3S1RK

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3s1rK00
4BBSC 2WAQD 3I4MC 5C4JK 3HOUC 3GTLK 5IP9C 2PMZL 3RZOK 1Y1WC 3I4MK 5TMCA 2BE5A 1HQMA 4XSZA 1Y1VC 4A3FC 2E2JC 1BDFA 2JA6K 4X6AK 1TWFC 2R7ZK 1Y1VK 2R93C 4BXXC 4A3LK 3HKZL 3WODA 2NVYC 4Y7NC 4A3FK 2E2JK 3CQZC 4XSXA 4BY1C 4Y52C 3PO2K 4BBRK 3HOVK 2B63C 5M3FK 4KN4A 2NVYK 4Y7NK 1ZYRA 3I4NC 4C3JK 4YFXA 4G7HA 3M4OC 3S2HC 3HOYK 2E2HK 3RZOC 1TWHK 4QJVB 4Q4ZA 3GTLC 5IYBC 3H3VD 4BY7K 4NOIA 2A68A 3GTKC 4QJVA 1SFOK 2E2IC 3PO3C 1IW7A 2E2HC 3K7AC 4QIWL 5M5WK 4A3IC 2YU9K 3S14K 1I50K 4A3EC 2JA5C 3GTQC 4A3JC 4KN7A 4OIRA 2PA8D 4OINA 1YNNA 2B63K 3GTJK 4G7OA 3FKIK 3S1QC 3S2DC 2JA7K 5IYDK 4YFNA 3GTQK 5C44K 4OIQA 1WCMC 2NVQK 4BXXK 3HOYC 3I4NK 3RZDK 3S1NC 4GZYA 5FLMC 1WCMK 4C3HK 2NVQC 5M5XK 5C44C 4A3DC 4A3MC 1XPPA 3GTKK 3PO3K 4OIPA 3GTOK 4AYBL 5C4JC 4A3MK 2WB1L 1TWCC 2YU9C 3GTGC 3HOZK 4XLNA 1I50C 4ZH4A 3S2HK 1TWAC 3HOWC 4OIOA 3S15K 1I3QK 3GTPK 3M4OK 2JA6C 4A3KC 2JA8K 4A93K 3HOZC 4LK0A 5IYBK 3S2DK 2A6HA 4KMUA 2WB1D 3PO2C 4MQ9A 2R92K 4Y52K 2Y0SD 2CW0A 5IYCK 1K83C 4A3GC 5FLMK 4A3BK 3S1RC 3S1NK 2WAQL 4JK1A 1K83K 5C4XK 2NVTK 2PMZD 5IYCC 3EQLA 3H3VL 5IP7C 4G7ZA 2JA7C 5IP9K 2A6EA 3GTOC 3S1MK 1Y1WK 2A69A 5IP7K 4MEXA 4BBSK 4LLGA 1TWFK 2R7ZC 2R93K 2O5JA 4A3LC 2O5IA 1TWAK 3HOWK 3S16C 5TMFA 3K7AK 2PPBA 5M5YK 5FJ8K 4QIWD 4XLPA 4YG2A 3GTMC 2R92C 5C3EC 3FKIC 1I6VA 3HOUK 4MEYA 4C2MK 3S1QK 2PA8L 1I3QC 3GTPC 1I6HC 4A3KK 2JA8C 3M3YK 3S17C 3S1RK 4A93C 5D4DA 3HOXC 4Q5SA 1I6HK 4A3CK 1R9TC 2VUMK 4LK1A 1TWCK 3GTGK 3S17K 4C3IK 4LJZA 1SFOC 1SMYA 3S1MC 4A3DK 4BY7C 1TWGC 1R9TK 2VUMC 2NVXK 3S14C 1YNJA 2NVTC 4AYBD 2JA5K 5C4XC 3S16K 3S15C 4X6AC 4A3IK 1TWGK 2E2IK 4A3GK 2NVXC 3H0GK 2Y0SL 3GTMK 4BBRC 5IYDC 3GTJC 5C3EK 1TWHC 3HOVC 3CQZK 3H0GC 4YFKA 4BY1K 4A3EK 4A3JK 3DXJA 5M3MK 3M3YC 4A3CC 3RZDC 4A3BC 3HOXK 3HKZD
chains in the Genus database with same CATH superfamily
2FQTA 2JA7A 1TWFA 1Y1WC 3GTOA 5TJ3A 4XSZA 1Y1VC 2JA6K 2W7VA 2R7ZK 4Y7NC 3LPXA 5IOSA 3CQZC 4ILDA 3HOVK 2RH6A 2B63C 4BKWA 2GSOA 2NVYK 3QX3A 1TWAA 3T00A 4GFQA 4QJVB 1B4AA 4QJVA 1IW7A 2ZUFA 2V6TA 3GTJA 1WQHA 4A3IC 1HI9A 1EFWA 3GTQC 4OIRA 2B63K 5IYDK 3AD9C 1C0AA 1SFOA 2Y3PA 3HOYC 4GTLA 3RZDK 4FZBA 1VH2A 1PJ6A 3OEPA 4A3MK 1F93A 3GIRA 3HOZK 1TWCC 1USOA 3GTGC 3S2HK 3HOWC 3M4OK 1EH1A 3GTPK 4A93K 4LK0A 5IYBK 3ADAC 1BGWA 1O25A 3PO2C 4MQ9A 2R92K 4KMAA 2Y0SD 2CFAA 4C45A 4A3GC 3N0CA 5FLMK 4A3BK 3S1NK 2WAQL 4G7ZA 2A6EA 4KASA 2A69A 1UV7A 4MEXA 4BBSK 3A8IA 3HOWK 4M1XA 3TFHA 3K7AK 2PPBA 1WOPA 1VLOA 3FKIC 4MEYA 3ERED 2JA8C 4A3CK 2VUMK 4C3IK 2V6UA 2JA5A 3G4CA 1SMYA 1G51A 2NVXK 1IQ0A 4XCHA 4A3IK 4LOWA 4PAAA 1J6XA 1ISEA 1PJ7A 2Y0SL 3GTMK 1O26A 3H0GC 4A3EK 4A3JK 4A3CC 2XCRB 3GTPA 3SZZA 4BLAA 4BLBA 3CQZA 2WAQD 5CHPA 5EGEA 5TMCA 1VJEA 3AQPA 2R93C 1Y1VK 4A3LK 1J98A 4XSXA 3LAJA 3Q3QA 1IE0A 1F7UA 5M3FK 3BP8C 5E68A 1KQ4A 4DDQA 3GSIA 1O2BA 2XCQA 4LR2A 4YFXA 3AD8C 4G7HA 1WCMA 3RZOC 1TWHK 1IL2A 3GTLC 3H3VD 3AQOA 4NOIA 1SFOK 3N0BA 3K7AC 3FKIA 4GTBA 1I50K 1USMA 4KN7A 4J3NA 1XXAA 2PA8D 5JVOA 2D6FC 3FKIK 3S2DC 5HL8A 4GZYA 1WQGA 1J6WA 4A3DC 1EK8A 2P8TA 4GTFA 1XPPA 3BP3A 3GTOK 4RMFA 2XCOA 4AYBL 4XLNA 2NVYA 1WQFA 1F7VA 1TWAC 4OIOA 1I3QK 3GEIA 4A3KC 3HOZC 5L46A 5IOTA 2WB1D 4AH6A 4Y52K 3CAGA 2RGRA 2CW0A 5IYCK 1I50A 1O2FB 3S1RC 4JK1A 1K83K 5C4XK 2V6SA 2PMZD 1WOSA 3H3VL 1ZBSA 2R7ZA 1TWHA 5IP7K 4KAWX 2R93K 2O5IA 3S16C 5TMFA 5C3EC 4C2MK 1I3QC 4A3KK 1ZQ1C 1R9TA 3S1RK 1I6HK 3H0GA 4FM9A 1TWGA 5CJ9A 3S1MC 4C3IC 2PHCB 2R92A 2VUMC 3S14C 1YNJA 3S16K 2E2IK 1XZPA 2KWAA 3HOVC 3CQZK 4YFKA 1DD5A 3V4GA 2E2IA 3M3YC 1WOOA 3HOXK 3HKZD 4BBSC 1K83A 5C4JK 1DCHA 2R93A 3I4MK 4A3FC 2E2JC 1J6VA 2GSUA 3L4JA 4BXXC 3WODA 1RU0A 4P9SA 4BY1C 4Y52C 1BJTA 2GSNA 4WJ3M 4KN4A 3HXAA 5IORA 3I4NC 4C3JK 3M4OC 3S2HC 3HOYK 2E2HK 3LAPA 4Q4ZA 5IYBC 3GEHA 4BY7K 4KM9A 1BS2A 2GAGC 4QIWL 4A3EC 2JA5C 3T02A 4A3JC 4WJ4A 4OINA 4G0WA 3S1QC 2P5MA 1JVIA 1PJ5A 1WCMC 4BXXK 3I4NK 3S1NC 4KB4A 5FLMC 4C3HK 2NVQC 1O29A 5M5XK 2E2HA 5C44C 1JQWA 4OIPA 1F9NA 1EQRA 3AH5A 3GDZA 1DCOA 4KDDA 4ZH4A 2JA8K 1X31C 4KMHA 2A6HA 2B63A 4KMUA 4WILA 4GTAA 3IPJA 3OPFA 4KB2A 2ZFZA 1K83C 2NVTK 5IYCC 3EQLA 5IP7C 2JA6A 1Y1WK 1XZPB 1ZXOA 3JSTA 2R7ZC 3BUEA 3S0XA 3T01A 3OREA 4GT9A 4XLPA 4C2MC 3GTMC 2R92C 1I6VA 3HOUK 2NVXA 2PA8L 3FHZA 3GTPC 1I6HC 4A93C 1INNA 1O27A 5D4DA 1R9TC 3S17K 4LK1A 2VUMA 1EI6A 1V5VA 4A3DK 4BY7C 1TWGC 1JOEA 4AYBD 2JA5K 2NVTC 3S15C 4X6AC 3FOEA 1IBAA 3GTMA 4BBRC 5IYDC 1TWHC 5M3MK 3RZDC 3SZYA 3TFJA 3I4MC 3HOUC 3GTLK 5IP9C 2PMZL 3RZOK 3GTKA 1O24A 2BE5A 1HQMA 1BDFA 5IOQA 3NUHA 2CFAB 4X6AK 1TWFC 1Y1WA 3HKZL 2NVYC 4A3FK 2E2JK 4O2DA 3PO2K 4BBRK 4Y7NK 1L0WA 1ZYRA 5EGHA 1WSVA 3L4KA 1YCLA 1ZVUA 2A68A 3GTKC 2E2IC 3PO3C 2E2HC 2FQOA 4G0UA 3GTQA 3GEEA 5M5WK 2YU9K 3S14K 1VGXA 2ZUEA 1DCPA 3AD7C 4LQYA 3TFIA 1YNNA 4G7OA 3GTJK 1XZQB 2JA7K 4YFNA 3GTQK 5C44K 4OIQA 4C3HC 2NVQK 4KC6A 3A8JA 1WCMK 1IS1A 4A3MC 3GTKK 3PO3K 1AB4A 5C4JC 3GTLA 2WB1L 2YU9C 1I50C 1VRQC 3S15K 2JA6C 4KARA 1Y1VA 3S2DK 3MMLB 3FOFA 1TWCA 3GTGA 1GE9A 4P5BA 4C3JC 3G4AA 3TTGA 4GTDA 2JA7C 5IP9K 3GTOC 2JH3A 3S1MK 2EBBA 1WIHA 4LLGA 1TWFK 2YU9A 4A3LC 1WORA 1TWAK 4GTEA 5M5YK 5FJ8K 4QIWD 4YG2A 3VA7A 3S1QK 1XZQA 3A8KA 3N3YA 1XXBA 3M3YK 3S17C 4Q5SA 3HOXC 5JFEA 4G0VA 4P5AA 1TWCK 3GTGK 1O2AA 4LJZA 1SFOC 1YX2A 1R9TK 5C4XC 1TWGK 4GTCA 4A3GK 2NVXC 1B4BA 2GAHC 1XXCA 3H0GK 1O28A 4KATA 3GTJC 5C3EK 4BY1K 1WSRA 4KM8A 4PABA 3DXJA 4KMDA 2O5JA 4A3BC 1I3QA
chains in the Genus database with same CATH topology
4BBSC 2WAQD 3I4MC 5C4JK 3HOUC 3GTLK 5IP9C 2PMZL 3RZOK 1Y1WC 3I4MK 5TMCA 2BE5A 1HQMA 4XSZA 1Y1VC 4A3FC 2E2JC 1BDFA 2JA6K 4X6AK 1TWFC 2R7ZK 1Y1VK 2R93C 4BXXC 4A3LK 3HKZL 3WODA 2NVYC 4Y7NC 4A3FK 2E2JK 3CQZC 4XSXA 4BY1C 4Y52C 3PO2K 4BBRK 3HOVK 2B63C 5M3FK 4KN4A 2NVYK 4Y7NK 1ZYRA 3I4NC 4C3JK 4YFXA 4G7HA 3M4OC 3S2HC 3HOYK 2E2HK 3RZOC 1TWHK 4QJVB 4Q4ZA 3GTLC 5IYBC 3H3VD 4BY7K 4NOIA 2A68A 3GTKC 4QJVA 1SFOK 2E2IC 3PO3C 1IW7A 2E2HC 3K7AC 4QIWL 5M5WK 4A3IC 2YU9K 3S14K 1I50K 4A3EC 2JA5C 3GTQC 4A3JC 4KN7A 4OIRA 2PA8D 4OINA 1YNNA 2B63K 3GTJK 4G7OA 3FKIK 3S1QC 3S2DC 2JA7K 5IYDK 4YFNA 3GTQK 5C44K 4OIQA 1WCMC 2NVQK 4BXXK 3HOYC 3I4NK 3RZDK 3S1NC 4GZYA 5FLMC 1WCMK 4C3HK 2NVQC 5M5XK 5C44C 4A3DC 4A3MC 1XPPA 3GTKK 3PO3K 4OIPA 3GTOK 4AYBL 5C4JC 4A3MK 2WB1L 1TWCC 2YU9C 3GTGC 3HOZK 4XLNA 1I50C 4ZH4A 3S2HK 1TWAC 3HOWC 4OIOA 3S15K 1I3QK 3GTPK 3M4OK 2JA6C 4A3KC 2JA8K 4A93K 3HOZC 4LK0A 5IYBK 3S2DK 2A6HA 4KMUA 2WB1D 3PO2C 4MQ9A 2R92K 4Y52K 2Y0SD 2CW0A 5IYCK 1K83C 4A3GC 5FLMK 4A3BK 3S1RC 3S1NK 2WAQL 4JK1A 1K83K 5C4XK 2NVTK 2PMZD 5IYCC 3EQLA 3H3VL 5IP7C 4G7ZA 2JA7C 5IP9K 2A6EA 3GTOC 3S1MK 1Y1WK 2A69A 5IP7K 4MEXA 4BBSK 4LLGA 1TWFK 2R7ZC 2R93K 2O5JA 4A3LC 2O5IA 1TWAK 3HOWK 3S16C 5TMFA 3K7AK 2PPBA 5M5YK 5FJ8K 4QIWD 4XLPA 4YG2A 3GTMC 2R92C 5C3EC 3FKIC 1I6VA 3HOUK 4MEYA 4C2MK 3S1QK 2PA8L 1I3QC 3GTPC 1I6HC 4A3KK 2JA8C 3M3YK 3S17C 3S1RK 4A93C 5D4DA 3HOXC 4Q5SA 1I6HK 4A3CK 1R9TC 2VUMK 4LK1A 1TWCK 3GTGK 3S17K 4C3IK 4LJZA 1SFOC 1SMYA 3S1MC 4A3DK 4BY7C 1TWGC 1R9TK 2VUMC 2NVXK 3S14C 1YNJA 2NVTC 4AYBD 2JA5K 5C4XC 3S16K 3S15C 4X6AC 4A3IK 1TWGK 2E2IK 4A3GK 2NVXC 3H0GK 2Y0SL 3GTMK 4BBRC 5IYDC 3GTJC 5C3EK 1TWHC 3HOVC 3CQZK 3H0GC 4YFKA 4BY1K 4A3EK 4A3JK 3DXJA 5M3MK 3M3YC 4A3CC 3RZDC 4A3BC 3HOXK 3HKZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBS C;  2WAQ D;  3I4M C;  5C4J K;  3HOU C;  3GTL K;  5IP9 C;  2PMZ L;  3RZO K;  1Y1W C;  3I4M K;  5TMC A;  2BE5 A;  1HQM A;  4XSZ A;  1Y1V C;  4A3F C;  2E2J C;  1BDF A;  2JA6 K;  4X6A K;  1TWF C;  2R7Z K;  1Y1V K;  2R93 C;  4BXX C;  4A3L K;  3HKZ L;  3WOD A;  2NVY C;  4Y7N C;  4A3F K;  2E2J K;  3CQZ C;  4XSX A;  4BY1 C;  4Y52 C;  3PO2 K;  4BBR K;  3HOV K;  2B63 C;  5M3F K;  4KN4 A;  2NVY K;  4Y7N K;  1ZYR A;  3I4N C;  4C3J K;  4YFX A;  4G7H A;  3M4O C;  3S2H C;  3HOY K;  2E2H K;  3RZO C;  1TWH K;  4QJV B;  4Q4Z A;  3GTL C;  5IYB C;  3H3V D;  4BY7 K;  4NOI A;  2A68 A;  3GTK C;  4QJV A;  1SFO K;  2E2I C;  3PO3 C;  1IW7 A;  2E2H C;  3K7A C;  4QIW L;  5M5W K;  4A3I C;  2YU9 K;  3S14 K;  1I50 K;  4A3E C;  2JA5 C;  3GTQ C;  4A3J C;  4KN7 A;  4OIR A;  2PA8 D;  4OIN A;  1YNN A;  2B63 K;  3GTJ K;  4G7O A;  3FKI K;  3S1Q C;  3S2D C;  2JA7 K;  5IYD K;  4YFN A;  3GTQ K;  5C44 K;  4OIQ A;  1WCM C;  2NVQ K;  4BXX K;  3HOY C;  3I4N K;  3RZD K;  3S1N C;  4GZY A;  5FLM C;  1WCM K;  4C3H K;  2NVQ C;  5M5X K;  5C44 C;  4A3D C;  4A3M C;  1XPP A;  3GTK K;  3PO3 K;  4OIP A;  3GTO K;  4AYB L;  5C4J C;  4A3M K;  2WB1 L;  1TWC C;  2YU9 C;  3GTG C;  3HOZ K;  4XLN A;  1I50 C;  4ZH4 A;  3S2H K;  1TWA C;  3HOW C;  4OIO A;  3S15 K;  1I3Q K;  3GTP K;  3M4O K;  2JA6 C;  4A3K C;  2JA8 K;  4A93 K;  3HOZ C;  4LK0 A;  5IYB K;  3S2D K;  2A6H A;  4KMU A;  2WB1 D;  3PO2 C;  4MQ9 A;  2R92 K;  4Y52 K;  2Y0S D;  2CW0 A;  5IYC K;  1K83 C;  4A3G C;  5FLM K;  4A3B K;  3S1R C;  3S1N K;  2WAQ L;  4JK1 A;  1K83 K;  5C4X K;  2NVT K;  2PMZ D;  5IYC C;  3EQL A;  3H3V L;  5IP7 C;  4G7Z A;  2JA7 C;  5IP9 K;  2A6E A;  3GTO C;  3S1M K;  1Y1W K;  2A69 A;  5IP7 K;  4MEX A;  4BBS K;  4LLG A;  1TWF K;  2R7Z C;  2R93 K;  2O5J A;  4A3L C;  2O5I A;  1TWA K;  3HOW K;  3S16 C;  5TMF A;  3K7A K;  2PPB A;  5M5Y K;  5FJ8 K;  4QIW D;  4XLP A;  4YG2 A;  3GTM C;  2R92 C;  5C3E C;  3FKI C;  1I6V A;  3HOU K;  4MEY A;  4C2M K;  3S1Q K;  2PA8 L;  1I3Q C;  3GTP C;  1I6H C;  4A3K K;  2JA8 C;  3M3Y K;  3S17 C;  3S1R K;  4A93 C;  5D4D A;  3HOX C;  4Q5S A;  1I6H K;  4A3C K;  1R9T C;  2VUM K;  4LK1 A;  1TWC K;  3GTG K;  3S17 K;  4C3I K;  4LJZ A;  1SFO C;  1SMY A;  3S1M C;  4A3D K;  4BY7 C;  1TWG C;  1R9T K;  2VUM C;  2NVX K;  3S14 C;  1YNJ A;  2NVT C;  4AYB D;  2JA5 K;  5C4X C;  3S16 K;  3S15 C;  4X6A C;  4A3I K;  1TWG K;  2E2I K;  4A3G K;  2NVX C;  3H0G K;  2Y0S L;  3GTM K;  4BBR C;  5IYD C;  3GTJ C;  5C3E K;  1TWH C;  3HOV C;  3CQZ K;  3H0G C;  4YFK A;  4BY1 K;  4A3E K;  4A3J K;  3DXJ A;  5M3M K;  3M3Y C;  4A3C C;  3RZD C;  4A3B C;  3HOX K;  3HKZ D; 
#chains in the Genus database with same CATH topology
 2FQT A;  2JA7 A;  1TWF A;  1Y1W C;  3GTO A;  5TJ3 A;  4XSZ A;  1Y1V C;  2JA6 K;  2W7V A;  2R7Z K;  4Y7N C;  3LPX A;  5IOS A;  3CQZ C;  4ILD A;  3HOV K;  2RH6 A;  2B63 C;  4BKW A;  2GSO A;  2NVY K;  3QX3 A;  1TWA A;  3T00 A;  4GFQ A;  4QJV B;  1B4A A;  4QJV A;  1IW7 A;  2ZUF A;  2V6T A;  3GTJ A;  1WQH A;  4A3I C;  1HI9 A;  1EFW A;  3GTQ C;  4OIR A;  2B63 K;  5IYD K;  3AD9 C;  1C0A A;  1SFO A;  2Y3P A;  3HOY C;  4GTL A;  3RZD K;  4FZB A;  1VH2 A;  1PJ6 A;  3OEP A;  4A3M K;  1F93 A;  3GIR A;  3HOZ K;  1TWC C;  1USO A;  3GTG C;  3S2H K;  3HOW C;  3M4O K;  1EH1 A;  3GTP K;  4A93 K;  4LK0 A;  5IYB K;  3ADA C;  1BGW A;  1O25 A;  3PO2 C;  4MQ9 A;  2R92 K;  4KMA A;  2Y0S D;  2CFA A;  4C45 A;  4A3G C;  3N0C A;  5FLM K;  4A3B K;  3S1N K;  2WAQ L;  4G7Z A;  2A6E A;  4KAS A;  2A69 A;  1UV7 A;  4MEX A;  4BBS K;  3A8I A;  3HOW K;  4M1X A;  3TFH A;  3K7A K;  2PPB A;  1WOP A;  1VLO A;  3FKI C;  4MEY A;  3ERE D;  2JA8 C;  4A3C K;  2VUM K;  4C3I K;  2V6U A;  2JA5 A;  3G4C A;  1SMY A;  1G51 A;  2NVX K;  1IQ0 A;  4XCH A;  4A3I K;  4LOW A;  4PAA A;  1J6X A;  1ISE A;  1PJ7 A;  2Y0S L;  3GTM K;  1O26 A;  3H0G C;  4A3E K;  4A3J K;  4A3C C;  2XCR B;  3GTP A;  3SZZ A;  4BLA A;  4BLB A;  3CQZ A;  2WAQ D;  5CHP A;  5EGE A;  5TMC A;  1VJE A;  3AQP A;  2R93 C;  1Y1V K;  4A3L K;  1J98 A;  4XSX A;  3LAJ A;  3Q3Q A;  1IE0 A;  1F7U A;  5M3F K;  3BP8 C;  5E68 A;  1KQ4 A;  4DDQ A;  3GSI A;  1O2B A;  2XCQ A;  4LR2 A;  4YFX A;  3AD8 C;  4G7H A;  1WCM A;  3RZO C;  1TWH K;  1IL2 A;  3GTL C;  3H3V D;  3AQO A;  4NOI A;  1SFO K;  3N0B A;  3K7A C;  3FKI A;  4GTB A;  1I50 K;  1USM A;  4KN7 A;  4J3N A;  1XXA A;  2PA8 D;  5JVO A;  2D6F C;  3FKI K;  3S2D C;  5HL8 A;  4GZY A;  1WQG A;  1J6W A;  4A3D C;  1EK8 A;  2P8T A;  4GTF A;  1XPP A;  3BP3 A;  3GTO K;  4RMF A;  2XCO A;  4AYB L;  4XLN A;  2NVY A;  1WQF A;  1F7V A;  1TWA C;  4OIO A;  1I3Q K;  3GEI A;  4A3K C;  3HOZ C;  5L46 A;  5IOT A;  2WB1 D;  4AH6 A;  4Y52 K;  3CAG A;  2RGR A;  2CW0 A;  5IYC K;  1I50 A;  1O2F B;  3S1R C;  4JK1 A;  1K83 K;  5C4X K;  2V6S A;  2PMZ D;  1WOS A;  3H3V L;  1ZBS A;  2R7Z A;  1TWH A;  5IP7 K;  4KAW X;  2R93 K;  2O5I A;  3S16 C;  5TMF A;  5C3E C;  4C2M K;  1I3Q C;  4A3K K;  1ZQ1 C;  1R9T A;  3S1R K;  1I6H K;  3H0G A;  4FM9 A;  1TWG A;  5CJ9 A;  3S1M C;  4C3I C;  2PHC B;  2R92 A;  2VUM C;  3S14 C;  1YNJ A;  3S16 K;  2E2I K;  1XZP A;  2KWA A;  3HOV C;  3CQZ K;  4YFK A;  1DD5 A;  3V4G A;  2E2I A;  3M3Y C;  1WOO A;  3HOX K;  3HKZ D;  4BBS C;  1K83 A;  5C4J K;  1DCH A;  2R93 A;  3I4M K;  4A3F C;  2E2J C;  1J6V A;  2GSU A;  3L4J A;  4BXX C;  3WOD A;  1RU0 A;  4P9S A;  4BY1 C;  4Y52 C;  1BJT A;  2GSN A;  4WJ3 M;  4KN4 A;  3HXA A;  5IOR A;  3I4N C;  4C3J K;  3M4O C;  3S2H C;  3HOY K;  2E2H K;  3LAP A;  4Q4Z A;  5IYB C;  3GEH A;  4BY7 K;  4KM9 A;  1BS2 A;  2GAG C;  4QIW L;  4A3E C;  2JA5 C;  3T02 A;  4A3J C;  4WJ4 A;  4OIN A;  4G0W A;  3S1Q C;  2P5M A;  1JVI A;  1PJ5 A;  1WCM C;  4BXX K;  3I4N K;  3S1N C;  4KB4 A;  5FLM C;  4C3H K;  2NVQ C;  1O29 A;  5M5X K;  2E2H A;  5C44 C;  1JQW A;  4OIP A;  1F9N A;  1EQR A;  3AH5 A;  3GDZ A;  1DCO A;  4KDD A;  4ZH4 A;  2JA8 K;  1X31 C;  4KMH A;  2A6H A;  2B63 A;  4KMU A;  4WIL A;  4GTA A;  3IPJ A;  3OPF A;  4KB2 A;  2ZFZ A;  1K83 C;  2NVT K;  5IYC C;  3EQL A;  5IP7 C;  2JA6 A;  1Y1W K;  1XZP B;  1ZXO A;  3JST A;  2R7Z C;  3BUE A;  3S0X A;  3T01 A;  3ORE A;  4GT9 A;  4XLP A;  4C2M C;  3GTM C;  2R92 C;  1I6V A;  3HOU K;  2NVX A;  2PA8 L;  3FHZ A;  3GTP C;  1I6H C;  4A93 C;  1INN A;  1O27 A;  5D4D A;  1R9T C;  3S17 K;  4LK1 A;  2VUM A;  1EI6 A;  1V5V A;  4A3D K;  4BY7 C;  1TWG C;  1JOE A;  4AYB D;  2JA5 K;  2NVT C;  3S15 C;  4X6A C;  3FOE A;  1IBA A;  3GTM A;  4BBR C;  5IYD C;  1TWH C;  5M3M K;  3RZD C;  3SZY A;  3TFJ A;  3I4M C;  3HOU C;  3GTL K;  5IP9 C;  2PMZ L;  3RZO K;  3GTK A;  1O24 A;  2BE5 A;  1HQM A;  1BDF A;  5IOQ A;  3NUH A;  2CFA B;  4X6A K;  1TWF C;  1Y1W A;  3HKZ L;  2NVY C;  4A3F K;  2E2J K;  4O2D A;  3PO2 K;  4BBR K;  4Y7N K;  1L0W A;  1ZYR A;  5EGH A;  1WSV A;  3L4K A;  1YCL A;  1ZVU A;  2A68 A;  3GTK C;  2E2I C;  3PO3 C;  2E2H C;  2FQO A;  4G0U A;  3GTQ A;  3GEE A;  5M5W K;  2YU9 K;  3S14 K;  1VGX A;  2ZUE A;  1DCP A;  3AD7 C;  4LQY A;  3TFI A;  1YNN A;  4G7O A;  3GTJ K;  1XZQ B;  2JA7 K;  4YFN A;  3GTQ K;  5C44 K;  4OIQ A;  4C3H C;  2NVQ K;  4KC6 A;  3A8J A;  1WCM K;  1IS1 A;  4A3M C;  3GTK K;  3PO3 K;  1AB4 A;  5C4J C;  3GTL A;  2WB1 L;  2YU9 C;  1I50 C;  1VRQ C;  3S15 K;  2JA6 C;  4KAR A;  1Y1V A;  3S2D K;  3MML B;  3FOF A;  1TWC A;  3GTG A;  1GE9 A;  4P5B A;  4C3J C;  3G4A A;  3TTG A;  4GTD A;  2JA7 C;  5IP9 K;  3GTO C;  2JH3 A;  3S1M K;  2EBB A;  1WIH A;  4LLG A;  1TWF K;  2YU9 A;  4A3L C;  1WOR A;  1TWA K;  4GTE A;  5M5Y K;  5FJ8 K;  4QIW D;  4YG2 A;  3VA7 A;  3S1Q K;  1XZQ A;  3A8K A;  3N3Y A;  1XXB A;  3M3Y K;  3S17 C;  4Q5S A;  3HOX C;  5JFE A;  4G0V A;  4P5A A;  1TWC K;  3GTG K;  1O2A A;  4LJZ A;  1SFO C;  1YX2 A;  1R9T K;  5C4X C;  1TWG K;  4GTC A;  4A3G K;  2NVX C;  1B4B A;  2GAH C;  1XXC A;  3H0G K;  1O28 A;  4KAT A;  3GTJ C;  5C3E K;  4BY1 K;  1WSR A;  4KM8 A;  4PAB A;  3DXJ A;  4KMD A;  2O5J A;  4A3B C;  1I3Q A; 
#chains in the Genus database with same CATH homology
 4BBS C;  2WAQ D;  3I4M C;  5C4J K;  3HOU C;  3GTL K;  5IP9 C;  2PMZ L;  3RZO K;  1Y1W C;  3I4M K;  5TMC A;  2BE5 A;  1HQM A;  4XSZ A;  1Y1V C;  4A3F C;  2E2J C;  1BDF A;  2JA6 K;  4X6A K;  1TWF C;  2R7Z K;  1Y1V K;  2R93 C;  4BXX C;  4A3L K;  3HKZ L;  3WOD A;  2NVY C;  4Y7N C;  4A3F K;  2E2J K;  3CQZ C;  4XSX A;  4BY1 C;  4Y52 C;  3PO2 K;  4BBR K;  3HOV K;  2B63 C;  5M3F K;  4KN4 A;  2NVY K;  4Y7N K;  1ZYR A;  3I4N C;  4C3J K;  4YFX A;  4G7H A;  3M4O C;  3S2H C;  3HOY K;  2E2H K;  3RZO C;  1TWH K;  4QJV B;  4Q4Z A;  3GTL C;  5IYB C;  3H3V D;  4BY7 K;  4NOI A;  2A68 A;  3GTK C;  4QJV A;  1SFO K;  2E2I C;  3PO3 C;  1IW7 A;  2E2H C;  3K7A C;  4QIW L;  5M5W K;  4A3I C;  2YU9 K;  3S14 K;  1I50 K;  4A3E C;  2JA5 C;  3GTQ C;  4A3J C;  4KN7 A;  4OIR A;  2PA8 D;  4OIN A;  1YNN A;  2B63 K;  3GTJ K;  4G7O A;  3FKI K;  3S1Q C;  3S2D C;  2JA7 K;  5IYD K;  4YFN A;  3GTQ K;  5C44 K;  4OIQ A;  1WCM C;  2NVQ K;  4BXX K;  3HOY C;  3I4N K;  3RZD K;  3S1N C;  4GZY A;  5FLM C;  1WCM K;  4C3H K;  2NVQ C;  5M5X K;  5C44 C;  4A3D C;  4A3M C;  1XPP A;  3GTK K;  3PO3 K;  4OIP A;  3GTO K;  4AYB L;  5C4J C;  4A3M K;  2WB1 L;  1TWC C;  2YU9 C;  3GTG C;  3HOZ K;  4XLN A;  1I50 C;  4ZH4 A;  3S2H K;  1TWA C;  3HOW C;  4OIO A;  3S15 K;  1I3Q K;  3GTP K;  3M4O K;  2JA6 C;  4A3K C;  2JA8 K;  4A93 K;  3HOZ C;  4LK0 A;  5IYB K;  3S2D K;  2A6H A;  4KMU A;  2WB1 D;  3PO2 C;  4MQ9 A;  2R92 K;  4Y52 K;  2Y0S D;  2CW0 A;  5IYC K;  1K83 C;  4A3G C;  5FLM K;  4A3B K;  3S1R C;  3S1N K;  2WAQ L;  4JK1 A;  1K83 K;  5C4X K;  2NVT K;  2PMZ D;  5IYC C;  3EQL A;  3H3V L;  5IP7 C;  4G7Z A;  2JA7 C;  5IP9 K;  2A6E A;  3GTO C;  3S1M K;  1Y1W K;  2A69 A;  5IP7 K;  4MEX A;  4BBS K;  4LLG A;  1TWF K;  2R7Z C;  2R93 K;  2O5J A;  4A3L C;  2O5I A;  1TWA K;  3HOW K;  3S16 C;  5TMF A;  3K7A K;  2PPB A;  5M5Y K;  5FJ8 K;  4QIW D;  4XLP A;  4YG2 A;  3GTM C;  2R92 C;  5C3E C;  3FKI C;  1I6V A;  3HOU K;  4MEY A;  4C2M K;  3S1Q K;  2PA8 L;  1I3Q C;  3GTP C;  1I6H C;  4A3K K;  2JA8 C;  3M3Y K;  3S17 C;  3S1R K;  4A93 C;  5D4D A;  3HOX C;  4Q5S A;  1I6H K;  4A3C K;  1R9T C;  2VUM K;  4LK1 A;  1TWC K;  3GTG K;  3S17 K;  4C3I K;  4LJZ A;  1SFO C;  1SMY A;  3S1M C;  4A3D K;  4BY7 C;  1TWG C;  1R9T K;  2VUM C;  2NVX K;  3S14 C;  1YNJ A;  2NVT C;  4AYB D;  2JA5 K;  5C4X C;  3S16 K;  3S15 C;  4X6A C;  4A3I K;  1TWG K;  2E2I K;  4A3G K;  2NVX C;  3H0G K;  2Y0S L;  3GTM K;  4BBR C;  5IYD C;  3GTJ C;  5C3E K;  1TWH C;  3HOV C;  3CQZ K;  3H0G C;  4YFK A;  4BY1 K;  4A3E K;  4A3J K;  3DXJ A;  5M3M K;  3M3Y C;  4A3C C;  3RZD C;  4A3B C;  3HOX K;  3HKZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...