3S1YA

Amp-c beta-lactamase (pseudomonas aeruginosa) in complex with a beta-lactamase inhibitor
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
361
structure length
361
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Side chain SAR of bicyclic Beta-lactamase inhibitors (BLIs). 2. N-Alkylated and open chain analogs of MK-8712
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 127
structure length 361
sequence length 361
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3s1yA00
4E3NA 3PBRA 4DE3A 1TDLA 2Y2QA 3P09A 4WEKA 1S6RA 3GSGA 1E25A 5FASA 3MXRA 5DTTA 3IF6C 5E2EA 4E3KA 1O07A 3N8SA 1BLPA 1KGEA 3HLGA 1JTGA 2WK0A 1HD8A 2Y2JA 4EV4A 2C6WB 3LY4A 4UHUA 3CJMA 2Y91A 4QY5A 3HLEA 1BT5A 4X55A 3TG9A 3UE1A 1K55C 4JF5A 1GHPA 4OOYA 2PU4A 3RXXA 1LI0A 3ZVTA 2HDUA 1HTZA 1TVFA 2FFYA 3MBZA 4WMCA 4QY6A 5EVLA 2ZQCA 3RJUA 1K38A 3QNBA 4CPKA 4PMAA 1PW8A 4OOLA 1NZUA 3BECA 4IVKA 3HREA 4OP5A 5DVAA 3V3RA 2H0TA 1YLJA 5CEBA 3LEZA 2XK1A 3PAGA 4LV1A 2EX2A 3WS1A 3FWLA 4DF6A 3OCLA 5J8XA 4N9KA 3NC8A 3N7WA 5A93A 3WS2A 2XR0A 4R3BA 2J8YA 1MBLA 1W5DA 1O7EA 2ZM8A 5GLAA 4PM6A 4OP8A 3IXBA 4KZ9A 5EVIB 1MY8A 3DW0A 1MPLA 5EVIC 4F94A 3Q07A 1FQGA 3ZG0A 4P87A 3TSGA 4E3LA 4KQQA 4WELA 3HUMA 1W7FA 2BG1A 2Y59A 2EFXA 5E2HA 3VFFA 3C4PA 3O3VA 1GA9A 2HDSA 3OC2A 4OQHA 4S2OA 4X69A 5GLCA 3CMZA 3IWQA 3ZNTA 4EBLA 4K91A 1LI9A 3ZG9B 1YMSA 4S2LA 3P98A 3LY3A 1K56D 1PIOA 5JYOA 1QMEA 5F1GA 3VP3A 2WYXA 5A90A 1K6SA 3EQUA 1EI5A 4B88A 3O86A 2QPNA 5FQKA 3VOYA 4KZ4A 3NBLA 1ERMA 1EWZA 5FATA 3W4PA 2IWBA 3ZG8B 1HVBA 1KE3A 3HBRA 4R0QA 4DE1A 1FR1A 3SH8A 1LL5A 3M6BA 3SS4A 3W4QA 5AQBA 1KGGA 4MEZA 4ZAMA 1Q2PA 5FQ9A 3FZCA 3GR2A 1XP4A 5GHZA 1YLPA 3BLMA 3M2JA 1DJCA 4GD8A 2ZD8A 1SKFA 4DE2A 2Y2KA 5FAQA 3ZFZA 1DJAA 5EVID 3CZDA 5CGWA 4Y0TA 2E8IA 1ES5A 1NRFA 4IVIA 1MKIA 1Y54A 3CG5A 5L2FA 4BQMA 1PI5A 3IXGA 3M2KA 1KVLA 2XFTA 3OCNA 5EE8A 1IKIA 1MWRA 4WMCD 2XGNA 3S22A 5M1AA 5DF9A 5CRFA 4JF4A 1W79A 1FR6A 3IWOA 1IYQA 3ZDJA 2C5WB 2Y2MA 4QHCA 5DTSA 4ZTKA 4OLDA 4LENA 5EECA 4N1HA 1FCMA 3IF5A 3QNCA 3A3DA 4JXGA 3UDFA 4GOGA 1E3UA 4HBTA 2OSUA 1DJBA 2ZLYA 1ES3A 1NYMA 5AQAA 5TGFA 5AQ9A 2XQZA 2HP9A 3ZVWA 5G18A 4GKUA 3VMAA 3PBOA 1NJ4A 4WEJA 3NY4A 3VSKA 4WZ4A 1C3BA 1K4FA 5I94A 5KSCA 4R1GA 5E2GA 3VP1A 3G34A 4GD6A 2WADA 4K0XA 4M3KA 4KZ7A 3A3FA 3DWZA 3BFDA 4L0LA 4CJNA 4E3JA 4OKPA 5HL1A 2UWXA 5KSHA 2V2FF 1IYSA 1LHYA 4WM9A 2WAFA 4RYEA 4JF6A 5CTNA 3SS5A 1ZG4A 2Y2GA 1NZOA 3DTMA 5FI2A 4HEFA 4MNRA 4S2NC 2R9WA 1ONHA 4PM7A 5F83A 3G2ZA 3HL9A 3IT9A 1JWVA 1CI9A 3UE3A 5AQ7A 4E3IA 3A3EA 2GDNA 1LLBA 3G2YA 3N8RA 4X53A 3ISGA 2FFFB 1K6RA 4EBNA 5CHUA 3FYZA 5FAOA 3UO9A 4UA6A 3PBQA 4GDBA 1PW1A 2HP6A 3OZHA 3G35A 2ZC5B 4P6BA 5CTMA 5DTKA 5FAPA 3VP4A 1YT4A 2EXBA 1K54A 4JLFA 3NDGA 3SH9A 1K4EA 1XA1A 4HESA 4FD8A 2ZC3B 3HLFA 4WYYA 4WZ5A 4ZDXA 3Q81A 4LV3A 1K57A 4GB7A 5HARA 3O88A 2OV5A 2ZM2A 3AGFA 3MKFA 1IYPA 4HBUA 4N9LA 1E3UD 2P9VA 4X68A 5EOEA 3W4OA 2XEPA 5A91A 3V50A 3OPLA 3M6HA 1H8YA 5GLDA 2PBYA 2ZQDA 1G68A 4XUZA 1XPBA 4H8RA 2ZQAA 4KG5A 3WS0A 2J7VA 4P0MA 3ZHHA 2Y2PA 3VFHA 3BYDA 4MBHA 1BUEA 4ID4A 4DXCA 4N92A 4BD0A 5E2FA 3PBNA 2WKEA 5EUAA 1BLCA 3GV9A 1E4DA 4GDNA 1K54C 4E3MA 4DXBA 3NCKA 1BZAA 5FI7A 2ZC6B 1KE4A 1ZG6A 4WZ5C 5CHMA 4MBFA 3IQAA 5GHYA 1K57C 3MZFA 3NDEA 4EUZA 3GTCA 2J9OA 4GZBA 2P9VB 1BLSA 1FOFA 3G4PA 5GL9A 1FSYA 2XD1A 4R4SA 3WS4A 3ZNYA 4Q8IA 1M6KA 4UAAA 2A49A 2OLVA 3FKWA 4XUXA 2X71A 4XXRA 1CK3A 3WS5A 5HX9A 3A3IA 2Y2NA 2WKIA 4OPQA 5E43A 4JXWA 2H0YA 1L0DA 2VGKA 4C75A 3IHAA 1XXMA 2G2UA 1YMXA 4Y0OA 4EQIA 1KVMA 2VGJA 4O7DA 3EQVA 3OPRA 2ZQ9A 2RCXA 4WBGA 4GNUA 3C5AA 4B4ZA 2XLNA 2HP5A 5JYPA 1MWUA 2RL3A 5FA7A 2WAEA 4E3OA 1CEFA 3G30A 4S2MA 3ITBA 4D2OA 4B4XA 3BFEA 1NY0A 4KZAA 2ZC4B 5F1FA 3HUNA 2G2WA 2XFSA 4JKTA 3E2KA 5GLBA 1CEGA 1W8QA 4GN2A 4KQRA 3VSLA 4KZ8A 3IXDA 1PYYA 1IELA 1YLYA 2DCFA 1MWTA 2WZZA 1VQQA 1ALQA 1IYOA 1SDNA 2JBFA 4BLMA 1FCOA 1SHVA 1N4OA 2IWDA 4KZBA 3ITAA 4MBKA 4OH0A 4UA7A 5TFQA 3BRMA 3OPPA 2DRWA 3IWIA 4OLGA 1I5QA 4FH4A 1J9MA 4JPMA 5KZHA 4X56A 3AGEA 4ZJ3A 1GA0A 1ONGA 1WE4A 1ZKJA 4RX2A 2PU2A 2P74A 3BM6A 5FSRA 3UDXA 3FKVA 4LCMA 4S2KA 2Y2LA 5HAQA 1L0EA 2CC1A 5U47A 3UDIA 2WKHA 3MZDA 4IBXA 4U0TA 5FDHA 1RGYA 4QU3A 2Z2LB 2ZMAA 3IF6A 3UPPA 1I2SA 4RVAA 1JWZA 1HZOA 4MLLA 2V1ZA 5CECA 3IH8A 1PWDA 3Q82A 4OPYA 1BULA 4OOMA 5CXWA 1YLZA 4OONA 5D3OA 2B5RA 4FCFA 1K25A 1YM1A 3A3JA 1GCEA 1K55A 4KZ6A 5F82A 3I7JA 2ZQ7A 3UNWA 3VP2A 3HUOA 5M19A 5FI6A 1BSGA 2JE5A 3G31A 2XF3A 3UN7A 3BFGA 4ZJ1A 2EXAA 4PPRA 5M18A 1L2SA 3GQZA 3IF6B 1FCNA 5CERA 3BEBA 5FQIA 1YLTA 1YQSA 2QMIA 3PBTA 4N1XA 4PM8A 4YFMA 1IKGA 3QHYA 3HVFA 1SCWA 3LCEA 1RGZA 1S0WA 3BFFA 4KENB 5EOOA 3LO7A 3SS3A 4FH2A 5EVIA 1TDGA 2EX6A 3UPNA 1KDSA 4LV2A 4OVDA 5DF8A 5FQQA 1QMFA 2ZJ9A 4UA9A 4S2IA 1FSWA 1W8YA 4FSFA 2Y4AA 3S1YA 2XD5A 1H5XA 2QZ6A 1BLHA 1XKZA 3MFDA 5EPHA 3ZGAB 3GMWA 1DY6A 3B3XA 4Y0UA 1N9BA 5DF7A 4E6WA 2Y55A 5FQJA 3PTEA 4QB8A 5HAPA 1XGIA 2Q9MA 3HLDA 4KG6A 3C7UA 4KQOA 3N8LA 4OPRA 5CEDA 2OLUA 2Y2HA 3UE0A 1SDEA 3Q1FA 4R3JA 4S2JA 1PWGA 3BLSA 2I72A 2H10A 4LV0A 1TEMA 1I2WA 1JVJA 3GRJA 2X01A 3D4FA 3V39A 4C3QA 2BLSA 3N6IA 1CI8A 1M40A 1OMEA 2Z2MB 5CHJA 5A92A 3TOIA 1Q2QA 2WGVA 3HLBA 4IBRA 3WRTA 3ZG5A 3C7VA 2EX8A 4E6XA 3ZG7B 4C6YA 2V20A 1ESUA 1H8ZA 1LL9A 3AGDA 3NIAA 2HPBA 5HW3A 4BL2A 1KDWA 4PM5A 3PAEA 3V5MA 3SOIA 3DWKA 5BOHA 2ZQ8A 2Q9NA 4BL3A 3WRZA 3E2LA 3C4OA 2J9PA 4ZJ2A 1ERQA 1MXOA 3MXSA 4BD1A 4DDYA 4NETA 1ESIA 3JYIA 5IHVA 2EFUA 1PZOA 4DRTA 4OPZA 2IWCA 3VOZA 3S4XA 1ZC2A 3RXWA 2X02A 4ZBEA 4JXVA 3UY6A 1U60A 5HAIA 5HFOA 4EBPA 2WGIA 1G6AA 3G32A 3ZCZA 2ZM0A 4RX3A 4OQ0A 2H5SA 4DDSA 1NYYA 1YLWA 2WUQA 2A3UA 2Y2OA 4Z9QA 3V3SA 1VM1A 3VP0A 4QD4A 1GHMA 3HLWA 1EROA 3Q7VA 4S2PA 5FQMA 3GVBA 4P85A 3Q7ZA 3IXHA 4IEDA 4EWFA 1AXBA 2R9XA 2Y2IA 1ES4A 2EX9A 1NXYA 4RA7A 4QJGA 4JBFA 4JXSA 2WZXA 2WGWA 5CGXA 1RCJA 3OPHA 3NI9A 1KGFA 4PM9A 4DE0A 1XA7A 4Y7PA 1WYCA 2ZC7A 3MZEA 1PZPA 4BJPA 4LCLA 4NK3A 3IHBA 4U3TA 1L0GA 3N4IA 4A5RA 4U0XA 3PBSA 1WYBA 2XDMA 4S2NA 1ES2A 4X6TA 5GHXA 3MKEA 4OQGA 1GHIA 2HDRA 1BTLA 2XH9A 3O87A 1PI4A 4KG2A 4R4RA 5CGSA 1KE0A 3Q7VB 2HDQA 2JC7A 1IEMA 1XX2A 1MWSA 5KMWA 4DKIA 1PWCA 1Z6FA 3BFCA 4K0WA 3HLCA 4KZ3A 5TR7A 3W8KA 4KZ5A 1JWPA 4YINA 3WWXA 2JCHA 3UPOA 3FV7A 3SH7A 1JTDA 1XGJA 2WGWB 1K56A 4BENA 2DNSA 1L0FA 4OQIA 3IH9A 4R23A 1RP5A
chains in the Genus database with same CATH superfamily
4E3NA 1KOUA 2LB9A 4WEKA 4I3JA 1TF1A 3N8SA 1JTGA 4PKYA 3CJMA 3NJAA 4EQ1A 5LBRA 1BT5A 3H9WA 4OOYA 2PU4A 3UMEA 2HDUA 2FFYA 1TVFA 2BTFP 2ZQCA 4CPKA 1UWNX 4OP5A 2H0TA 1YLJA 5CEBA 3LEZA 4LV1A 2EX2A 3MQQA 3FWLA 1GSVA 3TRCA 5EVEA 3L9KA 2XR0A 4KQDA 4R3BA 1YPRA 4MN6A 3KYEA 1MY8A 4X25A 4E3LA 4WELA 4UQIS 2HDSA 3ZNTA 2V1AA 4G3KA 4EBLA 3V67A 1LI9A 3T4LA 1QMEA 5F1GA 3T1XA 2VEAA 3T12B 5L07A 4B88A 2QPNA 3IS2A 3VOYA 1ODVA 1EWZA 5FATA 3M6BA 1KGGA 4ZAMA 1Q2PA 5FQ9A 2PR6A 4GLQA 4DE2A 2ZD8A 1SKFA 2Y2KA 4WN5A 5FEGA 4Y0TA 2E8IA 1ES5A 3CLOA 4IVIA 1PI5A 4WF0A 2XFTA 3OCNA 1MWRA 3S22A 2QWSA 5DF9A 4Y5FA 1FR6A 3IWOA 1JNUA 3VOLA 1DJBA 4NXFA 3VV4A 3W2ZA 5AQ9A 3F1NB 2XQZA 5G18A 3PBOA 3VSKA 2WKRA 5KSCA 5E2GA 1OJGA 4GD6A 5AVEA 4K0XA 5HZHA 4L0LA 5EM0A 2ZL1A 1S66L 3MS6A 4WM9A 2JHEA 5CTNA 3DTMA 4H6JB 4BBUA 4PM7A 3F1OB 3G2ZA 3HL9A 5AQ7A 2AVXA 2GDNA 3N8RA 5KIZA 2FFFB 3UE6A 3UO9A 1OJ5A 1SZVA 3G35A 1S4RA 2K2NA 4EEUA 3MQOA 3NDGA 3SH9A 4HESA 4FD8A 1OTAA 3Q81A 4HI4A 3GDIA 4HBUA 2JKRM 2XEPA 5A91A 3V50A 3M6HA 2PBYA 4L9GA 4H8RA 1XJ4A 3WS0A 2J7VA 3ZHHA 3VE4A 2Y2PA 1BUEA 1HLUP 3H7WA 5J3WA 5E2FA 3PBNA 4GDNA 4CLCA 4DXBA 1BZAA 4ME4A 1ZG6A 2V9AA 5DJTA 4L9FA 3NDEA 4EUZA 2J9OA 4IJGA 2P9VB 1BLSA 2XD1A 1UWPX 2OLVA 3FKWA 2X71A 2Y2NA 5E43A 2VGKA 2G2UA 2JN7A 3OPRA 2Q0OA 4GNUA 3C5AA 2XRNA 5JYPA 5FA7A 4E3OA 1CEFA 1S67L 3G30A 4S2MA 3HJKA 1NY0A 2ZOHA 5F1FA 4JKTA 3QP8A 1FILA 3CITA 4IHQA 1W8QA 3HCYA 3NOPC 5TBMB 2V1BA 4I39A 1PRQA 1SDNA 4BLMA 4OH0A 1SHVA 3QP2A 3BRMA 3E0YA 3IWIA 2E8JA 1GA0A 1WE4A 1G6OA 5FSRA 4LCMA 5L10A 5HAQA 3MZDA 5CX7A 5FDHA 3MF0A 1JWZA 2V1ZA 4R3AA 3UMDA 3IH8A 1PWDA 1D7EA 5D3OA 1GCEA 1K55A 3I7JA 4YOFA 3HUOA 1BSGA 2MJ6A 2XF3A 4R38A 4D60A 3GQZA 2VGLM 3IF6B 1FCNA 3BEBA 2HGVA 2UV0E 4HIAA 3KYZA 1RGZA 1S0WA 2O0YA 3SS3A 3LO7A 4FH2A 2P08A 4LV2A 4QPRA 3G6OA 4EUVA 2Y4AA 3S1YA 1STZA 1BLHA 1XKZA 3MFDA 5EPHA 3C2WA 4BBVA 3NOTC 3C38A 4KQOA 4OPRA 4WLAA 2DMWA 4R3JA 1PWGA 2H10A 4DMZA 2W3DA 3GRJA 4ARZB 3D4FA 4C3QA 2BLSA 3N6IA 3H82A 2D01A 5A92A 2PAVP 3LR3A 3HLBA 2WKQA 3C7VA 2EX8A 4E6XA 2V20A 1LL9A 4BL2A 1KDWA 3IX3A 3SOIA 3MXSA 5J7EA 5IHVA 4DRTA 2L4RA 3S4XA 3D9YA 1U60A 3IX4A 5HAIA 5HFOA 2WGIA 3G32A 3VE3A 3PR6A 4X1MA 2H5SA 2Y2OA 4I5SA 3VP0A 3Q7VA 4S2PA 1OPXA 2KOIA 4G3VA 2Y2IA 4RA7A 1NXYA 4JXSA 5CGXA 3OPHA 3PHYA 4PM9A 4DE0A 4Y7PA 2W3GA 4BJPA 4LCLA 4NK3A 1L0GA 3N4IA 3QP1A 4Y13A 3CPTB 1Z6FA 3BFCA 4YINA 3FV7A 1OT6A 1K56A 1LSVA 1L0FA 4OQIA 1RP5A 1TDLA 2K7SA 3F1PA 5HPFA 1S6RA 5DTTA 1Y4OA 3IF6C 5E2EA 4E3KA 4I38A 2PT7A 2W0NA 3HLGA 3KYQA 3EEHA 2NUTC 3D3OA 4LGWA 4LFUA 4QY5A 2O99A 4LLOB 1N9NA 4JF5A 1VEUA 1GHPA 3K3CA 5MC7A 2VZWA 3BECA 3HREA 3PAGA 3OCLA 4N9KA 3N7WA 1MBLA 1W5DA 3LI8A 3DW0A 5EVIC 1TS6A 2VV6A 2VGLS 4HJ6A 3ZG0A 1SKOA 1W7FA 1XFQA 3W4PA 2EFXA 3O3VA 3OC2A 4S2OA 2M7UA 3CAXA 5GLCA 1P97A 4K91A 4S2LA 1BYWA 3LY3A 1K56D 5HDCA 3DTKA 5A90A 1XFNA 1EI5A 1LSXA 1ERMA 1HVBA 1KE3A 1FR1A 2VK3A 3W4QA 4Z1WA 3CUEA 3FZCA 1YLPA 3BLMA 3MFXA 4GW9A 1DJAA 1CJFA 3CZDA 5EVID 2L1MA 1NRFA 1MKIA 3M2KA 1KVLA 2B95A 2OWJA 1IKIA 2XGNA 3IS2B 4JF4A 1W79A 1IYQA 3QP5A 2C5WB 4QHCA 4ZTKA 4OLDA 5EECA 3IF5A 3LIAA 1DP6A 3RH8B 1D06A 1NYMA 3ZVWA 2PHYA 3EWKA 1C3BA 1K4FA 5I94A 4R1GA 2OWHA 3A3FA 5HL1A 3BFDA 4E3JA 5KSHA 4BBTA 3SS5A 1ZG4A 5FI2A 4HEFA 1ONHA 4FTXA 3IT9A 1ZTUA 4O8GA 1CI9A 3UE3A 4E3IA 1J3WA 3T4OA 3ISGA 5DKLA 3KO6A 1K6RA 1ACFA 3FYZA 4UA6A 2HP6A 3JPUA 4LRXC 3OZHA 5CTMA 1YT4A 1K54A 2GZAA 1K4EA 4WZ5A 3B47A 3UB5P 1K57A 4GB7A 5HARA 1WA9A 3LGOA 2QHKA 1H8MA 3MKFA 1V9YA 1CF0A 5GLDA 5L8MA 5F6AA 2ZQDA 5DKKA 4XUZA 2XA7M 2ZQAA 4KG5A 3K2NA 4BD0A 3PXPA 1BLCA 3GV9A 4DN0A 1K54C 5FI7A 2ZC6B 4WZ5C 4MBFA 2PYPA 1OTBA 1K57C 5EM1A 2PDRA 4HQAA 4GZBA 1FOFA 3A0VA 4Q8IA 4Y17A 2A49A 4XUXA 3O5YA 4XXRA 4F3LA 3B42A 3DAVA 2M7VA 5HX9A 3A3IA 2V8FA 2QJ5A 3H7WB 2H0YA 4C75A 1YMXA 4X1LA 4O7DA 3EQVA 3MMHA 4CLCB 4I3AA 2ZQ9A 2RCXA 4EEPA 4B4ZA 2XLNA 2VV7A 5I5LA 2GJ3A 3BFEA 2XSSA 3HUNA 3QP4A 3ZQ5A 5HWVA 1CEGA 4YWZA 1OT9A 1PYYA 1MWTA 2WZZA 1VQQA 1IYOA 2V0WA 2JBFA 3S7PA 1FCOA 4UA7A 1F9IA 1N4OA 2IWDA 4KUKA 5HDDA 5TFQA 1YSQA 2PR5A 2DRWA 3OPPA 1J9MA 2J3TC 4JPMA 3R7WA 3AGEA 4GHIA 4ZJ3A 4RX2A 2PU2A 4S2KA 4PHTA 4BMWA 2O9AA 5U47A 3UDIA 3T1SA 2OOLA 1RGYA 3R4KA 2Z2LB 2ZMAA 1I2SA 2J3WA 2B02A 4MLLA 5CECA 5FEFA 1BULA 4OOMA 3BWLA 3JVUA 2B5RA 4FCFA 4KZ6A 3LR0A 3P01A 5M19A 4P6ZM 2GNXA 2J3TD 2EXAA 4MMNA 4DJ2A 1L2SA 5CERA 1L3LA 4R6LA 4N1XA 4RQ9A 3CHWP 3RTYA 4OVDA 3OLOA 5DF8A 4UA9A 4YNRA 3EGXC 1H5XA 2QZ6A 4XT2A 3ZGAB 4HJ4A 2YKHA 3DBAA 4E6WA 1H0MA 5AJGA 2Y55A 3PTEA 5HAPA 3ICYA 2OLUA 3MSHA 2Y2HA 5HWWA 1SDEA 3Q1FA 4HH3A 1DP9A 4B93A 1TEMA 3V39A 3FC7A 5G4YA 2Z2MB 3BQAA 3WRTA 4ETXA 3ZG5A 3ZG7B 3LR4A 2HPBA 4CLCC 3PAEA 4HY8A 2XA7S 5BOHA 3UB6A 2Q9NA 4GCZA 3WRZA 3E2LA 2J9PA 4BWIA 4BD1A 1ZC2A 2LB5A 1NWZA 3H82B 4ZBEA 3KX0X 4EBPA 3ZCZA 3UB7A 4GS9A 1VM1A 2JKTI 3HLWA 1EROA 2NUPC 3GECA 3TE8A 4IEDA 4QJGA 4JBFA 2WGWA 4E04A 3FPVA 4CLCD 4U3TA 2CMNA 3BY8A 4HOIA 4PKYG 4S2NA 1ES2A 4X6TA 2HDRA 1VETA 3F1OA 4EU0A 3O87A 1PI4A 1GSWA 3Q7VB 2HDQA 1XX2A 4Q0HA 3HLCA 5TR7A 1JTDA 3T4QA 4G3WA 3PBRA 4DE3A 3S7NA 1YSPA 1KGEA 1DRMA 3LICA 2WK0A 1TS7A 3LY4A 4Q0JA 3HLEA 3TG9A 1K55C 1HTZA 3RJUA 1K38A 3QNBA 3F1PB 1PW8A 1NZUA 3LEQA 5DVAA 3V3RA 2HJEA 1Z09A 4AFIA 3WS1A 4DF6A 3NC8A 5A93A 3OBFA 2G7UA 1YKDA 1O7EA 2J80A 2ZM8A 5GLAA 4OP8A 3IXBA 4KZ9A 2JKFA 5EVIB 1VEUB 4P87A 4KQQA 3UB8A 3HUMA 2BG1A 2Y59A 3VFFA 3C4PA 1GA9A 1F2KA 4ZRRA 1MC0A 3CMZA 3IWQA 1YMSA 3DTEA 5JYOA 5FDSA 5L09A 1K6SA 4M4XA 3O86A 3BJNA 5FQKA 1P0ZA 4KZ4A 3NBLA 3ZG8B 4R0QA 1SKOB 1XJ6A 5TBMA 2OAQ1 3BQ8A 3SS4A 1LL5A 2Z6DA 4MEZA 1DJCA 4GD8A 4LPZA 5L2FA 4BQMA 3IXGA 3C30A 5HL6A 3ZDJA 2Y2MA 2WKPA 5DTSA 4LENA 1FCMA 3A3DA 4JXGA 4GOGA 4HBTA 2ZLYA 5AQAA 5TGFA 3D72A 4GKUA 1TD5A 4WEJA 4WZ4A 2EA9A 1MKMA 3G34A 2WADA 5DJUA 4KZ7A 3DWZA 4CJNA 4OKPA 2UWXA 2ZMVA 2V2FF 1IYSA 2O9CA 3T4SA 3SW1A 4RYEA 4CLCE 4MNRA 2VJWA 2R9WA 2P04A 1X0OA 4ETZA 3KSHA 4X53A 1LLBA 2XROA 4EBNA 4Q0IA 2PBDP 1PW1A 4P6BA 2ZC5B 5FAPA 1V9ZA 3KSIA 4JLFA 4Y15A 2HF6A 2ZC3B 3HLFA 4WYYA 4ZDXA 2IA2A 3O88A 2OV5A 4CQHA 1IYPA 5EOEA 3E4QA 1S1YA 2V0UA 1XPBA 1F98A 2JKTM 2H28A 3VFHA 4MBHA 4Y2FA 4ID4A 2M1CA 2GX5A 4WUJA 2P7JA 3NULA 1A0KA 3IQAA 4I3IA 2K31A 3MZFA 3GTCA 5GL9A 3G4PA 5HPIA 3WS4A 4MN5A 4UAAA 4MCWA 3C8CA 3WS5A 3QP6A 3IHAA 2L0WA 2VX8A 4QWOA 1MWUA 2RL3A 3MJQA 4B4XA 4KZAA 1D1JA 5F5YA 2ZC4B 2V8CA 2G2WA 5IS1A 4F3LB 1XJ2A 4HH2A 4KZ8A 3DTIA 2DCFA 4NEED 3CUEC 4MBKA 3ITAA 2R78A 4OLGA 4FH4A 3IBJA 5KZHA 4X56A 3A0RA 1ONGA 1W63M 1NLYA 2PYRA 3BM6A 3UDXA 3FKVA 2Y2LA 1L0EA 3S7OA 2CC1A 2WKHA 4U0TA 3UPPA 4RVAA 3MR0A 3TW8A 3NHQA 2FZ0A 3R7WB 4GHIB 1G5UA 1K25A 4R70A 3UNWA 2ZBBA 5AVFA 5FI6A 2JE5A 3UN7A 3BFGA 2ZL1B 4II7A 1F5MA 5HD5A 5M18A 4PPRA 3T4JA 4JGQA 5FQIA 5F68A 1YQSA 3LR5A 3QHYA 1SCWA 3LCEA 4KENB 2INWA 2EX6A 1GSXA 3U4LP 4S2IA 1FSWA 3LUQA 1T1CA 1YAXA 3GMWA 2EWVA 4Y0UA 3B3XA 1P9RA 2Q9MA 3HLDA 4KG6A 4NG2A 5CEDA 5K5BA 3IBRA 3L7HA 3BLSA 1FIKA 1JVJA 3FPWA 1CI8A 2W1TA 1OMEA 5CHJA 3TOIA 4XT2B 2BASA 4IBRA 2ZOIA 1ESUA 3NIAA 4EERA 5HW3A 2QKPA 3DWKA 4BL3A 3C4OA 1ERQA 1MXOA 1DP8A 4DDYA 3CI6A 3JYIA 2EFUA 1PZOA 2IWCA 4HP9A 3RXWA 3EGDC 1PNEA 4L9EA 2X02A 3UY6A 4EW7A 3JVVA 3A0SA 1XJ3A 4OQ0A 2A24A 1LT0A 2B18A 4O0PA 4DDSA 2WUQA 2A3UA 4Z9QA 1N9LA 1GHMA 2ACGA 4NKPA 3GVBA 3LIDA 1AXBA 1ES4A 1AWIA 3U2AA 4B9OA 3UB9A 3NI9A 3MZEA 2A2LA 1PZPA 3IHBA 5G4ZA 2W3HA 3LIEA 3PBSA 2EWWA 1GHIA 1BTLA 1UGUA 4GS9B 4MDZA 4LRZE 1H3QA 3RFBA 1PWCA 4K0WA 3W8KA 4KZ5A 3UPOA 1XGJA 2WGWB 4BENA 2I9VA 4Y3IA 2Y2QA 3P09A 4IUKA 3GSGA 1E25A 5FASA 3MXRA 4WL9A 1VETB 2VKSA 1O07A 1BLPA 4UEYA 2PD7A 1HD8A 2Y2JA 3B33A 2C6WB 4EV4A 5DFXA 4UHUA 3LIBA 2Y91A 4X55A 3UE1A 4HNBA 3RXXA 1LI0A 3ZVTA 2HZ5A 4WMCA 5EVLA 3MBZA 4QY6A 4PMAA 3LIFA 4OOLA 5DFYA 3T4KA 4IVKA 4MN7A 3NOUC 2XK1A 5J8XA 1CQAA 3WS2A 2J8YA 3T1RA 2D02A 4PM6A 1MPLA 4F94A 3Q07A 1FQGA 3TSGA 5E2HA 4OQHA 4X69A 4JGOA 3ZG9B 4FOFA 2W3FA 3P98A 3E98A 1PIOA 3VP3A 4EXOA 2WYXA 5HSQA 3ZYTA 3EQUA 2PD8A 2IWBA 3T4TA 3HBRA 4DE1A 3KSFA 3SH8A 5AQBA 5A8BA 2Y8HA 3GR2A 1XP4A 5GHZA 3F1NA 3M2JA 3T1QB 5FAQA 3ZFZA 1LSWA 5CGWA 2KX6A 1Y54A 3CG5A 5EE8A 4WMCD 5M1AA 5CRFA 1TS0A 4IUHA 1ZHHB 3BW6A 5FL3A 4N1HA 3QNCA 3UDFA 1E3UA 5EV0A 2OSUA 2Y79A 5HWTA 3SZTA 1ES3A 4DJ3A 4H6JA 2HP9A 1TS8A 3VMAA 1NJ4A 2JKGA 3NY4A 3VP1A 4M3KA 5C5KA 3CWFA 1LHYA 4O01A 3EEAA 3TJZC 2WAFA 1T19A 4JF6A 2Y2GA 1NZOA 2Z6CA 3PYPA 4FUWA 3ULFA 5HDSA 4S2NC 5F83A 1JWVA 3A3EA 3G2YA 3KSGA 5CHUA 5FAOA 3PBQA 4GDBA 3IX8A 2VLGA 5EFWA 5DTKA 3VP4A 2EXBA 2VV8A 1T1BA 1XA1A 4LV3A 2KDKA 2ZM2A 3AGFA 4N9LA 4X68A 3W4OA 1E3UD 2P9VA 3OPLA 1H8YA 4LRYC 4P6ZS 4ESPA 1G68A 4P0MA 3BYDA 4DXCA 4N92A 1T18A 2WKEA 5EUAA 1E4DA 4E3MA 3NCKA 1KE4A 5CHMA 5GHYA 1T1AA 4HHDA 2OAP1 1FSYA 4R4SA 2VA0A 3ZNYA 1M6KA 4NXEA 2QJ7A 1CK3A 2WKIA 4OPQA 4EETB 4JXWA 2KLIA 1L0DA 1XXMA 4Y0OA 4EQIA 1KVMA 2VGJA 2W27A 1VHMA 1S1ZA 3LYXA 4K08A 4WBGA 2HP5A 1LL8A 2WAEA 3ITBA 4D2OA 3LFVA 3MXQA 3K3DA 1G28A 2XFSA 3E2KA 5GLBA 4GN2A 4KQRA 2QYBA 3VSLA 3IXDA 1IELA 1YLYA 1ALQA 1VB6A 4KZBA 1N9OA 5HD3A 1I5QA 1ZKJA 4EESA 2P74A 1IOUA 4JGPA 4PAUA 4IBXA 4QU3A 3IF6A 1HZOA 3Q82A 4OPYA 5CXWA 1IFQA 1YLZA 4OONA 1W63Q 1YM1A 3A3JA 3MQ0A 5F82A 2ZQ7A 3VP2A 2HJ9C 3G31A 4ZJ1A 1OTDA 4HP4A 3T50A 1YLTA 4UQIM 2QMIA 3PBTA 4PM8A 4YFMA 1IKGA 3HVFA 3BFFA 3EOIA 3HJIA 1EW0A 5EOOA 5EVIA 1TDGA 3UPNA 1Y28A 1KDSA 4ARZA 5FQQA 3S7QA 1QMFA 2ZJ9A 2W1RA 1W8YA 4FSFA 1OTIA 1P9WA 2XD5A 1S4SA 1DY6A 1N9BA 5DF7A 4KUOA 5FQJA 4QB8A 5IT5A 1XGIA 3C7UA 3N8LA 3UE0A 4S2JA 2PRFA 5TJJA 2I72A 4LV0A 1I2WA 2X01A 1PFLA 3BY9A 1M40A 1NRJA 1Q2QA 2WGVA 4C6YA 1H8ZA 3AGDA 3E4PA 4PM5A 3V5MA 2ZQ8A 4ZJ2A 4NETA 1ESIA 4OPZA 3VOZA 3NECA 3OOVA 2W1TB 4JXVA 1G6AA 1NLZA 2JKRI 2ZM0A 4RX3A 3P7NA 3LI9A 2W3EA 1NYYA 1YLWA 2FH5A 3V3SA 3CPTA 4QD4A 5FQMA 2ZMFA 4GJ4A 4P85A 3Q7ZA 3IXHA 4EWFA 2R9XA 2EX9A 2O9BA 1OTEA 2WZXA 1RCJA 2YKFA 1KGFA 1XA7A 1WYCA 2ZC7A 3FG8A 4NXBA 4A5RA 4U0XA 1WYBA 2XDMA 2A24B 5GHXA 4NXGA 3MKEA 4OQGA 1K0KA 2XH9A 4KG2A 4R4RA 5CGSA 5IU1A 1KE0A 2HV1A 3E4OA 2JC7A 1IEMA 5KMWA 1MWSA 4HJ3A 4DKIA 4KZ3A 4JGRA 1JWPA 3WWXA 2JCHA 5F69A 3SH7A 5J4EA 2DNSA 3IH9A 1MZUA 4R23A
chains in the Genus database with same CATH topology
4E3NA 3PBRA 4DE3A 1TDLA 2Y2QA 3P09A 4WEKA 1S6RA 3GSGA 1E25A 5FASA 3MXRA 5DTTA 3IF6C 5E2EA 4E3KA 1O07A 3N8SA 1BLPA 1KGEA 3HLGA 1JTGA 2WK0A 1HD8A 2Y2JA 4EV4A 2C6WB 3LY4A 4UHUA 3CJMA 2Y91A 4QY5A 3HLEA 1BT5A 4X55A 3TG9A 3UE1A 1K55C 4JF5A 1GHPA 4OOYA 2PU4A 3RXXA 1LI0A 3ZVTA 2HDUA 1HTZA 1TVFA 2FFYA 3MBZA 4WMCA 4QY6A 5EVLA 2ZQCA 3RJUA 1K38A 3QNBA 4CPKA 4PMAA 1PW8A 4OOLA 1NZUA 3BECA 4IVKA 3HREA 4OP5A 5DVAA 3V3RA 2H0TA 1YLJA 5CEBA 3LEZA 2XK1A 3PAGA 4LV1A 2EX2A 3WS1A 3FWLA 4DF6A 3OCLA 5J8XA 4N9KA 3NC8A 3N7WA 5A93A 3WS2A 2XR0A 4R3BA 2J8YA 1MBLA 1W5DA 1O7EA 2ZM8A 5GLAA 4PM6A 4OP8A 3IXBA 4KZ9A 5EVIB 1MY8A 3DW0A 1MPLA 5EVIC 4F94A 3Q07A 1FQGA 3ZG0A 4P87A 3TSGA 4E3LA 4KQQA 4WELA 3HUMA 1W7FA 2BG1A 2Y59A 2EFXA 5E2HA 3VFFA 3C4PA 3O3VA 1GA9A 2HDSA 3OC2A 4OQHA 4S2OA 4X69A 5GLCA 3CMZA 3IWQA 3ZNTA 4EBLA 4K91A 1LI9A 3ZG9B 1YMSA 4S2LA 3P98A 3LY3A 1K56D 1PIOA 5JYOA 1QMEA 5F1GA 3VP3A 2WYXA 5A90A 1K6SA 3EQUA 1EI5A 4B88A 3O86A 2QPNA 5FQKA 3VOYA 4KZ4A 3NBLA 1ERMA 1EWZA 5FATA 3W4PA 2IWBA 3ZG8B 1HVBA 1KE3A 3HBRA 4R0QA 4DE1A 1FR1A 3SH8A 1LL5A 3M6BA 3SS4A 3W4QA 5AQBA 1KGGA 4MEZA 4ZAMA 1Q2PA 5FQ9A 3FZCA 3GR2A 1XP4A 5GHZA 1YLPA 3BLMA 3M2JA 1DJCA 4GD8A 2ZD8A 1SKFA 4DE2A 2Y2KA 5FAQA 3ZFZA 1DJAA 5EVID 3CZDA 5CGWA 4Y0TA 2E8IA 1ES5A 1NRFA 4IVIA 1MKIA 1Y54A 3CG5A 5L2FA 4BQMA 1PI5A 3IXGA 3M2KA 1KVLA 2XFTA 3OCNA 5EE8A 1IKIA 1MWRA 4WMCD 2XGNA 3S22A 5M1AA 5DF9A 5CRFA 4JF4A 1W79A 1FR6A 3IWOA 1IYQA 3ZDJA 2C5WB 2Y2MA 4QHCA 5DTSA 4ZTKA 4OLDA 4LENA 5EECA 4N1HA 1FCMA 3IF5A 3QNCA 3A3DA 4JXGA 3UDFA 4GOGA 1E3UA 4HBTA 2OSUA 1DJBA 2ZLYA 1ES3A 1NYMA 5AQAA 5TGFA 5AQ9A 2XQZA 2HP9A 3ZVWA 5G18A 4GKUA 3VMAA 3PBOA 1NJ4A 4WEJA 3NY4A 3VSKA 4WZ4A 1C3BA 1K4FA 5I94A 5KSCA 4R1GA 5E2GA 3VP1A 3G34A 4GD6A 2WADA 4K0XA 4M3KA 4KZ7A 3A3FA 3DWZA 3BFDA 4L0LA 4CJNA 4E3JA 4OKPA 5HL1A 2UWXA 5KSHA 2V2FF 1IYSA 1LHYA 4WM9A 2WAFA 4RYEA 4JF6A 5CTNA 3SS5A 1ZG4A 2Y2GA 1NZOA 3DTMA 5FI2A 4HEFA 4MNRA 4S2NC 2R9WA 1ONHA 4PM7A 5F83A 3G2ZA 3HL9A 3IT9A 1JWVA 1CI9A 3UE3A 5AQ7A 4E3IA 3A3EA 2GDNA 1LLBA 3G2YA 3N8RA 4X53A 3ISGA 2FFFB 1K6RA 4EBNA 5CHUA 3FYZA 5FAOA 3UO9A 4UA6A 3PBQA 4GDBA 1PW1A 2HP6A 3OZHA 3G35A 2ZC5B 4P6BA 5CTMA 5DTKA 5FAPA 3VP4A 1YT4A 2EXBA 1K54A 4JLFA 3NDGA 3SH9A 1K4EA 1XA1A 4HESA 4FD8A 2ZC3B 3HLFA 4WYYA 4WZ5A 4ZDXA 3Q81A 4LV3A 1K57A 4GB7A 5HARA 3O88A 2OV5A 2ZM2A 3AGFA 3MKFA 1IYPA 4HBUA 4N9LA 1E3UD 2P9VA 4X68A 5EOEA 3W4OA 2XEPA 5A91A 3V50A 3OPLA 3M6HA 1H8YA 5GLDA 2PBYA 2ZQDA 1G68A 4XUZA 1XPBA 4H8RA 2ZQAA 4KG5A 3WS0A 2J7VA 4P0MA 3ZHHA 2Y2PA 3VFHA 3BYDA 4MBHA 1BUEA 4ID4A 4DXCA 4N92A 4BD0A 5E2FA 3PBNA 2WKEA 5EUAA 1BLCA 3GV9A 1E4DA 4GDNA 1K54C 4E3MA 4DXBA 3NCKA 1BZAA 5FI7A 2ZC6B 1KE4A 1ZG6A 4WZ5C 5CHMA 4MBFA 3IQAA 5GHYA 1K57C 3MZFA 3NDEA 4EUZA 3GTCA 2J9OA 4GZBA 2P9VB 1BLSA 1FOFA 3G4PA 5GL9A 1FSYA 2XD1A 4R4SA 3WS4A 3ZNYA 4Q8IA 1M6KA 4UAAA 2A49A 2OLVA 3FKWA 4XUXA 2X71A 4XXRA 1CK3A 3WS5A 5HX9A 3A3IA 2Y2NA 2WKIA 4OPQA 5E43A 4JXWA 2H0YA 1L0DA 2VGKA 4C75A 3IHAA 1XXMA 2G2UA 1YMXA 4Y0OA 4EQIA 1KVMA 2VGJA 4O7DA 3EQVA 3OPRA 2ZQ9A 2RCXA 4WBGA 4GNUA 3C5AA 4B4ZA 2XLNA 2HP5A 5JYPA 1MWUA 2RL3A 5FA7A 2WAEA 4E3OA 1CEFA 3G30A 4S2MA 3ITBA 4D2OA 4B4XA 3BFEA 1NY0A 4KZAA 2ZC4B 5F1FA 3HUNA 2G2WA 2XFSA 4JKTA 3E2KA 5GLBA 1CEGA 1W8QA 4GN2A 4KQRA 3VSLA 4KZ8A 3IXDA 1PYYA 1IELA 1YLYA 2DCFA 1MWTA 2WZZA 1VQQA 1ALQA 1IYOA 1SDNA 2JBFA 4BLMA 1FCOA 1SHVA 1N4OA 2IWDA 4KZBA 3ITAA 4MBKA 4OH0A 4UA7A 5TFQA 3BRMA 3OPPA 2DRWA 3IWIA 4OLGA 1I5QA 4FH4A 1J9MA 4JPMA 5KZHA 4X56A 3AGEA 4ZJ3A 1GA0A 1ONGA 1WE4A 1ZKJA 4RX2A 2PU2A 2P74A 3BM6A 5FSRA 3UDXA 3FKVA 4LCMA 4S2KA 2Y2LA 5HAQA 1L0EA 2CC1A 5U47A 3UDIA 2WKHA 3MZDA 4IBXA 4U0TA 5FDHA 1RGYA 4QU3A 2Z2LB 2ZMAA 3IF6A 3UPPA 1I2SA 4RVAA 1JWZA 1HZOA 4MLLA 2V1ZA 5CECA 3IH8A 1PWDA 3Q82A 4OPYA 1BULA 4OOMA 5CXWA 1YLZA 4OONA 5D3OA 2B5RA 4FCFA 1K25A 1YM1A 3A3JA 1GCEA 1K55A 4KZ6A 5F82A 3I7JA 2ZQ7A 3UNWA 3VP2A 3HUOA 5M19A 5FI6A 1BSGA 2JE5A 3G31A 2XF3A 3UN7A 3BFGA 4ZJ1A 2EXAA 4PPRA 5M18A 1L2SA 3GQZA 3IF6B 1FCNA 5CERA 3BEBA 5FQIA 1YLTA 1YQSA 2QMIA 3PBTA 4N1XA 4PM8A 4YFMA 1IKGA 3QHYA 3HVFA 1SCWA 3LCEA 1RGZA 1S0WA 3BFFA 4KENB 5EOOA 3LO7A 3SS3A 4FH2A 5EVIA 1TDGA 2EX6A 3UPNA 1KDSA 4LV2A 4OVDA 5DF8A 5FQQA 1QMFA 2ZJ9A 4UA9A 4S2IA 1FSWA 1W8YA 4FSFA 2Y4AA 3S1YA 2XD5A 1H5XA 2QZ6A 1BLHA 1XKZA 3MFDA 5EPHA 3ZGAB 3GMWA 1DY6A 3B3XA 4Y0UA 1N9BA 5DF7A 4E6WA 2Y55A 5FQJA 3PTEA 4QB8A 5HAPA 1XGIA 2Q9MA 3HLDA 4KG6A 3C7UA 4KQOA 3N8LA 4OPRA 5CEDA 2OLUA 2Y2HA 3UE0A 1SDEA 3Q1FA 4R3JA 4S2JA 1PWGA 3BLSA 2I72A 2H10A 4LV0A 1TEMA 1I2WA 1JVJA 3GRJA 2X01A 3D4FA 3V39A 4C3QA 2BLSA 3N6IA 1CI8A 1M40A 1OMEA 2Z2MB 5CHJA 5A92A 3TOIA 1Q2QA 2WGVA 3HLBA 4IBRA 3WRTA 3ZG5A 3C7VA 2EX8A 4E6XA 3ZG7B 4C6YA 2V20A 1ESUA 1H8ZA 1LL9A 3AGDA 3NIAA 2HPBA 5HW3A 4BL2A 1KDWA 4PM5A 3PAEA 3V5MA 3SOIA 3DWKA 5BOHA 2ZQ8A 2Q9NA 4BL3A 3WRZA 3E2LA 3C4OA 2J9PA 4ZJ2A 1ERQA 1MXOA 3MXSA 4BD1A 4DDYA 4NETA 1ESIA 3JYIA 5IHVA 2EFUA 1PZOA 4DRTA 4OPZA 2IWCA 3VOZA 3S4XA 1ZC2A 3RXWA 2X02A 4ZBEA 4JXVA 3UY6A 1U60A 5HAIA 5HFOA 4EBPA 2WGIA 1G6AA 3G32A 3ZCZA 2ZM0A 4RX3A 4OQ0A 2H5SA 4DDSA 1NYYA 1YLWA 2WUQA 2A3UA 2Y2OA 4Z9QA 3V3SA 1VM1A 3VP0A 4QD4A 1GHMA 3HLWA 1EROA 3Q7VA 4S2PA 5FQMA 3GVBA 4P85A 3Q7ZA 3IXHA 4IEDA 4EWFA 1AXBA 2R9XA 2Y2IA 1ES4A 2EX9A 1NXYA 4RA7A 4QJGA 4JBFA 4JXSA 2WZXA 2WGWA 5CGXA 1RCJA 3OPHA 3NI9A 1KGFA 4PM9A 4DE0A 1XA7A 4Y7PA 1WYCA 2ZC7A 3MZEA 1PZPA 4BJPA 4LCLA 4NK3A 3IHBA 4U3TA 1L0GA 3N4IA 4A5RA 4U0XA 3PBSA 1WYBA 2XDMA 4S2NA 1ES2A 4X6TA 5GHXA 3MKEA 4OQGA 1GHIA 2HDRA 1BTLA 2XH9A 3O87A 1PI4A 4KG2A 4R4RA 5CGSA 1KE0A 3Q7VB 2HDQA 2JC7A 1IEMA 1XX2A 1MWSA 5KMWA 4DKIA 1PWCA 1Z6FA 3BFCA 4K0WA 3HLCA 4KZ3A 5TR7A 3W8KA 4KZ5A 1JWPA 4YINA 3WWXA 2JCHA 3UPOA 3FV7A 3SH7A 1JTDA 1XGJA 2WGWB 1K56A 4BENA 2DNSA 1L0FA 4OQIA 3IH9A 4R23A 1RP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3N A;  3PBR A;  4DE3 A;  1TDL A;  2Y2Q A;  3P09 A;  4WEK A;  1S6R A;  3GSG A;  1E25 A;  5FAS A;  3MXR A;  5DTT A;  3IF6 C;  5E2E A;  4E3K A;  1O07 A;  3N8S A;  1BLP A;  1KGE A;  3HLG A;  1JTG A;  2WK0 A;  1HD8 A;  2Y2J A;  4EV4 A;  2C6W B;  3LY4 A;  4UHU A;  3CJM A;  2Y91 A;  4QY5 A;  3HLE A;  1BT5 A;  4X55 A;  3TG9 A;  3UE1 A;  1K55 C;  4JF5 A;  1GHP A;  4OOY A;  2PU4 A;  3RXX A;  1LI0 A;  3ZVT A;  2HDU A;  1HTZ A;  1TVF A;  2FFY A;  3MBZ A;  4WMC A;  4QY6 A;  5EVL A;  2ZQC A;  3RJU A;  1K38 A;  3QNB A;  4CPK A;  4PMA A;  1PW8 A;  4OOL A;  1NZU A;  3BEC A;  4IVK A;  3HRE A;  4OP5 A;  5DVA A;  3V3R A;  2H0T A;  1YLJ A;  5CEB A;  3LEZ A;  2XK1 A;  3PAG A;  4LV1 A;  2EX2 A;  3WS1 A;  3FWL A;  4DF6 A;  3OCL A;  5J8X A;  4N9K A;  3NC8 A;  3N7W A;  5A93 A;  3WS2 A;  2XR0 A;  4R3B A;  2J8Y A;  1MBL A;  1W5D A;  1O7E A;  2ZM8 A;  5GLA A;  4PM6 A;  4OP8 A;  3IXB A;  4KZ9 A;  5EVI B;  1MY8 A;  3DW0 A;  1MPL A;  5EVI C;  4F94 A;  3Q07 A;  1FQG A;  3ZG0 A;  4P87 A;  3TSG A;  4E3L A;  4KQQ A;  4WEL A;  3HUM A;  1W7F A;  2BG1 A;  2Y59 A;  2EFX A;  5E2H A;  3VFF A;  3C4P A;  3O3V A;  1GA9 A;  2HDS A;  3OC2 A;  4OQH A;  4S2O A;  4X69 A;  5GLC A;  3CMZ A;  3IWQ A;  3ZNT A;  4EBL A;  4K91 A;  1LI9 A;  3ZG9 B;  1YMS A;  4S2L A;  3P98 A;  3LY3 A;  1K56 D;  1PIO A;  5JYO A;  1QME A;  5F1G A;  3VP3 A;  2WYX A;  5A90 A;  1K6S A;  3EQU A;  1EI5 A;  4B88 A;  3O86 A;  2QPN A;  5FQK A;  3VOY A;  4KZ4 A;  3NBL A;  1ERM A;  1EWZ A;  5FAT A;  3W4P A;  2IWB A;  3ZG8 B;  1HVB A;  1KE3 A;  3HBR A;  4R0Q A;  4DE1 A;  1FR1 A;  3SH8 A;  1LL5 A;  3M6B A;  3SS4 A;  3W4Q A;  5AQB A;  1KGG A;  4MEZ A;  4ZAM A;  1Q2P A;  5FQ9 A;  3FZC A;  3GR2 A;  1XP4 A;  5GHZ A;  1YLP A;  3BLM A;  3M2J A;  1DJC A;  4GD8 A;  2ZD8 A;  1SKF A;  4DE2 A;  2Y2K A;  5FAQ A;  3ZFZ A;  1DJA A;  5EVI D;  3CZD A;  5CGW A;  4Y0T A;  2E8I A;  1ES5 A;  1NRF A;  4IVI A;  1MKI A;  1Y54 A;  3CG5 A;  5L2F A;  4BQM A;  1PI5 A;  3IXG A;  3M2K A;  1KVL A;  2XFT A;  3OCN A;  5EE8 A;  1IKI A;  1MWR A;  4WMC D;  2XGN A;  3S22 A;  5M1A A;  5DF9 A;  5CRF A;  4JF4 A;  1W79 A;  1FR6 A;  3IWO A;  1IYQ A;  3ZDJ A;  2C5W B;  2Y2M A;  4QHC A;  5DTS A;  4ZTK A;  4OLD A;  4LEN A;  5EEC A;  4N1H A;  1FCM A;  3IF5 A;  3QNC A;  3A3D A;  4JXG A;  3UDF A;  4GOG A;  1E3U A;  4HBT A;  2OSU A;  1DJB A;  2ZLY A;  1ES3 A;  1NYM A;  5AQA A;  5TGF A;  5AQ9 A;  2XQZ A;  2HP9 A;  3ZVW A;  5G18 A;  4GKU A;  3VMA A;  3PBO A;  1NJ4 A;  4WEJ A;  3NY4 A;  3VSK A;  4WZ4 A;  1C3B A;  1K4F A;  5I94 A;  5KSC A;  4R1G A;  5E2G A;  3VP1 A;  3G34 A;  4GD6 A;  2WAD A;  4K0X A;  4M3K A;  4KZ7 A;  3A3F A;  3DWZ A;  3BFD A;  4L0L A;  4CJN A;  4E3J A;  4OKP A;  5HL1 A;  2UWX A;  5KSH A;  2V2F F;  1IYS A;  1LHY A;  4WM9 A;  2WAF A;  4RYE A;  4JF6 A;  5CTN A;  3SS5 A;  1ZG4 A;  2Y2G A;  1NZO A;  3DTM A;  5FI2 A;  4HEF A;  4MNR A;  4S2N C;  2R9W A;  1ONH A;  4PM7 A;  5F83 A;  3G2Z A;  3HL9 A;  3IT9 A;  1JWV A;  1CI9 A;  3UE3 A;  5AQ7 A;  4E3I A;  3A3E A;  2GDN A;  1LLB A;  3G2Y A;  3N8R A;  4X53 A;  3ISG A;  2FFF B;  1K6R A;  4EBN A;  5CHU A;  3FYZ A;  5FAO A;  3UO9 A;  4UA6 A;  3PBQ A;  4GDB A;  1PW1 A;  2HP6 A;  3OZH A;  3G35 A;  2ZC5 B;  4P6B A;  5CTM A;  5DTK A;  5FAP A;  3VP4 A;  1YT4 A;  2EXB A;  1K54 A;  4JLF A;  3NDG A;  3SH9 A;  1K4E A;  1XA1 A;  4HES A;  4FD8 A;  2ZC3 B;  3HLF A;  4WYY A;  4WZ5 A;  4ZDX A;  3Q81 A;  4LV3 A;  1K57 A;  4GB7 A;  5HAR A;  3O88 A;  2OV5 A;  2ZM2 A;  3AGF A;  3MKF A;  1IYP A;  4HBU A;  4N9L A;  1E3U D;  2P9V A;  4X68 A;  5EOE A;  3W4O A;  2XEP A;  5A91 A;  3V50 A;  3OPL A;  3M6H A;  1H8Y A;  5GLD A;  2PBY A;  2ZQD A;  1G68 A;  4XUZ A;  1XPB A;  4H8R A;  2ZQA A;  4KG5 A;  3WS0 A;  2J7V A;  4P0M A;  3ZHH A;  2Y2P A;  3VFH A;  3BYD A;  4MBH A;  1BUE A;  4ID4 A;  4DXC A;  4N92 A;  4BD0 A;  5E2F A;  3PBN A;  2WKE A;  5EUA A;  1BLC A;  3GV9 A;  1E4D A;  4GDN A;  1K54 C;  4E3M A;  4DXB A;  3NCK A;  1BZA A;  5FI7 A;  2ZC6 B;  1KE4 A;  1ZG6 A;  4WZ5 C;  5CHM A;  4MBF A;  3IQA A;  5GHY A;  1K57 C;  3MZF A;  3NDE A;  4EUZ A;  3GTC A;  2J9O A;  4GZB A;  2P9V B;  1BLS A;  1FOF A;  3G4P A;  5GL9 A;  1FSY A;  2XD1 A;  4R4S A;  3WS4 A;  3ZNY A;  4Q8I A;  1M6K A;  4UAA A;  2A49 A;  2OLV A;  3FKW A;  4XUX A;  2X71 A;  4XXR A;  1CK3 A;  3WS5 A;  5HX9 A;  3A3I A;  2Y2N A;  2WKI A;  4OPQ A;  5E43 A;  4JXW A;  2H0Y A;  1L0D A;  2VGK A;  4C75 A;  3IHA A;  1XXM A;  2G2U A;  1YMX A;  4Y0O A;  4EQI A;  1KVM A;  2VGJ A;  4O7D A;  3EQV A;  3OPR A;  2ZQ9 A;  2RCX A;  4WBG A;  4GNU A;  3C5A A;  4B4Z A;  2XLN A;  2HP5 A;  5JYP A;  1MWU A;  2RL3 A;  5FA7 A;  2WAE A;  4E3O A;  1CEF A;  3G30 A;  4S2M A;  3ITB A;  4D2O A;  4B4X A;  3BFE A;  1NY0 A;  4KZA A;  2ZC4 B;  5F1F A;  3HUN A;  2G2W A;  2XFS A;  4JKT A;  3E2K A;  5GLB A;  1CEG A;  1W8Q A;  4GN2 A;  4KQR A;  3VSL A;  4KZ8 A;  3IXD A;  1PYY A;  1IEL A;  1YLY A;  2DCF A;  1MWT A;  2WZZ A;  1VQQ A;  1ALQ A;  1IYO A;  1SDN A;  2JBF A;  4BLM A;  1FCO A;  1SHV A;  1N4O A;  2IWD A;  4KZB A;  3ITA A;  4MBK A;  4OH0 A;  4UA7 A;  5TFQ A;  3BRM A;  3OPP A;  2DRW A;  3IWI A;  4OLG A;  1I5Q A;  4FH4 A;  1J9M A;  4JPM A;  5KZH A;  4X56 A;  3AGE A;  4ZJ3 A;  1GA0 A;  1ONG A;  1WE4 A;  1ZKJ A;  4RX2 A;  2PU2 A;  2P74 A;  3BM6 A;  5FSR A;  3UDX A;  3FKV A;  4LCM A;  4S2K A;  2Y2L A;  5HAQ A;  1L0E A;  2CC1 A;  5U47 A;  3UDI A;  2WKH A;  3MZD A;  4IBX A;  4U0T A;  5FDH A;  1RGY A;  4QU3 A;  2Z2L B;  2ZMA A;  3IF6 A;  3UPP A;  1I2S A;  4RVA A;  1JWZ A;  1HZO A;  4MLL A;  2V1Z A;  5CEC A;  3IH8 A;  1PWD A;  3Q82 A;  4OPY A;  1BUL A;  4OOM A;  5CXW A;  1YLZ A;  4OON A;  5D3O A;  2B5R A;  4FCF A;  1K25 A;  1YM1 A;  3A3J A;  1GCE A;  1K55 A;  4KZ6 A;  5F82 A;  3I7J A;  2ZQ7 A;  3UNW A;  3VP2 A;  3HUO A;  5M19 A;  5FI6 A;  1BSG A;  2JE5 A;  3G31 A;  2XF3 A;  3UN7 A;  3BFG A;  4ZJ1 A;  2EXA A;  4PPR A;  5M18 A;  1L2S A;  3GQZ A;  3IF6 B;  1FCN A;  5CER A;  3BEB A;  5FQI A;  1YLT A;  1YQS A;  2QMI A;  3PBT A;  4N1X A;  4PM8 A;  4YFM A;  1IKG A;  3QHY A;  3HVF A;  1SCW A;  3LCE A;  1RGZ A;  1S0W A;  3BFF A;  4KEN B;  5EOO A;  3LO7 A;  3SS3 A;  4FH2 A;  5EVI A;  1TDG A;  2EX6 A;  3UPN A;  1KDS A;  4LV2 A;  4OVD A;  5DF8 A;  5FQQ A;  1QMF A;  2ZJ9 A;  4UA9 A;  4S2I A;  1FSW A;  1W8Y A;  4FSF A;  2Y4A A;  3S1Y A;  2XD5 A;  1H5X A;  2QZ6 A;  1BLH A;  1XKZ A;  3MFD A;  5EPH A;  3ZGA B;  3GMW A;  1DY6 A;  3B3X A;  4Y0U A;  1N9B A;  5DF7 A;  4E6W A;  2Y55 A;  5FQJ A;  3PTE A;  4QB8 A;  5HAP A;  1XGI A;  2Q9M A;  3HLD A;  4KG6 A;  3C7U A;  4KQO A;  3N8L A;  4OPR A;  5CED A;  2OLU A;  2Y2H A;  3UE0 A;  1SDE A;  3Q1F A;  4R3J A;  4S2J A;  1PWG A;  3BLS A;  2I72 A;  2H10 A;  4LV0 A;  1TEM A;  1I2W A;  1JVJ A;  3GRJ A;  2X01 A;  3D4F A;  3V39 A;  4C3Q A;  2BLS A;  3N6I A;  1CI8 A;  1M40 A;  1OME A;  2Z2M B;  5CHJ A;  5A92 A;  3TOI A;  1Q2Q A;  2WGV A;  3HLB A;  4IBR A;  3WRT A;  3ZG5 A;  3C7V A;  2EX8 A;  4E6X A;  3ZG7 B;  4C6Y A;  2V20 A;  1ESU A;  1H8Z A;  1LL9 A;  3AGD A;  3NIA A;  2HPB A;  5HW3 A;  4BL2 A;  1KDW A;  4PM5 A;  3PAE A;  3V5M A;  3SOI A;  3DWK A;  5BOH A;  2ZQ8 A;  2Q9N A;  4BL3 A;  3WRZ A;  3E2L A;  3C4O A;  2J9P A;  4ZJ2 A;  1ERQ A;  1MXO A;  3MXS A;  4BD1 A;  4DDY A;  4NET A;  1ESI A;  3JYI A;  5IHV A;  2EFU A;  1PZO A;  4DRT A;  4OPZ A;  2IWC A;  3VOZ A;  3S4X A;  1ZC2 A;  3RXW A;  2X02 A;  4ZBE A;  4JXV A;  3UY6 A;  1U60 A;  5HAI A;  5HFO A;  4EBP A;  2WGI A;  1G6A A;  3G32 A;  3ZCZ A;  2ZM0 A;  4RX3 A;  4OQ0 A;  2H5S A;  4DDS A;  1NYY A;  1YLW A;  2WUQ A;  2A3U A;  2Y2O A;  4Z9Q A;  3V3S A;  1VM1 A;  3VP0 A;  4QD4 A;  1GHM A;  3HLW A;  1ERO A;  3Q7V A;  4S2P A;  5FQM A;  3GVB A;  4P85 A;  3Q7Z A;  3IXH A;  4IED A;  4EWF A;  1AXB A;  2R9X A;  2Y2I A;  1ES4 A;  2EX9 A;  1NXY A;  4RA7 A;  4QJG A;  4JBF A;  4JXS A;  2WZX A;  2WGW A;  5CGX A;  1RCJ A;  3OPH A;  3NI9 A;  1KGF A;  4PM9 A;  4DE0 A;  1XA7 A;  4Y7P A;  1WYC A;  2ZC7 A;  3MZE A;  1PZP A;  4BJP A;  4LCL A;  4NK3 A;  3IHB A;  4U3T A;  1L0G A;  3N4I A;  4A5R A;  4U0X A;  3PBS A;  1WYB A;  2XDM A;  4S2N A;  1ES2 A;  4X6T A;  5GHX A;  3MKE A;  4OQG A;  1GHI A;  2HDR A;  1BTL A;  2XH9 A;  3O87 A;  1PI4 A;  4KG2 A;  4R4R A;  5CGS A;  1KE0 A;  3Q7V B;  2HDQ A;  2JC7 A;  1IEM A;  1XX2 A;  1MWS A;  5KMW A;  4DKI A;  1PWC A;  1Z6F A;  3BFC A;  4K0W A;  3HLC A;  4KZ3 A;  5TR7 A;  3W8K A;  4KZ5 A;  1JWP A;  4YIN A;  3WWX A;  2JCH A;  3UPO A;  3FV7 A;  3SH7 A;  1JTD A;  1XGJ A;  2WGW B;  1K56 A;  4BEN A;  2DNS A;  1L0F A;  4OQI A;  3IH9 A;  4R23 A;  1RP5 A; 
#chains in the Genus database with same CATH topology
 4E3N A;  1KOU A;  2LB9 A;  4WEK A;  4I3J A;  1TF1 A;  3N8S A;  1JTG A;  4PKY A;  3CJM A;  3NJA A;  4EQ1 A;  5LBR A;  1BT5 A;  3H9W A;  4OOY A;  2PU4 A;  3UME A;  2HDU A;  2FFY A;  1TVF A;  2BTF P;  2ZQC A;  4CPK A;  1UWN X;  4OP5 A;  2H0T A;  1YLJ A;  5CEB A;  3LEZ A;  4LV1 A;  2EX2 A;  3MQQ A;  3FWL A;  1GSV A;  3TRC A;  5EVE A;  3L9K A;  2XR0 A;  4KQD A;  4R3B A;  1YPR A;  4MN6 A;  3KYE A;  1MY8 A;  4X25 A;  4E3L A;  4WEL A;  4UQI S;  2HDS A;  3ZNT A;  2V1A A;  4G3K A;  4EBL A;  3V67 A;  1LI9 A;  3T4L A;  1QME A;  5F1G A;  3T1X A;  2VEA A;  3T12 B;  5L07 A;  4B88 A;  2QPN A;  3IS2 A;  3VOY A;  1ODV A;  1EWZ A;  5FAT A;  3M6B A;  1KGG A;  4ZAM A;  1Q2P A;  5FQ9 A;  2PR6 A;  4GLQ A;  4DE2 A;  2ZD8 A;  1SKF A;  2Y2K A;  4WN5 A;  5FEG A;  4Y0T A;  2E8I A;  1ES5 A;  3CLO A;  4IVI A;  1PI5 A;  4WF0 A;  2XFT A;  3OCN A;  1MWR A;  3S22 A;  2QWS A;  5DF9 A;  4Y5F A;  1FR6 A;  3IWO A;  1JNU A;  3VOL A;  1DJB A;  4NXF A;  3VV4 A;  3W2Z A;  5AQ9 A;  3F1N B;  2XQZ A;  5G18 A;  3PBO A;  3VSK A;  2WKR A;  5KSC A;  5E2G A;  1OJG A;  4GD6 A;  5AVE A;  4K0X A;  5HZH A;  4L0L A;  5EM0 A;  2ZL1 A;  1S66 L;  3MS6 A;  4WM9 A;  2JHE A;  5CTN A;  3DTM A;  4H6J B;  4BBU A;  4PM7 A;  3F1O B;  3G2Z A;  3HL9 A;  5AQ7 A;  2AVX A;  2GDN A;  3N8R A;  5KIZ A;  2FFF B;  3UE6 A;  3UO9 A;  1OJ5 A;  1SZV A;  3G35 A;  1S4R A;  2K2N A;  4EEU A;  3MQO A;  3NDG A;  3SH9 A;  4HES A;  4FD8 A;  1OTA A;  3Q81 A;  4HI4 A;  3GDI A;  4HBU A;  2JKR M;  2XEP A;  5A91 A;  3V50 A;  3M6H A;  2PBY A;  4L9G A;  4H8R A;  1XJ4 A;  3WS0 A;  2J7V A;  3ZHH A;  3VE4 A;  2Y2P A;  1BUE A;  1HLU P;  3H7W A;  5J3W A;  5E2F A;  3PBN A;  4GDN A;  4CLC A;  4DXB A;  1BZA A;  4ME4 A;  1ZG6 A;  2V9A A;  5DJT A;  4L9F A;  3NDE A;  4EUZ A;  2J9O A;  4IJG A;  2P9V B;  1BLS A;  2XD1 A;  1UWP X;  2OLV A;  3FKW A;  2X71 A;  2Y2N A;  5E43 A;  2VGK A;  2G2U A;  2JN7 A;  3OPR A;  2Q0O A;  4GNU A;  3C5A A;  2XRN A;  5JYP A;  5FA7 A;  4E3O A;  1CEF A;  1S67 L;  3G30 A;  4S2M A;  3HJK A;  1NY0 A;  2ZOH A;  5F1F A;  4JKT A;  3QP8 A;  1FIL A;  3CIT A;  4IHQ A;  1W8Q A;  3HCY A;  3NOP C;  5TBM B;  2V1B A;  4I39 A;  1PRQ A;  1SDN A;  4BLM A;  4OH0 A;  1SHV A;  3QP2 A;  3BRM A;  3E0Y A;  3IWI A;  2E8J A;  1GA0 A;  1WE4 A;  1G6O A;  5FSR A;  4LCM A;  5L10 A;  5HAQ A;  3MZD A;  5CX7 A;  5FDH A;  3MF0 A;  1JWZ A;  2V1Z A;  4R3A A;  3UMD A;  3IH8 A;  1PWD A;  1D7E A;  5D3O A;  1GCE A;  1K55 A;  3I7J A;  4YOF A;  3HUO A;  1BSG A;  2MJ6 A;  2XF3 A;  4R38 A;  4D60 A;  3GQZ A;  2VGL M;  3IF6 B;  1FCN A;  3BEB A;  2HGV A;  2UV0 E;  4HIA A;  3KYZ A;  1RGZ A;  1S0W A;  2O0Y A;  3SS3 A;  3LO7 A;  4FH2 A;  2P08 A;  4LV2 A;  4QPR A;  3G6O A;  4EUV A;  2Y4A A;  3S1Y A;  1STZ A;  1BLH A;  1XKZ A;  3MFD A;  5EPH A;  3C2W A;  4BBV A;  3NOT C;  3C38 A;  4KQO A;  4OPR A;  4WLA A;  2DMW A;  4R3J A;  1PWG A;  2H10 A;  4DMZ A;  2W3D A;  3GRJ A;  4ARZ B;  3D4F A;  4C3Q A;  2BLS A;  3N6I A;  3H82 A;  2D01 A;  5A92 A;  2PAV P;  3LR3 A;  3HLB A;  2WKQ A;  3C7V A;  2EX8 A;  4E6X A;  2V20 A;  1LL9 A;  4BL2 A;  1KDW A;  3IX3 A;  3SOI A;  3MXS A;  5J7E A;  5IHV A;  4DRT A;  2L4R A;  3S4X A;  3D9Y A;  1U60 A;  3IX4 A;  5HAI A;  5HFO A;  2WGI A;  3G32 A;  3VE3 A;  3PR6 A;  4X1M A;  2H5S A;  2Y2O A;  4I5S A;  3VP0 A;  3Q7V A;  4S2P A;  1OPX A;  2KOI A;  4G3V A;  2Y2I A;  4RA7 A;  1NXY A;  4JXS A;  5CGX A;  3OPH A;  3PHY A;  4PM9 A;  4DE0 A;  4Y7P A;  2W3G A;  4BJP A;  4LCL A;  4NK3 A;  1L0G A;  3N4I A;  3QP1 A;  4Y13 A;  3CPT B;  1Z6F A;  3BFC A;  4YIN A;  3FV7 A;  1OT6 A;  1K56 A;  1LSV A;  1L0F A;  4OQI A;  1RP5 A;  1TDL A;  2K7S A;  3F1P A;  5HPF A;  1S6R A;  5DTT A;  1Y4O A;  3IF6 C;  5E2E A;  4E3K A;  4I38 A;  2PT7 A;  2W0N A;  3HLG A;  3KYQ A;  3EEH A;  2NUT C;  3D3O A;  4LGW A;  4LFU A;  4QY5 A;  2O99 A;  4LLO B;  1N9N A;  4JF5 A;  1VEU A;  1GHP A;  3K3C A;  5MC7 A;  2VZW A;  3BEC A;  3HRE A;  3PAG A;  3OCL A;  4N9K A;  3N7W A;  1MBL A;  1W5D A;  3LI8 A;  3DW0 A;  5EVI C;  1TS6 A;  2VV6 A;  2VGL S;  4HJ6 A;  3ZG0 A;  1SKO A;  1W7F A;  1XFQ A;  3W4P A;  2EFX A;  3O3V A;  3OC2 A;  4S2O A;  2M7U A;  3CAX A;  5GLC A;  1P97 A;  4K91 A;  4S2L A;  1BYW A;  3LY3 A;  1K56 D;  5HDC A;  3DTK A;  5A90 A;  1XFN A;  1EI5 A;  1LSX A;  1ERM A;  1HVB A;  1KE3 A;  1FR1 A;  2VK3 A;  3W4Q A;  4Z1W A;  3CUE A;  3FZC A;  1YLP A;  3BLM A;  3MFX A;  4GW9 A;  1DJA A;  1CJF A;  3CZD A;  5EVI D;  2L1M A;  1NRF A;  1MKI A;  3M2K A;  1KVL A;  2B95 A;  2OWJ A;  1IKI A;  2XGN A;  3IS2 B;  4JF4 A;  1W79 A;  1IYQ A;  3QP5 A;  2C5W B;  4QHC A;  4ZTK A;  4OLD A;  5EEC A;  3IF5 A;  3LIA A;  1DP6 A;  3RH8 B;  1D06 A;  1NYM A;  3ZVW A;  2PHY A;  3EWK A;  1C3B A;  1K4F A;  5I94 A;  4R1G A;  2OWH A;  3A3F A;  5HL1 A;  3BFD A;  4E3J A;  5KSH A;  4BBT A;  3SS5 A;  1ZG4 A;  5FI2 A;  4HEF A;  1ONH A;  4FTX A;  3IT9 A;  1ZTU A;  4O8G A;  1CI9 A;  3UE3 A;  4E3I A;  1J3W A;  3T4O A;  3ISG A;  5DKL A;  3KO6 A;  1K6R A;  1ACF A;  3FYZ A;  4UA6 A;  2HP6 A;  3JPU A;  4LRX C;  3OZH A;  5CTM A;  1YT4 A;  1K54 A;  2GZA A;  1K4E A;  4WZ5 A;  3B47 A;  3UB5 P;  1K57 A;  4GB7 A;  5HAR A;  1WA9 A;  3LGO A;  2QHK A;  1H8M A;  3MKF A;  1V9Y A;  1CF0 A;  5GLD A;  5L8M A;  5F6A A;  2ZQD A;  5DKK A;  4XUZ A;  2XA7 M;  2ZQA A;  4KG5 A;  3K2N A;  4BD0 A;  3PXP A;  1BLC A;  3GV9 A;  4DN0 A;  1K54 C;  5FI7 A;  2ZC6 B;  4WZ5 C;  4MBF A;  2PYP A;  1OTB A;  1K57 C;  5EM1 A;  2PDR A;  4HQA A;  4GZB A;  1FOF A;  3A0V A;  4Q8I A;  4Y17 A;  2A49 A;  4XUX A;  3O5Y A;  4XXR A;  4F3L A;  3B42 A;  3DAV A;  2M7V A;  5HX9 A;  3A3I A;  2V8F A;  2QJ5 A;  3H7W B;  2H0Y A;  4C75 A;  1YMX A;  4X1L A;  4O7D A;  3EQV A;  3MMH A;  4CLC B;  4I3A A;  2ZQ9 A;  2RCX A;  4EEP A;  4B4Z A;  2XLN A;  2VV7 A;  5I5L A;  2GJ3 A;  3BFE A;  2XSS A;  3HUN A;  3QP4 A;  3ZQ5 A;  5HWV A;  1CEG A;  4YWZ A;  1OT9 A;  1PYY A;  1MWT A;  2WZZ A;  1VQQ A;  1IYO A;  2V0W A;  2JBF A;  3S7P A;  1FCO A;  4UA7 A;  1F9I A;  1N4O A;  2IWD A;  4KUK A;  5HDD A;  5TFQ A;  1YSQ A;  2PR5 A;  2DRW A;  3OPP A;  1J9M A;  2J3T C;  4JPM A;  3R7W A;  3AGE A;  4GHI A;  4ZJ3 A;  4RX2 A;  2PU2 A;  4S2K A;  4PHT A;  4BMW A;  2O9A A;  5U47 A;  3UDI A;  3T1S A;  2OOL A;  1RGY A;  3R4K A;  2Z2L B;  2ZMA A;  1I2S A;  2J3W A;  2B02 A;  4MLL A;  5CEC A;  5FEF A;  1BUL A;  4OOM A;  3BWL A;  3JVU A;  2B5R A;  4FCF A;  4KZ6 A;  3LR0 A;  3P01 A;  5M19 A;  4P6Z M;  2GNX A;  2J3T D;  2EXA A;  4MMN A;  4DJ2 A;  1L2S A;  5CER A;  1L3L A;  4R6L A;  4N1X A;  4RQ9 A;  3CHW P;  3RTY A;  4OVD A;  3OLO A;  5DF8 A;  4UA9 A;  4YNR A;  3EGX C;  1H5X A;  2QZ6 A;  4XT2 A;  3ZGA B;  4HJ4 A;  2YKH A;  3DBA A;  4E6W A;  1H0M A;  5AJG A;  2Y55 A;  3PTE A;  5HAP A;  3ICY A;  2OLU A;  3MSH A;  2Y2H A;  5HWW A;  1SDE A;  3Q1F A;  4HH3 A;  1DP9 A;  4B93 A;  1TEM A;  3V39 A;  3FC7 A;  5G4Y A;  2Z2M B;  3BQA A;  3WRT A;  4ETX A;  3ZG5 A;  3ZG7 B;  3LR4 A;  2HPB A;  4CLC C;  3PAE A;  4HY8 A;  2XA7 S;  5BOH A;  3UB6 A;  2Q9N A;  4GCZ A;  3WRZ A;  3E2L A;  2J9P A;  4BWI A;  4BD1 A;  1ZC2 A;  2LB5 A;  1NWZ A;  3H82 B;  4ZBE A;  3KX0 X;  4EBP A;  3ZCZ A;  3UB7 A;  4GS9 A;  1VM1 A;  2JKT I;  3HLW A;  1ERO A;  2NUP C;  3GEC A;  3TE8 A;  4IED A;  4QJG A;  4JBF A;  2WGW A;  4E04 A;  3FPV A;  4CLC D;  4U3T A;  2CMN A;  3BY8 A;  4HOI A;  4PKY G;  4S2N A;  1ES2 A;  4X6T A;  2HDR A;  1VET A;  3F1O A;  4EU0 A;  3O87 A;  1PI4 A;  1GSW A;  3Q7V B;  2HDQ A;  1XX2 A;  4Q0H A;  3HLC A;  5TR7 A;  1JTD A;  3T4Q A;  4G3W A;  3PBR A;  4DE3 A;  3S7N A;  1YSP A;  1KGE A;  1DRM A;  3LIC A;  2WK0 A;  1TS7 A;  3LY4 A;  4Q0J A;  3HLE A;  3TG9 A;  1K55 C;  1HTZ A;  3RJU A;  1K38 A;  3QNB A;  3F1P B;  1PW8 A;  1NZU A;  3LEQ A;  5DVA A;  3V3R A;  2HJE A;  1Z09 A;  4AFI A;  3WS1 A;  4DF6 A;  3NC8 A;  5A93 A;  3OBF A;  2G7U A;  1YKD A;  1O7E A;  2J80 A;  2ZM8 A;  5GLA A;  4OP8 A;  3IXB A;  4KZ9 A;  2JKF A;  5EVI B;  1VEU B;  4P87 A;  4KQQ A;  3UB8 A;  3HUM A;  2BG1 A;  2Y59 A;  3VFF A;  3C4P A;  1GA9 A;  1F2K A;  4ZRR A;  1MC0 A;  3CMZ A;  3IWQ A;  1YMS A;  3DTE A;  5JYO A;  5FDS A;  5L09 A;  1K6S A;  4M4X A;  3O86 A;  3BJN A;  5FQK A;  1P0Z A;  4KZ4 A;  3NBL A;  3ZG8 B;  4R0Q A;  1SKO B;  1XJ6 A;  5TBM A;  2OAQ 1;  3BQ8 A;  3SS4 A;  1LL5 A;  2Z6D A;  4MEZ A;  1DJC A;  4GD8 A;  4LPZ A;  5L2F A;  4BQM A;  3IXG A;  3C30 A;  5HL6 A;  3ZDJ A;  2Y2M A;  2WKP A;  5DTS A;  4LEN A;  1FCM A;  3A3D A;  4JXG A;  4GOG A;  4HBT A;  2ZLY A;  5AQA A;  5TGF A;  3D72 A;  4GKU A;  1TD5 A;  4WEJ A;  4WZ4 A;  2EA9 A;  1MKM A;  3G34 A;  2WAD A;  5DJU A;  4KZ7 A;  3DWZ A;  4CJN A;  4OKP A;  2UWX A;  2ZMV A;  2V2F F;  1IYS A;  2O9C A;  3T4S A;  3SW1 A;  4RYE A;  4CLC E;  4MNR A;  2VJW A;  2R9W A;  2P04 A;  1X0O A;  4ETZ A;  3KSH A;  4X53 A;  1LLB A;  2XRO A;  4EBN A;  4Q0I A;  2PBD P;  1PW1 A;  4P6B A;  2ZC5 B;  5FAP A;  1V9Z A;  3KSI A;  4JLF A;  4Y15 A;  2HF6 A;  2ZC3 B;  3HLF A;  4WYY A;  4ZDX A;  2IA2 A;  3O88 A;  2OV5 A;  4CQH A;  1IYP A;  5EOE A;  3E4Q A;  1S1Y A;  2V0U A;  1XPB A;  1F98 A;  2JKT M;  2H28 A;  3VFH A;  4MBH A;  4Y2F A;  4ID4 A;  2M1C A;  2GX5 A;  4WUJ A;  2P7J A;  3NUL A;  1A0K A;  3IQA A;  4I3I A;  2K31 A;  3MZF A;  3GTC A;  5GL9 A;  3G4P A;  5HPI A;  3WS4 A;  4MN5 A;  4UAA A;  4MCW A;  3C8C A;  3WS5 A;  3QP6 A;  3IHA A;  2L0W A;  2VX8 A;  4QWO A;  1MWU A;  2RL3 A;  3MJQ A;  4B4X A;  4KZA A;  1D1J A;  5F5Y A;  2ZC4 B;  2V8C A;  2G2W A;  5IS1 A;  4F3L B;  1XJ2 A;  4HH2 A;  4KZ8 A;  3DTI A;  2DCF A;  4NEE D;  3CUE C;  4MBK A;  3ITA A;  2R78 A;  4OLG A;  4FH4 A;  3IBJ A;  5KZH A;  4X56 A;  3A0R A;  1ONG A;  1W63 M;  1NLY A;  2PYR A;  3BM6 A;  3UDX A;  3FKV A;  2Y2L A;  1L0E A;  3S7O A;  2CC1 A;  2WKH A;  4U0T A;  3UPP A;  4RVA A;  3MR0 A;  3TW8 A;  3NHQ A;  2FZ0 A;  3R7W B;  4GHI B;  1G5U A;  1K25 A;  4R70 A;  3UNW A;  2ZBB A;  5AVF A;  5FI6 A;  2JE5 A;  3UN7 A;  3BFG A;  2ZL1 B;  4II7 A;  1F5M A;  5HD5 A;  5M18 A;  4PPR A;  3T4J A;  4JGQ A;  5FQI A;  5F68 A;  1YQS A;  3LR5 A;  3QHY A;  1SCW A;  3LCE A;  4KEN B;  2INW A;  2EX6 A;  1GSX A;  3U4L P;  4S2I A;  1FSW A;  3LUQ A;  1T1C A;  1YAX A;  3GMW A;  2EWV A;  4Y0U A;  3B3X A;  1P9R A;  2Q9M A;  3HLD A;  4KG6 A;  4NG2 A;  5CED A;  5K5B A;  3IBR A;  3L7H A;  3BLS A;  1FIK A;  1JVJ A;  3FPW A;  1CI8 A;  2W1T A;  1OME A;  5CHJ A;  3TOI A;  4XT2 B;  2BAS A;  4IBR A;  2ZOI A;  1ESU A;  3NIA A;  4EER A;  5HW3 A;  2QKP A;  3DWK A;  4BL3 A;  3C4O A;  1ERQ A;  1MXO A;  1DP8 A;  4DDY A;  3CI6 A;  3JYI A;  2EFU A;  1PZO A;  2IWC A;  4HP9 A;  3RXW A;  3EGD C;  1PNE A;  4L9E A;  2X02 A;  3UY6 A;  4EW7 A;  3JVV A;  3A0S A;  1XJ3 A;  4OQ0 A;  2A24 A;  1LT0 A;  2B18 A;  4O0P A;  4DDS A;  2WUQ A;  2A3U A;  4Z9Q A;  1N9L A;  1GHM A;  2ACG A;  4NKP A;  3GVB A;  3LID A;  1AXB A;  1ES4 A;  1AWI A;  3U2A A;  4B9O A;  3UB9 A;  3NI9 A;  3MZE A;  2A2L A;  1PZP A;  3IHB A;  5G4Z A;  2W3H A;  3LIE A;  3PBS A;  2EWW A;  1GHI A;  1BTL A;  1UGU A;  4GS9 B;  4MDZ A;  4LRZ E;  1H3Q A;  3RFB A;  1PWC A;  4K0W A;  3W8K A;  4KZ5 A;  3UPO A;  1XGJ A;  2WGW B;  4BEN A;  2I9V A;  4Y3I A;  2Y2Q A;  3P09 A;  4IUK A;  3GSG A;  1E25 A;  5FAS A;  3MXR A;  4WL9 A;  1VET B;  2VKS A;  1O07 A;  1BLP A;  4UEY A;  2PD7 A;  1HD8 A;  2Y2J A;  3B33 A;  2C6W B;  4EV4 A;  5DFX A;  4UHU A;  3LIB A;  2Y91 A;  4X55 A;  3UE1 A;  4HNB A;  3RXX A;  1LI0 A;  3ZVT A;  2HZ5 A;  4WMC A;  5EVL A;  3MBZ A;  4QY6 A;  4PMA A;  3LIF A;  4OOL A;  5DFY A;  3T4K A;  4IVK A;  4MN7 A;  3NOU C;  2XK1 A;  5J8X A;  1CQA A;  3WS2 A;  2J8Y A;  3T1R A;  2D02 A;  4PM6 A;  1MPL A;  4F94 A;  3Q07 A;  1FQG A;  3TSG A;  5E2H A;  4OQH A;  4X69 A;  4JGO A;  3ZG9 B;  4FOF A;  2W3F A;  3P98 A;  3E98 A;  1PIO A;  3VP3 A;  4EXO A;  2WYX A;  5HSQ A;  3ZYT A;  3EQU A;  2PD8 A;  2IWB A;  3T4T A;  3HBR A;  4DE1 A;  3KSF A;  3SH8 A;  5AQB A;  5A8B A;  2Y8H A;  3GR2 A;  1XP4 A;  5GHZ A;  3F1N A;  3M2J A;  3T1Q B;  5FAQ A;  3ZFZ A;  1LSW A;  5CGW A;  2KX6 A;  1Y54 A;  3CG5 A;  5EE8 A;  4WMC D;  5M1A A;  5CRF A;  1TS0 A;  4IUH A;  1ZHH B;  3BW6 A;  5FL3 A;  4N1H A;  3QNC A;  3UDF A;  1E3U A;  5EV0 A;  2OSU A;  2Y79 A;  5HWT A;  3SZT A;  1ES3 A;  4DJ3 A;  4H6J A;  2HP9 A;  1TS8 A;  3VMA A;  1NJ4 A;  2JKG A;  3NY4 A;  3VP1 A;  4M3K A;  5C5K A;  3CWF A;  1LHY A;  4O01 A;  3EEA A;  3TJZ C;  2WAF A;  1T19 A;  4JF6 A;  2Y2G A;  1NZO A;  2Z6C A;  3PYP A;  4FUW A;  3ULF A;  5HDS A;  4S2N C;  5F83 A;  1JWV A;  3A3E A;  3G2Y A;  3KSG A;  5CHU A;  5FAO A;  3PBQ A;  4GDB A;  3IX8 A;  2VLG A;  5EFW A;  5DTK A;  3VP4 A;  2EXB A;  2VV8 A;  1T1B A;  1XA1 A;  4LV3 A;  2KDK A;  2ZM2 A;  3AGF A;  4N9L A;  4X68 A;  3W4O A;  1E3U D;  2P9V A;  3OPL A;  1H8Y A;  4LRY C;  4P6Z S;  4ESP A;  1G68 A;  4P0M A;  3BYD A;  4DXC A;  4N92 A;  1T18 A;  2WKE A;  5EUA A;  1E4D A;  4E3M A;  3NCK A;  1KE4 A;  5CHM A;  5GHY A;  1T1A A;  4HHD A;  2OAP 1;  1FSY A;  4R4S A;  2VA0 A;  3ZNY A;  1M6K A;  4NXE A;  2QJ7 A;  1CK3 A;  2WKI A;  4OPQ A;  4EET B;  4JXW A;  2KLI A;  1L0D A;  1XXM A;  4Y0O A;  4EQI A;  1KVM A;  2VGJ A;  2W27 A;  1VHM A;  1S1Z A;  3LYX A;  4K08 A;  4WBG A;  2HP5 A;  1LL8 A;  2WAE A;  3ITB A;  4D2O A;  3LFV A;  3MXQ A;  3K3D A;  1G28 A;  2XFS A;  3E2K A;  5GLB A;  4GN2 A;  4KQR A;  2QYB A;  3VSL A;  3IXD A;  1IEL A;  1YLY A;  1ALQ A;  1VB6 A;  4KZB A;  1N9O A;  5HD3 A;  1I5Q A;  1ZKJ A;  4EES A;  2P74 A;  1IOU A;  4JGP A;  4PAU A;  4IBX A;  4QU3 A;  3IF6 A;  1HZO A;  3Q82 A;  4OPY A;  5CXW A;  1IFQ A;  1YLZ A;  4OON A;  1W63 Q;  1YM1 A;  3A3J A;  3MQ0 A;  5F82 A;  2ZQ7 A;  3VP2 A;  2HJ9 C;  3G31 A;  4ZJ1 A;  1OTD A;  4HP4 A;  3T50 A;  1YLT A;  4UQI M;  2QMI A;  3PBT A;  4PM8 A;  4YFM A;  1IKG A;  3HVF A;  3BFF A;  3EOI A;  3HJI A;  1EW0 A;  5EOO A;  5EVI A;  1TDG A;  3UPN A;  1Y28 A;  1KDS A;  4ARZ A;  5FQQ A;  3S7Q A;  1QMF A;  2ZJ9 A;  2W1R A;  1W8Y A;  4FSF A;  1OTI A;  1P9W A;  2XD5 A;  1S4S A;  1DY6 A;  1N9B A;  5DF7 A;  4KUO A;  5FQJ A;  4QB8 A;  5IT5 A;  1XGI A;  3C7U A;  3N8L A;  3UE0 A;  4S2J A;  2PRF A;  5TJJ A;  2I72 A;  4LV0 A;  1I2W A;  2X01 A;  1PFL A;  3BY9 A;  1M40 A;  1NRJ A;  1Q2Q A;  2WGV A;  4C6Y A;  1H8Z A;  3AGD A;  3E4P A;  4PM5 A;  3V5M A;  2ZQ8 A;  4ZJ2 A;  4NET A;  1ESI A;  4OPZ A;  3VOZ A;  3NEC A;  3OOV A;  2W1T B;  4JXV A;  1G6A A;  1NLZ A;  2JKR I;  2ZM0 A;  4RX3 A;  3P7N A;  3LI9 A;  2W3E A;  1NYY A;  1YLW A;  2FH5 A;  3V3S A;  3CPT A;  4QD4 A;  5FQM A;  2ZMF A;  4GJ4 A;  4P85 A;  3Q7Z A;  3IXH A;  4EWF A;  2R9X A;  2EX9 A;  2O9B A;  1OTE A;  2WZX A;  1RCJ A;  2YKF A;  1KGF A;  1XA7 A;  1WYC A;  2ZC7 A;  3FG8 A;  4NXB A;  4A5R A;  4U0X A;  1WYB A;  2XDM A;  2A24 B;  5GHX A;  4NXG A;  3MKE A;  4OQG A;  1K0K A;  2XH9 A;  4KG2 A;  4R4R A;  5CGS A;  5IU1 A;  1KE0 A;  2HV1 A;  3E4O A;  2JC7 A;  1IEM A;  5KMW A;  1MWS A;  4HJ3 A;  4DKI A;  4KZ3 A;  4JGR A;  1JWP A;  3WWX A;  2JCH A;  5F69 A;  3SH7 A;  5J4E A;  2DNS A;  3IH9 A;  1MZU A;  4R23 A; 
#chains in the Genus database with same CATH homology
 4E3N A;  3PBR A;  4DE3 A;  1TDL A;  2Y2Q A;  3P09 A;  4WEK A;  1S6R A;  3GSG A;  1E25 A;  5FAS A;  3MXR A;  5DTT A;  3IF6 C;  5E2E A;  4E3K A;  1O07 A;  3N8S A;  1BLP A;  1KGE A;  3HLG A;  1JTG A;  2WK0 A;  1HD8 A;  2Y2J A;  4EV4 A;  2C6W B;  3LY4 A;  4UHU A;  3CJM A;  2Y91 A;  4QY5 A;  3HLE A;  1BT5 A;  4X55 A;  3TG9 A;  3UE1 A;  1K55 C;  4JF5 A;  1GHP A;  4OOY A;  2PU4 A;  3RXX A;  1LI0 A;  3ZVT A;  2HDU A;  1HTZ A;  1TVF A;  2FFY A;  3MBZ A;  4WMC A;  4QY6 A;  5EVL A;  2ZQC A;  3RJU A;  1K38 A;  3QNB A;  4CPK A;  4PMA A;  1PW8 A;  4OOL A;  1NZU A;  3BEC A;  4IVK A;  3HRE A;  4OP5 A;  5DVA A;  3V3R A;  2H0T A;  1YLJ A;  5CEB A;  3LEZ A;  2XK1 A;  3PAG A;  4LV1 A;  2EX2 A;  3WS1 A;  3FWL A;  4DF6 A;  3OCL A;  5J8X A;  4N9K A;  3NC8 A;  3N7W A;  5A93 A;  3WS2 A;  2XR0 A;  4R3B A;  2J8Y A;  1MBL A;  1W5D A;  1O7E A;  2ZM8 A;  5GLA A;  4PM6 A;  4OP8 A;  3IXB A;  4KZ9 A;  5EVI B;  1MY8 A;  3DW0 A;  1MPL A;  5EVI C;  4F94 A;  3Q07 A;  1FQG A;  3ZG0 A;  4P87 A;  3TSG A;  4E3L A;  4KQQ A;  4WEL A;  3HUM A;  1W7F A;  2BG1 A;  2Y59 A;  2EFX A;  5E2H A;  3VFF A;  3C4P A;  3O3V A;  1GA9 A;  2HDS A;  3OC2 A;  4OQH A;  4S2O A;  4X69 A;  5GLC A;  3CMZ A;  3IWQ A;  3ZNT A;  4EBL A;  4K91 A;  1LI9 A;  3ZG9 B;  1YMS A;  4S2L A;  3P98 A;  3LY3 A;  1K56 D;  1PIO A;  5JYO A;  1QME A;  5F1G A;  3VP3 A;  2WYX A;  5A90 A;  1K6S A;  3EQU A;  1EI5 A;  4B88 A;  3O86 A;  2QPN A;  5FQK A;  3VOY A;  4KZ4 A;  3NBL A;  1ERM A;  1EWZ A;  5FAT A;  3W4P A;  2IWB A;  3ZG8 B;  1HVB A;  1KE3 A;  3HBR A;  4R0Q A;  4DE1 A;  1FR1 A;  3SH8 A;  1LL5 A;  3M6B A;  3SS4 A;  3W4Q A;  5AQB A;  1KGG A;  4MEZ A;  4ZAM A;  1Q2P A;  5FQ9 A;  3FZC A;  3GR2 A;  1XP4 A;  5GHZ A;  1YLP A;  3BLM A;  3M2J A;  1DJC A;  4GD8 A;  2ZD8 A;  1SKF A;  4DE2 A;  2Y2K A;  5FAQ A;  3ZFZ A;  1DJA A;  5EVI D;  3CZD A;  5CGW A;  4Y0T A;  2E8I A;  1ES5 A;  1NRF A;  4IVI A;  1MKI A;  1Y54 A;  3CG5 A;  5L2F A;  4BQM A;  1PI5 A;  3IXG A;  3M2K A;  1KVL A;  2XFT A;  3OCN A;  5EE8 A;  1IKI A;  1MWR A;  4WMC D;  2XGN A;  3S22 A;  5M1A A;  5DF9 A;  5CRF A;  4JF4 A;  1W79 A;  1FR6 A;  3IWO A;  1IYQ A;  3ZDJ A;  2C5W B;  2Y2M A;  4QHC A;  5DTS A;  4ZTK A;  4OLD A;  4LEN A;  5EEC A;  4N1H A;  1FCM A;  3IF5 A;  3QNC A;  3A3D A;  4JXG A;  3UDF A;  4GOG A;  1E3U A;  4HBT A;  2OSU A;  1DJB A;  2ZLY A;  1ES3 A;  1NYM A;  5AQA A;  5TGF A;  5AQ9 A;  2XQZ A;  2HP9 A;  3ZVW A;  5G18 A;  4GKU A;  3VMA A;  3PBO A;  1NJ4 A;  4WEJ A;  3NY4 A;  3VSK A;  4WZ4 A;  1C3B A;  1K4F A;  5I94 A;  5KSC A;  4R1G A;  5E2G A;  3VP1 A;  3G34 A;  4GD6 A;  2WAD A;  4K0X A;  4M3K A;  4KZ7 A;  3A3F A;  3DWZ A;  3BFD A;  4L0L A;  4CJN A;  4E3J A;  4OKP A;  5HL1 A;  2UWX A;  5KSH A;  2V2F F;  1IYS A;  1LHY A;  4WM9 A;  2WAF A;  4RYE A;  4JF6 A;  5CTN A;  3SS5 A;  1ZG4 A;  2Y2G A;  1NZO A;  3DTM A;  5FI2 A;  4HEF A;  4MNR A;  4S2N C;  2R9W A;  1ONH A;  4PM7 A;  5F83 A;  3G2Z A;  3HL9 A;  3IT9 A;  1JWV A;  1CI9 A;  3UE3 A;  5AQ7 A;  4E3I A;  3A3E A;  2GDN A;  1LLB A;  3G2Y A;  3N8R A;  4X53 A;  3ISG A;  2FFF B;  1K6R A;  4EBN A;  5CHU A;  3FYZ A;  5FAO A;  3UO9 A;  4UA6 A;  3PBQ A;  4GDB A;  1PW1 A;  2HP6 A;  3OZH A;  3G35 A;  2ZC5 B;  4P6B A;  5CTM A;  5DTK A;  5FAP A;  3VP4 A;  1YT4 A;  2EXB A;  1K54 A;  4JLF A;  3NDG A;  3SH9 A;  1K4E A;  1XA1 A;  4HES A;  4FD8 A;  2ZC3 B;  3HLF A;  4WYY A;  4WZ5 A;  4ZDX A;  3Q81 A;  4LV3 A;  1K57 A;  4GB7 A;  5HAR A;  3O88 A;  2OV5 A;  2ZM2 A;  3AGF A;  3MKF A;  1IYP A;  4HBU A;  4N9L A;  1E3U D;  2P9V A;  4X68 A;  5EOE A;  3W4O A;  2XEP A;  5A91 A;  3V50 A;  3OPL A;  3M6H A;  1H8Y A;  5GLD A;  2PBY A;  2ZQD A;  1G68 A;  4XUZ A;  1XPB A;  4H8R A;  2ZQA A;  4KG5 A;  3WS0 A;  2J7V A;  4P0M A;  3ZHH A;  2Y2P A;  3VFH A;  3BYD A;  4MBH A;  1BUE A;  4ID4 A;  4DXC A;  4N92 A;  4BD0 A;  5E2F A;  3PBN A;  2WKE A;  5EUA A;  1BLC A;  3GV9 A;  1E4D A;  4GDN A;  1K54 C;  4E3M A;  4DXB A;  3NCK A;  1BZA A;  5FI7 A;  2ZC6 B;  1KE4 A;  1ZG6 A;  4WZ5 C;  5CHM A;  4MBF A;  3IQA A;  5GHY A;  1K57 C;  3MZF A;  3NDE A;  4EUZ A;  3GTC A;  2J9O A;  4GZB A;  2P9V B;  1BLS A;  1FOF A;  3G4P A;  5GL9 A;  1FSY A;  2XD1 A;  4R4S A;  3WS4 A;  3ZNY A;  4Q8I A;  1M6K A;  4UAA A;  2A49 A;  2OLV A;  3FKW A;  4XUX A;  2X71 A;  4XXR A;  1CK3 A;  3WS5 A;  5HX9 A;  3A3I A;  2Y2N A;  2WKI A;  4OPQ A;  5E43 A;  4JXW A;  2H0Y A;  1L0D A;  2VGK A;  4C75 A;  3IHA A;  1XXM A;  2G2U A;  1YMX A;  4Y0O A;  4EQI A;  1KVM A;  2VGJ A;  4O7D A;  3EQV A;  3OPR A;  2ZQ9 A;  2RCX A;  4WBG A;  4GNU A;  3C5A A;  4B4Z A;  2XLN A;  2HP5 A;  5JYP A;  1MWU A;  2RL3 A;  5FA7 A;  2WAE A;  4E3O A;  1CEF A;  3G30 A;  4S2M A;  3ITB A;  4D2O A;  4B4X A;  3BFE A;  1NY0 A;  4KZA A;  2ZC4 B;  5F1F A;  3HUN A;  2G2W A;  2XFS A;  4JKT A;  3E2K A;  5GLB A;  1CEG A;  1W8Q A;  4GN2 A;  4KQR A;  3VSL A;  4KZ8 A;  3IXD A;  1PYY A;  1IEL A;  1YLY A;  2DCF A;  1MWT A;  2WZZ A;  1VQQ A;  1ALQ A;  1IYO A;  1SDN A;  2JBF A;  4BLM A;  1FCO A;  1SHV A;  1N4O A;  2IWD A;  4KZB A;  3ITA A;  4MBK A;  4OH0 A;  4UA7 A;  5TFQ A;  3BRM A;  3OPP A;  2DRW A;  3IWI A;  4OLG A;  1I5Q A;  4FH4 A;  1J9M A;  4JPM A;  5KZH A;  4X56 A;  3AGE A;  4ZJ3 A;  1GA0 A;  1ONG A;  1WE4 A;  1ZKJ A;  4RX2 A;  2PU2 A;  2P74 A;  3BM6 A;  5FSR A;  3UDX A;  3FKV A;  4LCM A;  4S2K A;  2Y2L A;  5HAQ A;  1L0E A;  2CC1 A;  5U47 A;  3UDI A;  2WKH A;  3MZD A;  4IBX A;  4U0T A;  5FDH A;  1RGY A;  4QU3 A;  2Z2L B;  2ZMA A;  3IF6 A;  3UPP A;  1I2S A;  4RVA A;  1JWZ A;  1HZO A;  4MLL A;  2V1Z A;  5CEC A;  3IH8 A;  1PWD A;  3Q82 A;  4OPY A;  1BUL A;  4OOM A;  5CXW A;  1YLZ A;  4OON A;  5D3O A;  2B5R A;  4FCF A;  1K25 A;  1YM1 A;  3A3J A;  1GCE A;  1K55 A;  4KZ6 A;  5F82 A;  3I7J A;  2ZQ7 A;  3UNW A;  3VP2 A;  3HUO A;  5M19 A;  5FI6 A;  1BSG A;  2JE5 A;  3G31 A;  2XF3 A;  3UN7 A;  3BFG A;  4ZJ1 A;  2EXA A;  4PPR A;  5M18 A;  1L2S A;  3GQZ A;  3IF6 B;  1FCN A;  5CER A;  3BEB A;  5FQI A;  1YLT A;  1YQS A;  2QMI A;  3PBT A;  4N1X A;  4PM8 A;  4YFM A;  1IKG A;  3QHY A;  3HVF A;  1SCW A;  3LCE A;  1RGZ A;  1S0W A;  3BFF A;  4KEN B;  5EOO A;  3LO7 A;  3SS3 A;  4FH2 A;  5EVI A;  1TDG A;  2EX6 A;  3UPN A;  1KDS A;  4LV2 A;  4OVD A;  5DF8 A;  5FQQ A;  1QMF A;  2ZJ9 A;  4UA9 A;  4S2I A;  1FSW A;  1W8Y A;  4FSF A;  2Y4A A;  3S1Y A;  2XD5 A;  1H5X A;  2QZ6 A;  1BLH A;  1XKZ A;  3MFD A;  5EPH A;  3ZGA B;  3GMW A;  1DY6 A;  3B3X A;  4Y0U A;  1N9B A;  5DF7 A;  4E6W A;  2Y55 A;  5FQJ A;  3PTE A;  4QB8 A;  5HAP A;  1XGI A;  2Q9M A;  3HLD A;  4KG6 A;  3C7U A;  4KQO A;  3N8L A;  4OPR A;  5CED A;  2OLU A;  2Y2H A;  3UE0 A;  1SDE A;  3Q1F A;  4R3J A;  4S2J A;  1PWG A;  3BLS A;  2I72 A;  2H10 A;  4LV0 A;  1TEM A;  1I2W A;  1JVJ A;  3GRJ A;  2X01 A;  3D4F A;  3V39 A;  4C3Q A;  2BLS A;  3N6I A;  1CI8 A;  1M40 A;  1OME A;  2Z2M B;  5CHJ A;  5A92 A;  3TOI A;  1Q2Q A;  2WGV A;  3HLB A;  4IBR A;  3WRT A;  3ZG5 A;  3C7V A;  2EX8 A;  4E6X A;  3ZG7 B;  4C6Y A;  2V20 A;  1ESU A;  1H8Z A;  1LL9 A;  3AGD A;  3NIA A;  2HPB A;  5HW3 A;  4BL2 A;  1KDW A;  4PM5 A;  3PAE A;  3V5M A;  3SOI A;  3DWK A;  5BOH A;  2ZQ8 A;  2Q9N A;  4BL3 A;  3WRZ A;  3E2L A;  3C4O A;  2J9P A;  4ZJ2 A;  1ERQ A;  1MXO A;  3MXS A;  4BD1 A;  4DDY A;  4NET A;  1ESI A;  3JYI A;  5IHV A;  2EFU A;  1PZO A;  4DRT A;  4OPZ A;  2IWC A;  3VOZ A;  3S4X A;  1ZC2 A;  3RXW A;  2X02 A;  4ZBE A;  4JXV A;  3UY6 A;  1U60 A;  5HAI A;  5HFO A;  4EBP A;  2WGI A;  1G6A A;  3G32 A;  3ZCZ A;  2ZM0 A;  4RX3 A;  4OQ0 A;  2H5S A;  4DDS A;  1NYY A;  1YLW A;  2WUQ A;  2A3U A;  2Y2O A;  4Z9Q A;  3V3S A;  1VM1 A;  3VP0 A;  4QD4 A;  1GHM A;  3HLW A;  1ERO A;  3Q7V A;  4S2P A;  5FQM A;  3GVB A;  4P85 A;  3Q7Z A;  3IXH A;  4IED A;  4EWF A;  1AXB A;  2R9X A;  2Y2I A;  1ES4 A;  2EX9 A;  1NXY A;  4RA7 A;  4QJG A;  4JBF A;  4JXS A;  2WZX A;  2WGW A;  5CGX A;  1RCJ A;  3OPH A;  3NI9 A;  1KGF A;  4PM9 A;  4DE0 A;  1XA7 A;  4Y7P A;  1WYC A;  2ZC7 A;  3MZE A;  1PZP A;  4BJP A;  4LCL A;  4NK3 A;  3IHB A;  4U3T A;  1L0G A;  3N4I A;  4A5R A;  4U0X A;  3PBS A;  1WYB A;  2XDM A;  4S2N A;  1ES2 A;  4X6T A;  5GHX A;  3MKE A;  4OQG A;  1GHI A;  2HDR A;  1BTL A;  2XH9 A;  3O87 A;  1PI4 A;  4KG2 A;  4R4R A;  5CGS A;  1KE0 A;  3Q7V B;  2HDQ A;  2JC7 A;  1IEM A;  1XX2 A;  1MWS A;  5KMW A;  4DKI A;  1PWC A;  1Z6F A;  3BFC A;  4K0W A;  3HLC A;  4KZ3 A;  5TR7 A;  3W8K A;  4KZ5 A;  1JWP A;  4YIN A;  3WWX A;  2JCH A;  3UPO A;  3FV7 A;  3SH7 A;  1JTD A;  1XGJ A;  2WGW B;  1K56 A;  4BEN A;  2DNS A;  1L0F A;  4OQI A;  3IH9 A;  4R23 A;  1RP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...