K;  4OIO A;  1TWG K;  3RZD K;  4OIN A;  4LLG A;  2VUM K;  4BBR C;  4Y7N C;  5C44 C;  3S1R C;  3HOZ C;  3RZO C;  3I4N C;  5M5X K;  1WCM C;  5TMF A;  5C3E K;  5C44 K;  3S1R K;  1TWA K;  3S2H K;  4KMU A;  4BBS C;  2Y0S D;  4A3C C;  2PMZ D;  5M3M K;  5FLM K;  4XLP A;  2NVQ C;  3K7A K;  4MEY A;  3GTM C;  2JA5 C;  4A3B C;  3H3V L;  3PO3 C;  4A3D C;  2R7Z K;  4A3B K;  3S14 K;  3CQZ K;  4A3L K;  1Y1V C;  4A3K K;  3GTO C;  3FKI C;  4A3J C;  4QJV B;  1TWF C;  1Y1V K;  2JA6 K;  4XSZ A;  1Y1W C;  4Y52 K;  1YNN A;  4A3J K;  4LJZ A;  3GTG K;  3HOW K;  2A68 A;  4A3G C;  1Y1W K;  2YU9 K;  5IYB C;  4KN7 A;  3GTL C;  2R92 K;  1BDF A;  2Y0S L;  2NVY C;  2PMZ L;  5IYD C;  4XLN A;  5IYC C;  4A3I C;  3GTL K;  1I50 C;  2NVY K;  4Q5S A;  5IYD K;  3S15 C;  5IYC K;  1YNJ A;  4KN4 A;  4A3F C;  2A6H A;  3GTQ C;  4A3F K;  2NVX C;  4X6A C;  4BBR K;  4Y7N K;  3RZO K;  3HOZ K;  3I4N K;  4A3M C;  2E2H C;  4BBS K;  1WCM K;  3S16 C;  4A3C K;  3S1Q C;  1IW7 A;  3S17 C;  2JA7 C;  4A3M K;  3S1N C;  2JA8 C;  2NVQ K;  3HOV C;  4ZH4 A;  3GTM K;  1R9T C;  2JA5 K;  2NVT C;  3PO3 K;  3S2H C;  1SFO C;  3PO2 C;  4A93 C;  2E2J C;  4GZY A;  4A3D K;  4OIP A;  4NOI A;  4YFX A;  1XPP A;  3I4M C;  5FJ8 K;  3GTO K;  3FKI K;  4QIW D;  2B63 C;  2CW0 A;  1TWF K;  1ZYR A;  2WB1 D;  4BY7 C;  2E2I C;  3M3Y C;  4A3G K;  3DXJ A;  4BY1 C;  3M4O C;  4C3I K;  2E2I K;  2O5J A;  3HOU C;  5IYB K;  5C4J C;  3HOY C;  4BXX C;  4YFK A;  3S2D C;  4MQ9 A;  4A3I K;  1I50 K;  3S1M C;  3S15 K;  5M5Y K;  1SMY A;  4MEX A;  2PPB A;  4LK1 A;  3GTQ K;  4A3E C;  2NVX K;  4X6A K;  4QIW L;  2WAQ D;  2E2H K;  4G7O A;  5M5W K;  3S16 K;  2WB1 L;  5IP9 C;  4AYB D;  3RZD C;  3S1Q K;  2JA7 K;  3S1N K;  2R93 C;  2JA8 K;  1I3Q C;  4XSX A;  5IP9 K;  1I6V A;  3GTJ C;  1HQM A;  3HOX C;  4G7Z A;  3HOV K;  1R9T K;  2NVT K;  4QJV A;  3H0G C;  4YG2 A;  1SFO K;  3WOD A;  5IP7 C;  2E2J K;  4OIR A;  3PO2 K;  4A93 K;  5C4X C;  3HKZ D;  1I6H C;  3GTP C;  2O5I A;  3I4M K;  2B63 K;  2PA8 D;  1TWG C;  2A6E A;  3EQL A;  2VUM C;  4C2M K;  4BY7 K; 
#chains in the Genus database with same CATH topology
 3FOF A;  3M3Y K;  5C3E C;  1TWA C;  2NVX A;  2BE5 A;  2W7V A;  4GTD A;  1TWC C;  3S2D K;  1TWC K;  3GTK C;  3CQZ C;  3GTK K;  4YFN A;  3T00 A;  2GSN A;  4FZB A;  3GTP A;  3ORE A;  4KC6 A;  3HOX K;  3S0X A;  4KM9 A;  4C3J K;  5IP7 K;  3NUH A;  3A8I A;  1WOO A;  1WOP A;  5E68 A;  1C0A A;  1TWG K;  3RZD K;  4BBR C;  3S1R C;  1WQH A;  1XZQ B;  1TWC A;  3I4N C;  4KAT A;  5M5X K;  1WCM C;  5TMF A;  3S1R K;  3GTK A;  1DCH A;  4WJ3 M;  3GTM C;  4A3B C;  2JA5 C;  4KAR A;  5L46 A;  3PO3 C;  1VRQ C;  4A3B K;  4A3L K;  1Y1V C;  4KMA A;  2XCQ A;  4QJV B;  1TWF C;  1Y1V K;  1YNN A;  3GTG K;  2V6U A;  1IE0 A;  1TWG A;  2P5M A;  5IYB C;  3MML B;  4KN7 A;  1F7U A;  2PMZ L;  5IYC C;  5IOS A;  5IYC K;  1B4A A;  1XXB A;  1BGW A;  1XXC A;  3BP3 A;  4X6A C;  4Y7N K;  1WOS A;  3TFI A;  4KB4 A;  4A3C K;  1ZQ1 C;  1EFW A;  1Y1V A;  2NVQ K;  3HOV C;  3GTG A;  4G0U A;  1J6X A;  3S2H C;  4A3D K;  3PO2 C;  2E2J C;  1O2A A;  4GTC A;  2FQT A;  4OIP A;  3I4M C;  3GTO K;  2B63 C;  2CW0 A;  1DCO A;  2E2I C;  4KMH A;  4BY1 C;  2O5J A;  4C3I K;  1F7V A;  2E2I K;  4BXX C;  4MQ9 A;  4A3I K;  1I50 K;  1EH1 A;  4G0W A;  5M5Y K;  1WQF A;  4KAW X;  4P5B A;  5IOT A;  5JFE A;  5CJ9 A;  1J6W A;  3L4K A;  4G0V A;  3LAJ A;  3S1Q K;  1EK8 A;  3GTO A;  1HI9 A;  2JA8 K;  1I3Q C;  1I6V A;  1HQM A;  4GFQ A;  3TTG A;  1USO A;  4LR2 A;  4C3H C;  2E2I A;  5EGE A;  1I6H C;  5HL8 A;  1I50 A;  4C2M K;  2PHC B;  3HOU K;  5C4J K;  3HXA A;  3HOY K;  3K7A C;  3GEE A;  1TWH C;  3S14 C;  1BJT A;  2A69 A;  4Q4Z A;  1TWH K;  2JA6 C;  1WQG A;  4Y52 C;  1L0W A;  3HOW C;  3S17 K;  5IOR A;  3GTJ K;  3H0G K;  2ZFZ A;  1EI6 A;  5M3F K;  5C4X K;  4AH6 A;  1YCL A;  5TMC A;  3LAP A;  3GTP K;  4OIN A;  2VUM K;  5C44 C;  3RZO C;  3HOZ C;  4O2D A;  5C3E K;  5C44 K;  1TWH A;  1TWA K;  2PMZ D;  3JST A;  4MEY A;  3H3V L;  1XZP A;  1JOE A;  5JVO A;  3GTJ A;  3CQZ K;  3AQP A;  3FKI C;  4A3J C;  3H0G A;  1USM A;  1Y1W C;  4A3J K;  4LJZ A;  4A3G C;  4KMD A;  1Y1W K;  4P9S A;  3AD8 C;  2GSU A;  1O26 A;  3GTL C;  2VUM A;  1BDF A;  2Y0S L;  1O24 A;  5IYD C;  1IS1 A;  3GTL K;  1TWA A;  4GTL A;  5IYD K;  3T02 A;  3S15 C;  1YNJ A;  1IL2 A;  1KQ4 A;  3GTQ C;  3AQO A;  4BBR K;  3CQZ A;  4A3M C;  2RGR A;  3I4N K;  1WCM K;  1IW7 A;  2JA7 C;  4A3M K;  4WJ4 A;  2FQO A;  5EGH A;  4LQY A;  1GE9 A;  3GTM K;  1R9T C;  2JA5 K;  3PO3 K;  1Y1W A;  3ERE D;  1SFO C;  4NOI A;  4YFX A;  2XCR B;  2P8T A;  3GTL A;  1TWF K;  4BY7 C;  3M4O C;  5IYB K;  1RU0 A;  3GTQ A;  1JVI A;  1WCM A;  3GEH A;  3S1M C;  3N0C A;  4MEX A;  1WIH A;  3GTM A;  2JA5 A;  3SZZ A;  4A3E C;  3T01 A;  4X6A K;  1XZP B;  4QIW L;  4C45 A;  2WB1 L;  2R93 C;  1TWF A;  4XSX A;  3HOV K;  4DDQ A;  3GSI A;  3S2H K;  3OPF A;  3PO2 K;  2E2J K;  2D6F C;  4KM8 A;  3FOE A;  3I4M K;  2O5I A;  2GAG C;  2B63 K;  3TFJ A;  1F9N A;  5CHP A;  1O27 A;  4BY1 K;  3GIR A;  5FLM C;  4BXX K;  4AYB L;  1ZBS A;  1AB4 A;  1J6V A;  1BS2 A;  2R7Z C;  4A3K C;  4ILD A;  2PA8 L;  1K83 C;  4OIQ A;  2YU9 C;  4GTB A;  1EQR A;  2B63 A;  1K83 K;  1I3Q K;  3H3V D;  2R92 C;  2CFA A;  1V5V A;  4C3H K;  3CAG A;  4JK1 A;  4LK0 A;  1I6H K;  4OIO A;  4GTE A;  1ISE A;  1F93 A;  4BBS C;  1VH2 A;  2Y0S D;  4XLP A;  3K7A K;  4KAS A;  1K83 A;  3S14 K;  1I3Q A;  1VGX A;  3AH5 A;  3V4G A;  2JA6 K;  3A8K A;  4BKW A;  4Y52 K;  3HOW K;  2Y3P A;  2GAH C;  4J3N A;  4GTF A;  4BLA A;  3QX3 A;  4KN4 A;  4A3F C;  1J98 A;  4A3F K;  2NVX C;  3RZO K;  3HOZ K;  1O28 A;  2E2H C;  1WSR A;  3S16 C;  1PJ5 A;  3S1N C;  3FHZ A;  2JA6 A;  4XCH A;  4WIL A;  4ZH4 A;  1WOR A;  4BLB A;  2NVT C;  4A93 C;  1XPP A;  2CFA B;  5FJ8 K;  3OEP A;  3FKI K;  4QIW D;  1XXA A;  1ZYR A;  2WB1 D;  1ZXO A;  3M3Y C;  4A3G K;  3DXJ A;  4YFK A;  4GT9 A;  3S2D C;  4LOW A;  2E2H A;  2V6S A;  1IBA A;  3S15 K;  1INN A;  1O25 A;  1SMY A;  2PPB A;  4LK1 A;  1VLO A;  3GTQ K;  3N0B A;  1DCP A;  4G7O A;  5M5W K;  5IP9 C;  4AYB D;  3FKI A;  1O29 A;  2JA7 K;  5IP9 K;  3HOX C;  1R9T K;  4YG2 A;  4C3J C;  3WOD A;  5IP7 C;  1SFO K;  4FM9 A;  1VJE A;  2PA8 D;  1TWG C;  2XCO A;  3EQL A;  3RZD C;  3SZY A;  4BY7 K;  3G4A A;  4G7H A;  3M4O K;  2WAQ L;  1PJ6 A;  1YX2 A;  2ZUE A;  3BP8 C;  2JA7 A;  3S1M K;  4A3L C;  1PJ7 A;  1O2B A;  3GEI A;  5D4D A;  1R9T A;  3HKZ L;  4A3E K;  1SFO A;  1ZVU A;  3GTG C;  1IQ0 A;  4PAA A;  2R93 K;  2GSO A;  2EBB A;  3GDZ A;  4LLG A;  4Y7N C;  4A3C C;  3L4J A;  4KMU A;  2NVQ C;  5M3M K;  5FLM K;  4A3D C;  2R93 A;  2R7Z K;  1G51 A;  4A3K K;  3GTO C;  3AD7 C;  5TJ3 A;  4XSZ A;  1X31 C;  2V6T A;  2A68 A;  2YU9 K;  4C3I C;  2R92 K;  1UV7 A;  2NVY C;  4XLN A;  4A3I C;  1I50 C;  2NVY K;  4Q5S A;  3TFH A;  3BUE A;  1O2F B;  2A6H A;  3ADA C;  2R7Z A;  3G4C A;  4M1X A;  3AD9 C;  3S1Q C;  4BBS K;  3VA7 A;  2JA8 C;  3LPX A;  2YU9 A;  4GZY A;  2R92 A;  4GTA A;  4KB2 A;  2NVY A;  3Q3Q A;  4C2M C;  5IOQ A;  1WSV A;  1DD5 A;  3HOU C;  5C4J C;  3HOY C;  1B4B A;  1XZQ A;  2ZUF A;  3N3Y A;  2NVX K;  1JQW A;  4PAB A;  2WAQ D;  2E2H K;  3S16 K;  4P5A A;  3S1N K;  3S17 C;  3GTJ C;  4G7Z A;  3A8J A;  2RH6 A;  3IPJ A;  2NVT K;  4QJV A;  3H0G C;  4A93 K;  2KWA A;  4OIR A;  5C4X C;  4KDD A;  3HKZ D;  3GTP C;  2JH3 A;  4RMF A;  2A6E A;  2VUM C; 
#chains in the Genus database with same CATH homology
 3M3Y K;  5C3E C;  1TWA C;  4G7H A;  4BY1 K;  2WAQ L;  3M4O K;  3HOU K;  5C4J K;  3HOY K;  5FLM C;  4BXX K;  4AYB L;  3K7A C;  2BE5 A;  3S2D K;  1TWC C;  2R7Z C;  3S1M K;  1TWH C;  1TWC K;  3GTK C;  3S14 C;  3CQZ C;  4A3L C;  2A69 A;  4A3K C;  4Q4Z A;  5D4D A;  1TWH K;  3GTK K;  4YFN A;  2JA6 C;  3HKZ L;  4A3E K;  4Y52 C;  2PA8 L;  3GTG C;  1K83 C;  3HOW C;  4OIQ A;  2YU9 C;  2R93 K;  1K83 K;  3S17 K;  1I3Q K;  3H3V D;  3GTJ K;  3HOX K;  2R92 C;  4C3H K;  3H0G K;  4C3J K;  5IP7 K;  5M3F K;  4JK1 A;  5C4X K;  4LK0 A;  1I6H K;  5TMC A;  3GTP K;  4OIO A;  1TWG K;  3RZD K;  4OIN A;  4LLG A;  2VUM K;  4BBR C;  4Y7N C;  5C44 C;  3S1R C;  3HOZ C;  3RZO C;  3I4N C;  5M5X K;  1WCM C;  5TMF A;  5C3E K;  5C44 K;  3S1R K;  1TWA K;  3S2H K;  4KMU A;  4BBS C;  2Y0S D;  4A3C C;  2PMZ D;  5M3M K;  5FLM K;  4XLP A;  2NVQ C;  3K7A K;  4MEY A;  3GTM C;  2JA5 C;  4A3B C;  3H3V L;  3PO3 C;  4A3D C;  2R7Z K;  4A3B K;  3S14 K;  3CQZ K;  4A3L K;  1Y1V C;  4A3K K;  3GTO C;  3FKI C;  4A3J C;  4QJV B;  1TWF C;  1Y1V K;  2JA6 K;  4XSZ A;  1Y1W C;  4Y52 K;  1YNN A;  4A3J K;  4LJZ A;  3GTG K;  3HOW K;  2A68 A;  4A3G C;  1Y1W K;  2YU9 K;  5IYB C;  4KN7 A;  3GTL C;  2R92 K;  1BDF A;  2Y0S L;  2NVY C;  2PMZ L;  5IYD C;  4XLN A;  5IYC C;  4A3I C;  3GTL K;  1I50 C;  2NVY K;  4Q5S A;  5IYD K;  3S15 C;  5IYC K;  1YNJ A;  4KN4 A;  4A3F C;  2A6H A;  3GTQ C;  4A3F K;  2NVX C;  4X6A C;  4BBR K;  4Y7N K;  3RZO K;  3HOZ K;  3I4N K;  4A3M C;  2E2H C;  4BBS K;  1WCM K;  3S16 C;  4A3C K;  3S1Q C;  1IW7 A;  3S17 C;  2JA7 C;  4A3M K;  3S1N C;  2JA8 C;  2NVQ K;  3HOV C;  4ZH4 A;  3GTM K;  1R9T C;  2JA5 K;  2NVT C;  3PO3 K;  3S2H C;  1SFO C;  3PO2 C;  4A93 C;  2E2J C;  4GZY A;  4A3D K;  4OIP A;  4NOI A;  4YFX A;  1XPP A;  3I4M C;  5FJ8 K;  3GTO K;  3FKI K;  4QIW D;  2B63 C;  2CW0 A;  1TWF K;  1ZYR A;  2WB1 D;  4BY7 C;  2E2I C;  3M3Y C;  4A3G K;  3DXJ A;  4BY1 C;  3M4O C;  4C3I K;  2E2I K;  2O5J A;  3HOU C;  5IYB K;  5C4J C;  3HOY C;  4BXX C;  4YFK A;  3S2D C;  4MQ9 A;  4A3I K;  1I50 K;  3S1M C;  3S15 K;  5M5Y K;  1SMY A;  4MEX A;  2PPB A;  4LK1 A;  3GTQ K;  4A3E C;  2NVX K;  4X6A K;  4QIW L;  2WAQ D;  2E2H K;  4G7O A;  5M5W K;  3S16 K;  2WB1 L;  5IP9 C;  4AYB D;  3RZD C;  3S1Q K;  2JA7 K;  3S1N K;  2R93 C;  2JA8 K;  1I3Q C;  4XSX A;  5IP9 K;  1I6V A;  3GTJ C;  1HQM A;  3HOX C;  4G7Z A;  3HOV K;  1R9T K;  2NVT K;  4QJV A;  3H0G C;  4YG2 A;  1SFO K;  3WOD A;  5IP7 C;  2E2J K;  4OIR A;  3PO2 K;  4A93 K;  5C4X C;  3HKZ D;  1I6H C;  3GTP C;  2O5I A;  3I4M K;  2B63 K;  2PA8 D;  1TWG C;  2A6E A;  3EQL A;  2VUM C;  4C2M K;  4BY7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...