3S2GA

Crystal structure of furx nadh+:furfuryl alcohol i
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
340
structure length
340
Chain Sequence
AMMKAAVVRAFGAPLTIDEVPVPQPGPGQVQVKIEASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGYVSAVGSGVSRVKEGDRVGVPWLYSACGYCEHCLQGWETLCEKQQNTGYSVNGGYGEYVVADPNYVGLLPDKVGFVEIAPILCAGVTVYKGLKVTDTRPGQWVVISGIGGLGHVAVQYARAMGLRVAAVDIDDAKLNLARRLGAEVAVNARDTDPAAWLQKEIGGAHGVLVTAVSPKAFSQAIGMVRRGGTIALNGLPPGDFGTPIFDVVLKGITIRGSIVGTRSDLQESLDFAAHGDVKATVSTAKLDDVNDVFGRLREGKVEGRVVLDFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and furfural reduction mechanism of a bacterial zinc-dependent alcohol dehydrogenase
rcsb
source organism Ralstonia eutropha
molecule tags Oxidoreductase
molecule keywords Zinc-containing alcohol dehydrogenase superfamily
total genus 109
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3s2gA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3s2gA01
1G6KA 4MKRA 2I76A 1YDEA 3S55A 2EJVA 1P1KA 4E21A 1PR3A 6LDHA 1RM0A 3H4VA 3ANLA 1ZNQO 2GF2A 3BMOA 3NT5A 4IGFA 3PIIA 4P4LA 4TSKA 4CM8B 2QRJA 2E4AA 4CMCA 1IE3A 2DTDA 1LU9A 3JD2A 4RVDA 2PKQP 1H2HA 3OEWA 4UREA 2IZ0A 1SO8A 2CDBA 4KOAA 4PLWA 1SMKA 3DWFA 2QIOA 3FBTA 1E6EA 4KWHA 2AE1A 1ML3A 1K2WA 2NVBA 3QWIA 1C0PA 4OKIA 5JO9A 2VT3A 4MVJM 2J5RA 3VOSA 4BO7A 2ZYAA 5G4LA 3ZV6A 4YJFB 3IAHA 3JQ8A 1MA0A 2CZCA 3DO5A 3ON5A 1M67A 4RVFA 5G4KA 3VH2A 3W1VA 3ZGYA 2VUTA 4WJZA 4CMGA 4E32A 3DONA 4CR6A 1EUDA 4WK6A 4QFDA 2FRDA 3U0BA 4IY1A 2X86A 4N54A 4MKXA 4CMBA 3Q2IA 4CM9A 5AXBA 1CF2O 3PPIA 3I4FA 3GAFA 1C0LA 1ONPA 2YQ4A 3DBLA 3QRWA 4BNHA 1U7HA 4IXWA 1PU2A 2Q1WA 2A4KA 3HDQA 4GMFA 1B0AA 1K0UA 1LSSA 3NTQA 4E2ZA 3TZQA 1DFIA 1WMBA 1L1FA 4L0QA 3LLVA 4YJFA 2B5VA 2QW8A 3HDJA 3DR3A 1F8FA 4J7UA 5B12A 2P9CA 3NJ8A 5HTOA 2YY7A 1MC5A 2PKRA 5KIAA 2HRZA 2HAEA 4DLAA 4XRGA 4IBOA 5IZCA 4NG5A 4ZQEA 4EITA 2DTXA 3ENKA 2RHRA 4PRKA 5TLSA 2D2IA 1C0KA 3ZDFA 1KBZA 4J49A 1C1XA 2GZ1A 2R00C 3AUSA 2JD0A 1V0JA 2GZ3A 2O3UA 1LDNA 1D4FA 2IZZA 4YDRA 1D8AA 3QVXA 3PI7A 1U28A 1K6IA 3C1OA 4R5MA 4ND2A 4P8RA 2RH8A 1ZMOA 2E37A 4KP7A 1E1MA 2VZ0A 3GFGA 5L4SA 4OQZA 4Z6KA 4FGWA 4IDDA 4W82A 3JQAD 4LVUA 3DOOA 2JFGA 1I3NA 4FJ1A 1GDHA 3NGLA 3PQEA 4IJUA 4RVUA 3NTRA 2UYYA 4JK3A 1XU9A 3R0IA 4XWYA 3IOYA 4WASA 3O9ZA 1T2DA 1DC3A 3OIFA 3C85A 1GADO 1DHRA 4CMKA 2GN6A 4NFHA 4B4UA 2AEMA 3QY9A 4HFRA 1U3VA 2FSVA 3SLGA 5L4LA 4E2WA 1E6WA 3ITDA 2XF8A 2UV8A 3N7UA 4PGFA 3DHNA 3EW7A 5EL0A 1PL6A 1E7RA 3JD4A 5C5IA 5JDIC 2YJZA 3GMSA 1P74A 3GDFA 3HQ4O 4HWKA 1PZHA 3F1LA 4FB5A 3H9GA 3JQDA 5HRUA 1AXGA 1DAOA 1AE1A 3KZVA 2VRBA 4PIVA 1EVIA 2DPGA 4CV1A 1P77A 3AFNA 5T64A 5IZ4A 3M6IA 2FPGA 3OETA 5GY7A 1KS9A 1VSUA 3NDIA 5JY1A 1HYHA 3BTOA 2PGJA 4BKOA 3SC4A 4FBGA 1JAXA 2YUTA 1PJ2A 3LC1O 4FFRA 4YJDA 4BV9A 3RSHA 5TNXA 1IHYA 5LDHA 4P38A 3RUHA 1MP0A 4BNTA 4WGGA 4DRYA 3C7CB 3BIOA 4B7XA 4LGVA 5A02A 1I36A 1UDCA 5A5FA 3T4EA 4WNIA 3IKTA 3E5MA 4H7PA 2IYOA 2O3TA 3OH8A 1EQUA 1EUCA 1N2SA 2AEJA 1K89A 1ZXBA 4WOKA 2YDYA 4PFJA 4RF3A 2Q1TA 1YS4A 2C7GA 3H9EO 4WUVA 2VOEA 5KJ6A 3DMTC 1DLIA 1D3AA 2YV2A 2BGLA 2HJSA 3BMQA 4YAGA 1ZW1A 3W6ZA 1RKXA 4HP8A 3CZRA 4E12A 4J90A 4YAKA 2AQKA 2BELA 1VKOA 1EDOA 2CUKA 2OGUA 1O0SA 3X2FA 2DBRA 3LDHA 1ZEMA 4KQXA 4I1IA 3K30A 4ZICA 3H5RA 5JO0A 4LSMA 1FDVA 2CDCA 1KC3A 2IRWA 2NQTA 5EMHA 1DHTA 1JQBA 4FJ2A 1B14A 3ETDA 1MFZA 3JQAA 2X0NA 4CM1A 2YHUA 3FPCA 2O7SA 3I6IA 5DF1A 4NR0A 4W7HA 3WGIA 1DC6A 3ENNA 3UVEA 1MXFA 2OBNA 1DAPA 1E3JA 3CSDA 4FIZA 4ALNA 3KSUA 3N74A 3PFFA 4AJEA 1GU7A 2TMGA 1JVSA 2WD7A 1E92A 4CMEA 3S1LA 4R41A 3AM3A 3D0OA 2ZYDA 5L95A 5IFLA 3NUGA 3Q1LA 4ALKA 4N5LA 1XHLA 4A0SA 5EJ2A 2JD1A 3TOZA 5B1YA 2C07A 2B37A 2X23A 2FSSA 2H9IA 3G1UA 3ZNOA 1JN0A 5DCYA 1MLDA 3WQRA 3LF2A 4FW8A 4WLOA 1LDYA 4DPKA 3DAFA 4GGPA 1OZAA 2BKAA 1LDGA 2V6MA 4TWRA 3U4CA 2ZCUA 1B8PA 4WLNA 5ENVA 3RCBA 3JCZA 3S2FA 2VHXA 1UUFA 1TA4A 3QWFA 4LSWA 3C1AA 3AOEA 3O03A 3AFMA 3VPGA 4D3FA 5EESA 4Z0PA 5H81A 2JJYA 2DKNA 3DB2A 1GCOA 1NHWA 3OECA 2EW2A 1GQQA 3E5RA 4LN1A 4WKGA 4BNUA 3DAGA 4PN3A 2OP1A 2CVZA 4NH4A 1GQYA 3RASA 1E7QA 3RC1A 4WOJA 1WVGA 3B70A 2J3IA 3TRIA 3A06A 1HLPA 1PJCA 1ZEJA 2VQ3A 2G0TA 3NGXA 1ZVMA 1Y5RA 4PZCA 3ZWAA 1KVUA 4W9NA 2ZB7A 3KBOA 4IJKA 5ENDA 3LLSA 4YR9A 5A03A 4MP6A 3WG9A 1P1HA 1CIVA 2B0JA 1WZEA 1GD1O 1CWUA 3MOGA 2WM3A 3Q9NA 2FY8A 5KWEA 1Y1PA 3K8ZA 4AJ4A 5KVSA 1MC4A 1QMGA 4B4VA 5BNTA 2P91A 1F14A 4GX2A 4YJHB 3ZWOA 4CUJA 2NV6A 1IYZA 1U3WA 1M2WA 3F3SA 4J0EA 1RYDA 3V2HA 3WS7A 4D7AA 3ZNPA 4BHTA 4DIOA 5JNLA 3DZJA 4I9NA 4MVJE 4AJ1A 2Q4EA 5TGDA 4HXYA 1LRLA 3Q3CA 5JYDA 5DULA 1AHIA 4J4TA 3TWOA 3DBRB 2X0IA 2Q1SA 3PFWO 4WLVA 4ALJA 1WAMA 3KYCA 3A9WA 4RPGA 4EYEA 2G1UA 4CLRB 1ZXLA 2WE7A 1NXQA 3L77A 4BGIA 1BHSA 3DHYA 2QZZA 5AXCA 3ROMA 2I66A 4DUPA 3V8BA 3DBLB 3RAJA 3L4BA 2VYVA 2JFHA 4ITUA 3TPCA 4EGFA 5EN4A 1A4IA 1RWBA 3GEDA 5BQFA 1E0DA 1ENZA 3RJ9A 3I9LA 3MWDB 3OM9A 2B5WA 4FDAA 5G0WA 4C7KA 3U4IA 5T8KC 3WOHA 5BSGA 1R15A 5IJZA 3U5TA 1PGJA 4RPHA 5JC8A 3D1LA 3ETGA 1X14A 4EUHA 3DTYA 3U49A 4U8GA 3H5NA 5JLAA 1LUAA 2OXIA 1D1SA 5U1PA 2H5LA 1CDOA 3O26A 5BSEA 4O1MA 1DLJA 4ND3A 2Z5LA 3GQVA 1DC5A 5F1OA 3I4CA 1Z74A 4YXFA 3EMKA 4R3WA 1PX0A 2H1SA 2I5PO 1XQ6A 4KZPA 4EUFA 4YT4A 1SBYA 3EUWA 5U9CA 3WX0A 3OQ6A 4NBVA 3BMOB 4MVJA 2QZ9A 4W6ZA 3DTTA 4PG6A 4YCAA 3KB6A 3HADA 3L4BC 4OYRA 3ZV5A 2DC1A 4XD2A 1XQ1A 2ZCVA 3UN1A 3CMCO 3ZWBA 1IHXA 3H7AA 4YAEA 3TL2A 1EVJA 1GQ2A 1A27A 4DC0A 4TVOA 5G0SA 3FN4A 3IJRA 3PRJA 1BTOA 1SAYA 2OORA 1UAGA 4IZIA 2NQ8A 4GX1A 3K31A 4LCEA 2JHFA 3NJ4A 3LT1A 4ZHSA 5KKCA 2ZQZA 1O8CA 2EV9A 3WSVA 3E1KA 2GERA 2WWRA 1LI4A 3IQDB 3TZCA 4ZQHA 1BVRA 5ILOA 1XSEA 3ADOA 5FF9A 5G0TA 4FGSA 4BKPA 3RIHA 1GUYA 1XIVA 1HKUA 4NK4A 4J2OA 1LDEA 4PLZA 5K9ZA 3WGGA 1EVYA 4CUZA 3E6AA 3OEYA 1XDWA 2HCTA 3EY4A 3K6JA 4R1SA 4GWKA 1TXGA 4PG7A 4WCFC 1NQTA 1E1NA 2VZ9A 4JJIA 3VTFA 1BG6A 1UZNA 3PQDA 1HRDA 4U6SA 4IIUA 2PZJA 3F47A 4J43A 5JW6A 2WYVA 2O3QA 2VHZA 4F6CA 4HV4A 2DFVA 4KTTE 1HDYA 1NR7A 1QV7A 2I9PA 4L9RA 1YJQA 2BI7A 4GKVA 3UFXA 3WBBA 4MVJF 4D45A 4XEHA 3RKUA 3PHJA 1YJ8A 5I9NA 2G82A 3GN2A 1PZGA 2B83A 2DT5A 4EW6A 1DIRA 3DDNA 3CMMA 1PIWA 3D3WA 4OXNA 4DPLA 1E1KA 3NYWA 1NWHA 3C1TA 1HDCA 3FI9A 3SEFA 4ZVVA 4K28A 1IY8A 1NM5A 1UR5A 1XCBA 5JDCA 3JQ6A 3ONFA 3BA1A 3DAPA 4RVGA 1H6DA 3RU9A 1P33A 3NDJA 4DC1A 1KEUA 3C7DB 4D3DA 1KYQA 1HDGO 5CEJA 1ISGA 3QA9A 2AHRA 2NTJA 4AJJA 2X22A 2AQIA 2NNLD 4CMEC 1V8BA 1ZFNA 5CG1A 1X0XA 3CTMA 3RQSA 4IQGA 3H9JA 3JQBA 1U3UA 4M86A 4M55A 3NRCA 2GR9A 2PZLA 3BMQB 4KWIA 3U3XA 3LC7O 4ZD6A 1GTMA 4ND1A 3MJSA 5ADHA 1BSVA 4R1UA 4CLXA 3DBHB 4JROA 2VHWA 2Y93A 3PVZA 4DQUA 1SZJG 1QYXA 4R16A 4S1VA 2NVUB 4XGIA 4M49A 1H9AA 3WGOA 1UP7A 1JWBB 3DBRA 2R00A 4JCOA 4FR5A 4O6VA 5EIOA 4H3VA 4R69A 2NU7A 4CM5A 1QR6A 4A26A 4XDYA 3EVTA 1ONNA 1C0IA 5CFZA 4EBFA 1IZ9A 3C24A 3FNGA 2PK3A 1M75A 4NFSA 2YQ5A 3JQEA 4CLHA 4IZHA 3A4VA 3UH1A 1GV0A 1XYGA 3JQ7B 1LX6A 2QX7A 3PZBA 3VZSA 4GX5A 4NI5A 3I23A 4MINA 4WPGA 3RBZA 4EDFA 2V65A 5IAAA 1FDUA 3K2EA 2P4QA 3LZ6A 3FNEA 5ILGA 5B4TA 1LTHR 1H0KA 3K92A 4G81A 1B8UA 2V7PA 1BDBA 1BXGB 1LC0A 2D8AA 2Q2VA 3STHA 5JSFA 1Z75A 5K1SA 5H83A 1P1IA 2GN8A 3WGTA 1I2BA 1ZK3A 4NBTA 2J5QA 1UDBA 3DEYX 4TRNA 2QHXA 2R6JA 1QSGA 2ET6A 4KUGA 2W2KB 3IP1A 5L7YA 2YZ7A 5ICSA 2OOSA 1S7CA 1D7OA 4NQZA 5HS4A 2O2YA 4KDEA 2W2LD 3WNVA 4D43A 1DIAA 2C54A 4Q3BA 3KYDA 5T8KA 1NNUA 3QLJA 3U9LA 2OO5A 1MB4A 4PLCA 1YH3A 5TS3A 1GY8A 3PYMA 2PV7A 3NX4A 1H93A 3RROA 3U4HA 5KJEA 1LRJA 3DL2A 1YOVB 1T2CA 3UICA 3VAZA 3U62A 5ER6A 3Q11A 4PLFA 5TC4A 5CPBA 4AJOA 4HUJA 4ALIA 3BHIA 1Q7CA 3GRKA 4DLBA 4BNVA 3AY7A 4AG3A 3TDKA 5I7VA 4IIVA 3I1JA 1R12A 2IEDA 2GRAA 5CPFA 4CODB 2I65A 5DDIP 1B15A 4ZJUA 4PLTA 1GPJA 3GRPA 5I8ZA 3AK4A 3OIDA 1HETA 1ORRA 4AJ2A 1H94A 1T25A 4KDFA 1UP6A 4U5QA 1TT5B 3ASVA 4CLOB 3I9JA 8ADHA 3GG9A 1PS9A 4XIYA 1FMCA 2GGSA 2OUIA 5A4DA 1M6HA 2NM0A 2EERA 2FPPA 3ADPA 2D59A 4IQ8A 1ZSVA 4RZHA 2NLOA 1F12A 2PNFA 1V35A 3S2EA 4K9DA 1JKFA 2GUGA 3IP3A 4KMSA 5AXDA 1VE9A 2YHIA 5T5QA 3ANNA 1W8DA 3MJCA 5HM8A 1ISFA 1GEEA 1EFKA 3O38A 1E6UA 3ZHYA 1SCUA 3E9QA 3MJVA 4DBZA 4JBHA 3KRTA 4B7CA 1R0SA 4BMVA 3P2OA 4YVFA 4R68A 4WEQA 4BNFA 1XWFA 3B1JA 3WMXA 4CL8A 3UCEA 3I3OA 4IJVA 2NU8A 3MJTA 4BNIA 5I8WA 1AXEA 3RUEA 4MPDA 4DQVA 4JIGA 3ZWMA 2P4HX 5EINA 3JQ7A 3JYLA 4AFNA 3ANMA 2J3HA 2JL1A 3L07A 9LDTA 2ZKLA 3PEFA 4JJFA 1WWKA 1A9YA 3QE3A 3JQ9A 4OXYA 2Q49A 2H63A 1ADFA 4YRAA 5I9MA 4K6FA 5L9AA 3JQFA 4Q9NA 2VRCD 1U3TA 1NASA 1CEQA 5HWSA 5EQFA 3AJRA 3LU1A 2OBYA 4BMNA 1YB4A 1EE9A 4JP3A 4AJLA 4C4OA 1HDOA 4IMRA 4J4BA 3LYLA 1E7SA 4XB2A 2EHDA 1ZMTA 1Y8QB 2B35A 1ZUD1 1DJNA 2BHLA 4H15A 6ADHA 3DZHA 2EJWA 1R37A 3KV3O 3AM5A 4GX0A 1NYTA 4TKMA 3ASUA 1Z45A 1R4MA 5ITVA 3HSKA 3C8MA 1IOLA 2CMDA 2PZKA 4R9RA 3B1KA 1EUZA 1N9GB 1NQ5A 3GZNA 3E9MA 4YRBA 1C1DA 3UGKA 4NFYA 4A27A 3OJEA 5GZ6A 4E2XA 4D0RA 3G0OA 3TF5A 4NBWA 3WGZA 4M89A 4CR7A 1E77A 3P2YA 4U6QA 3B20A 4J1TA 4OH1A 1HT0A 1LBEA 3GEMA 2W2LA 3U4DA 1ISHA 3GK3A 1PGOA 4XB1A 3JSAA 4PVCA 2RBEA 2HSDA 2IXBA 3PYXA 3Q9UA 4Q3AA 2HU2A 3LK7A 4XGKA 5DBIA 3BMNB 3FNHA 3F4BA 1WMAA 4PG4A 4PLYA 4TZKA 3ZNQA 5CDGA 4BKRA 1FDSA 1U9JA 4Q39A 4WCDA 4CQMD 4XDZA 2X5KO 3ZW9A 3PLNA 3WR5A 2DBQA 3PJFA 3GUCA 4DQXA 3A28A 5F3RA 1UXHA 2VHYA 4Z0TA 2CDAA 4II2A 4MVJD 4YAJA 2OL4A 4M1QA 4OMUA 3UHAA 1NPDA 1SB9A 1XEAA 2B69A 1GYPA 4UUOA 4B8WA 3TL3A 2DUUA 5THKA 1BVUA 1GZ4A 3FR7A 4IPTA 9LDBA 4GVLA 5CDTA 3WGQA 3OHSX 4XYBA 4Y67A 4M8SA 4BO3A 2E49A 1DIHA 3VKVA 4E5MA 3KM0A 3ZW8A 5AQ1A 3I9OA 2X0RA 3I83A 4XKJA 3GF4A 3OMLA 4EJ6A 1M66A 3HE3A 3WGHA 4QTZA 4F3YA 3SX2A 4YAIA 4MJLA 4YQZA 4A5OA 1PZEA 3T7EA 3NT2A 1B2LA 2X6TA 4JXKA 3K5PA 2AQ8A 1UH5A 3FNFA 4UVDA 3UAGA 4DBVO 1HTBA 1E3EA 2C7VA 4YT2A 4J1SA 3EC7A 2QYTA 3GVCA 3P5SA 3KEQA 2VYVD 3G49A 2IZ1A 1HZZA 4YT8A 3K2BA 1SEPA 2E82A 1A72A 1QLHA 3ZCXA 4CV2A 1QXSA 3IIEA 2NADA 4WLEA 1R6DA 1GV1A 1MG0A 1T4DA 4BO0A 2ZIZA 3MEQA 4QFCA 1QP8A 2HMSA 3KLPX 5COBA 2EEZA 4LRTB 2B4RO 2GNAA 1LSOA 2DBZA 2IE0A 1PS0A 4CMIA 3LT2A 1ARZA 1Y8QA 4IJWA 2CSUA 3B1FA 5TRTA 2OZPA 1T26A 3WNQA 4BKQA 1T2FA 3WICA 2AMFA 1P0CA 1R0LA 4J0FA 1JKIA 2E48A 2I3AA 1NHGA 1GZ6A 1I0ZA 3HB5X 4OO3A 4CM4A 3QIVA 3RVDA 2DLDA 4YACA 1Y5MA 3PGXA 2FOIA 1NVMB 2NTNA 5CDSA 2VUUA 4BO5A 5LC1A 1ADGA 4J4HA 4CM9D 4IMPA 4EJ0A 2Z1MA 4GKBA 4FQ8A 3RFTA 2B4QA 1YGYA 2ZB4A 5I7FA 1JTVA 1VSVA 1PR9A 2CVOA 4BO6A 3ULKA 3RC2A 4CQMB 3H8VA 4YPOA 2WSBA 3R3SA 1HZJA 1BW9B 5JYEA 1JAYA 1ZK4A 1QYVA 4L75A 3ZN2A 5C7OO 1N1GA 3E03A 2B36A 5I9LA 4IDEA 1QYDA 5CAEA 2EP5A 4B4WA 2Y1EA 3W8DA 1GL3A 1YL6A 3DBVO 3LT4A 1HYGA 1DDOA 1J5PA 4HFNA 5F1PA 3ZWNA 3MWEB 3AU8A 3H2ZA 3IS3A 5HA5A 4O5OA 4ZN6A 4GBJA 4Z0HO 2GSDA 3M2PA 2PWZA 2ZYGA 4E4YA 5KCZA 2D5AA 4FSHA 3A1NA 1EK6A 4GWGA 2FP4A 2DAPA 5A3JA 4FN4A 4CLRA 3JTMA 1RM3A 4J91A 4L76A 4FOOA 2C59A 3H9UA 3OSUA 1GEGA 2NTVA 4RPLA 4ZQFA 1TT5A 5CG2A 2LDXA 4CLOA 2HMWA 5L45A 1KC1A 1ISIA 4TRRA 1GCUA 2VUSA 3JD3A 1GFSA 1DJQA 4F6LA 1KIFA 1TVEA 5COAA 4IINA 1V6AA 1T2AA 3MJ4A 3FWZA 4BMSA 4D42A 4FFOA 1I8TA 5DBGA 1ENYA 1ZK2A 5EERA 4D44A 3CUKA 2FWMX 4YQYA 2X58A 1DBVO 1EDZA 1IB6A 1NQAO 5KJCA 4E6PA 4E2YA 2JAHA 3QWBA 3RC7A 2JAPA 2Y1FA 5IN4A 3DQPA 1E7YA 4I5FA 5EQDA 2E6UX 1PSDA 3D4PA 5TT0A 1YDWA 4AJKA 2CF5A 1ULSA 3PIDA 3BMNA 1DEHA 3M1LA 2ZQYA 3VH4A 2FR0A 4BNMA 3EDMA 4GLLA 2NUAA 3M1AA 3WWZA 5HBRA 3VZPA 4DGSA 1V3TA 3IDSA 4C7JA 4UVGA 4BV8A 1I32A 1P1JA 2Q1UA 2W2KA 2A94A 3GZ4A 4MVJP 1PQPA 4OKNA 5LCXA 1MV8A 1C1DB 5C37A 4TMFA 3FHLA 4MP3A 1Y8RA 2JD2A 3DXFA 3GZNB 3MJEA 4E33A 4MIYA 1ZH8A 1UXIA 4L8VA 3TN7A 1OAAA 2HJRA 1TI7A 2QQ5A 4JN6B 4J7CA 2PD4A 3I5MA 2NACA 4NJMA 1LDBA 1N7HA 2JCVA 1HE3A 2YFHA 4H16A 1B3RA 1GYRA 5DN9A 1I24A 3AUAA 4XYEA 2I3GA 1K3TA 4UUMA 4A10A 5C3MA 3HUDA 3QW2A 4O63O 1VM6A 1YKFA 1A7KA 1C3VA 1HDZA 1QV6A 3EK2A 4PLVA 5K0ZA 3GGOA 4CQLB 2PTGA 2Q2WA 3VDRA 4BGEA 1ISMA 1G0OA 3LF1A 3S8MA 4PRLA 1MX3A 1PS8A 3ZWCA 2UDPA 4BKUA 5U4QA 1O95A 5JC1A 5I7EA 1I10A 4PG5A 2YW9A 1F06A 2AG5A 4JGBA 2BGMA 3VH1A 4IDAA 1YWGO 4XYLA 5L7TA 4QX6A 3H6KA 3GY0A 3WQQA 2PH5A 2DM6A 2FZEA 4K6CA 4BNWA 1PGNA 2W90A 2AW5A 1BGVA 5IN5A 3WYEA 4JP2A 2X9VA 4I08A 3FTNA 3W8FA 1BDMA 3JQAB 2NWQA 1O6ZA 2CF6A 3EGOA 3LT0A 4ILKA 3V2UA 7MDHA 4KQWA 3GT0A 3D3EA 3ZZNA 2P9GA 3GDOA 4J2HA 3OQ1A 2LDBA 3AW9A 2V6BA 3JYNA 2BI8A 4BNNA 1KEWA 2C20A 1T1SA 2YHIB 3QQPA 1VJ0A 4IS3A 1PL7A 4BS9A 5TT1A 4BNZA 4OXKA 2NU9A 2PZMA 4B4OA 3H9QA 3KO8A 2AG8A 4FD3A 4IGEA 4QUKA 4FJ0A 3UF0A 5B4VA 2HMUA 4ZRMA 5JAQA 2OP0A 2VNSA 1PJBA 1NFFA 2ZTMA 4B79A 2UUOA 2ZB3A 5B37A 4JJGA 1E3WA 2JKVA 4NHEA 1JWAB 5A9RA 1GUZA 1NTOA 1JU9A 5CEEA 1BWSA 3W4KA 4XQCA 1B7GO 3D5TA 5IDQA 1O5IA 4I5EA 1YRLA 3SJ7A 3RKRA 4EJMA 3IUPA 3ZU4A 1SB8A 4CLDA 3G17A 1TB4A 4FPXA 4AJNA 4DA9A 3IL2A 1A71A 3L9XA 4WNCA 1ONOA 4ONEA 5JCJA 3QHAA 1GUFA 1HWYA 1F17A 3VVCA 1QKIA 2EF1A 3PHGA 5AOVA 3GHHA 3SBOA 2HUNA 2C82A 1BXZA 2X5OA 3BXXA 1EEHA 1Q7GA 5K6AA 4OJNA 4RDHA 5CEFA 1PL8A 1YQGA 3W4IA 4R9SA 1X7DA 3VC7A 1Z7EA 1EK5A 1SOWA 1L7DA 3KHUA 5H82A 3WIDA 1LSUA 2ZTLA 5A9SA 1NPYA 2ZJ1A 4R01A 1K6JA 1O89A 3ETEA 2O3RA 4G5HA 3L6EA 2X5JO 3R1IA 3GNQA 1EE2A 4E13A 1PEDA 3GUYA 4NIMA 2WE8A 4E5YA 3BMCA 3PDUA 4LMPA 1WDKA 4W99A 3GMDA 5FWNA 1HF3A 1MGOA 1AHHA 3R6DA 1OBFO 3PP8A 2IDZA 3UUWA 1NFRA 2DFDA 3JQCA 4HNHA 2A92A 3TZHA 1MG5A 4MVJG 2ZTUA 4BOYA 4IXTA 4LRSB 1U5AA 2RIRA 4Y6PA 1X0VA 4LISA 2HQ1A 4GI2A 5IDYA 4R5HA 3RC9A 3VVBA 1KVTA 1O9BA 2ZK7A 4AJPA 2AA3A 4W9NC 1LLQA 2UAGA 3AWDA 3PDJA 1DIGA 1U4SA 1ZBQA 2Q2QA 1BXKA 2BMAA 3FPLA 3SJUA 4OGWA 2VWHA 5DZSA 3F4LA 1B26A 3UW3A 4YJGB 3WYCA 2NVUA 2HK9A 3H65A 3AM4A 4J1QA 4UUNA 2ZATA 3DBHA 4GL4A 5F21A 1E7WA 4J1NA 1DRVA 4RPJA 2XAAA 2Y68A 4DMLA 1S6YA 4FS3A 3HWRA 4GVXA 1JW9B 3ST7A 4EEZA 1ISJA 5CHEA 4KUHA 3RD5A 2EKPA 4E0BA 3V1TC 3OJLA 5F1KA 2BGKA 4RJTA 3RUFA 5FI5A 2O3JA 3W8EA 3CKYA 2DQ4A 5HS6A 5TJ9A 1H6CA 1U2GA 4BGUA 2XXBA 3G3EA 5MGBA 1UXGA 1U4OA 2C5AA 1BW9A 5TSDA 2ZJ0A 3HDYA 3TFQA 4Q3EA 4QXMA 2GN4A 5ICMA 1PJLA 3FRJA 5A9TA 5KVQA 3HB4X 3V1UA 3GA0A 4CMHA 1W6UA 4WE3A 4P4GA 1IZ0A 1K5HA 4GSKA 4L73A 1NWCA 2YFQA 3V1YA 4MIEA 2FR1A 3H3JA 3AU9A 3BTSA 5DP2A 3ZH2A 3VTZA 3U09A 4E30A 4DVJA 4NDNE 4ZU3A 1R66A 3ONDA 3L0DA 4TRJA 1E3IA 1AUPA 3PWKA 4IQ0A 4JQCA 1A7AA 2WD8A 4WECA 2O2SA 3JD1A 3WGYA 4EUEA 3NT4A 4W7IA 3JD0A 2Y1CA 4CJXA 3F5QA 1WLYA 2EKQA 3VPFA 5A04A 4IDCA 3I9NA 5JS6A 1N1EA 3WQSB 3LSYA 1WDMA 1I5RA 3F5SA 1ZIDA 1VRWA 4OHUA 1YONA 3JQGB 3WDSA 2C2YA 4E5NA 4QO8A 3TOXA 3QJ5A 3WWYA 4UEJA 1NP3A 1E3SA 4IUYA 4P22A 1RM5A 1FK8A 4BO1A 3K96A 2PR2A 1Y6JA 1EBUA 1U1IA 2CVQA 4BNJA 5DP1A 2R2GA 3UKOA 5K6AC 1NAHA 3DOJA 1XELA 4II3A 5IG2A 3JYOA 4LW8A 2F00A 4BB6A 4IDBA 5G2OA 3KYBA 5DNAA 2Q45A 4CUKA 4TKLA 2QRKA 3VPSA 3N58A 1PJ4A 1T1RA 7ADHA 1W0CA 3WJ7A 2DVMA 3CXRA 1VL6A 4Y6RA 1IL0A 5GMOA 4L4RA 3ROPA 1HSOA 2VTDA 4UVIA 4TROA 2X4GA 2HK7A 3E48A 1PJQA 4PZDA 5JBIA 3CPSA 1R4NA 1ZKMA 2AE2A 4F46A 1B16A 3P19A 2J3JA 2OFPA 2BFMA 1DXYA 5BNFA 2BFOA 3OBBA 1PZFA 5GZ1A 1JA9A 5I7SA 3ZV3A 3O8QA 4MOWA 4PCVA 4I9HA 4AL4A 4GPD1 2Q4BA 1NVTA 1XU7A 4CM7A 4RVHA 3MOIA 2BF7A 3EVNA 2PY6A 4TVBA 1UDAA 3ZWPA 5KOIA 4LVCA 4RZIA 1V9LA 4UUPA 3KOUA 2GYYA 1G1AA 3CEAA 1BMDA 4D79A 1YOVA 4NNJA 1A5ZA 2DPHA 4Y8VA 3UCFA 4E5PA 1Z7BA 1I01A 4FOSA 4YA6A 1Q0QA 1XLTA 2CD9A 5A05A 4L74A 4M54A 2BLLA 2NSDA 4FFNA 4GQAA 5IF3A 2PGLA 1UXKA 3VPXA 4Z3KA 4ZQBA 4UULA 4CPDA 4OAQA 3CH6A 4BO2A 3IC5A 4CR8A 4FC6A 4QECA 3DMTA 1P9LA 3MTGA 5G0UA 5JDCC 4RGBA 3PHLA 1Y9AA 2GO1A 4D41A 3ORFA 5A5EA 1H9BA 2G5CA 1JDJA 3A14A 2YV3A 3OJOA 3Q6IA 1LQTA 1BRMA 4JNKA 1TLTA 1P1FA 8LDHA 1R16A 4WLFA 3AUTA 3X2EA 1Q0HA 3PHIA 2UVDA 3E82A 3I6QA 2O48X 2V6FA 1J0XO 3TFOA 2WEKA 4TZTA 2EKLA 2WYUA 3D7LA 4QT0A 1GAEO 1ZK1A 2O7QA 4WEOA 4DREA 1LXCA 1DSSG 3QSGA 4HFJA 4BO8A 1W4ZA 3O8QB 3HHPA 4DIBA 3TZKA 3GHYA 3LC2O 2D0IA 4ZA2A 4W4TA 5DOZA 4XR4A 1N7GA 4RVSA 1CQIA 2VYNA 3WB9A 5F5NA 3D4NA 3RWBA 4XQEA 3IUSA 3GVIA 4PLPA 4R1TA 2ZTVA 1ADCA 1PWXA 2BRUA 4QQRA 2AXQA 4NJMB 3T4XA 2EG9A 1HE5A 2Y05A 2QYSA 1HYEA 2VWGA 2BH9A 3ZU3A 4JLWA 1OC4A 4PLHA 1Y8RB 3WSWA 4CMJA 1WPQA 1PJ3A 3KLMX 3L6OO 2HDHA 1Z73A 2EWMA 5TF4A 1UJMA 3TQHA 5ITWA 1QLJA 2VT2A 2NVWA 2IYPA 3AUUA 2UUPA 2DBVO 3BAZA 4J16A 3BHMA 5T57A 4LMRA 4BNYA 1PGPA 4NJOA 4RCVA 3TZ6A 4A73A 5TQVA 5KVCA 4TQGA 3CZMA 1CERA 1JLLA 3D4OA 5JFOA 3QVTA 3WBFA 1DRUA 3HG7A 4KTVE 2Y1GA 3DHEA 3VDQA 3COSA 3QP9A 4Q3NA 4BQRA 3GVHA 1C14A 2SCUA 1FXSA 4JX8A 1Z82A 2Z95A 4XZ3A 5TIIA 2Y1DA 3I9KA 3FCOA 4KUEA 2YDXA 1ZSNA 3D3WB 3GLQA 3SLKA 4HY3A 4D46A 1E1LA 1YB1A 3GH3A 4K1LA 5FFFA 4LCJA 3RI3A 5JY6A 3L6DA 3OICA 1TT7A 1ID1A 1Q0LA 1WZIA 1VL8A 3RFXA 4BNKA 1DB3A 4YEDA 4QO7A 4FFMA 5JMWA 1VKNA 3AOGA 3PJGA 4BVAA 5A06A 4TRMA 4FCCA 1KVSA 1N8KA 3QVWA 4Q3DA 4NBRA 1KEPA 2C2XA 4NMHA 4YJHA 1OFGA 4I5GA 2W8ZA 1JKJA 2FR8A 5A1TA 1LQUA 2P5UA 3PLRA 4MO2A 4R51A 2EGHA 3ZWWA 4OIMA 3DZIA 4MIOA 4ZRNA 4UVEA 2H6EA 3WFIA 1QRRA 3KUXA 2CFCA 3GC6A 4J6FA 5L51A 1I2CA 4Y6SA 1T2EA 3L9WA 3INTA 4CV3A 3V2GA 3ZHBA 1DIBA 4YBZA 1YO6A 1QYWA 3TNLA 3ZU5A 2HMTA 2GN9A 5IDWA 1LDMA 3WJAA 4BNXA 3PGJA 3BTUA 3BZUA 5L3ZA 4EEXA 3LVFO 4XA8A 4JBIA 5KVVA 1PQWA 2PGDA 3OA0A 1VJ1A 1SEVA 2X9NA 1T24A 3CE6A 1MUUA 2FHSA 2O4UX 2VCYA 3F6YA 1N9GA 1HE4A 3TSCA 4WCFB 4XRRA 5DCUA 2C5EA 5JAIA 3DFZA 1X7GA 2AEFA 2WMDA 3VPHA 4XIJA 4RLSA 1U2DA 4ZQGA 2IODA 4A03A 1NX6A 3EZLA 1B8VA 1NPTO 1VL0A 3GDGA 2X9GA 2F1KA 3KETA 3L4SO 5LDGA 1YQDA 4IDFA 4MVJH 3RBVA 3HN7A 3T7CA 4RQTA 1I3KA 1LEHA 3HFSA 3WTBA 3S2IA 4RV9A 4AICA 4Z9FA 1KERA 2FMUA 1UXJA 2D3TA 1Y9EA 1J6UA 1EVZA 2D5CA 3KXDA 1FF9A 1IPFA 1RYEA 1I2ZA 5KTKA 4RO0A 4BIIA 1CQJA 5KKAA 3KSZO 3KEOA 5EPOA 4E31A 1SOVA 4CMIB 1PTJA 3NEPX 2I6TA 1PJTA 1NFQA 4XX0A 4NK5A 5JXWA 3VH3A 1A9ZA 1DFGA 3GN1A 1SNYA 1OC2A 1V3VA 5DCWA 2VOJA 2P5YA 4UEOA 1H6BA 5IXSA 4FFPA 2A35A 3AY3A 3OP4A 3V5NA 3WXBA 3ICPA 4OOFA 3MTJA 4RORA 4NPCA 1V3UA 4RLHA 4ALLA 1PWZA 2WDZA 4E3ZA 2VTEA 2O4CA 5BSFA 5KNLA 3IKVA 2PKQO 4BB5A 4N7RA 2FN7A 1FJHA 1U7TA 4CL3A 3VZQA 4GSLA 2GLXA 3DFUA 4HBGA 4OQYA 1M76A 2ILTA 3OFSA 4LK3A 3JYPA 2GCGA 4CMAA 5ER9A 4RDIA 1HSZA 1ENOA 1EZ4A 2J5KA 3GGGA 2BFAA 5AVOA 3ONEA 3UCXA 5ES3A 4AJHA 1M6WA 4B8ZA 3SC6A 1I3MA 4CM6A 1X13A 3OJ0A 3AI3A 1DFHA 3MZ0A 5C7IO 3G79A 1J49A 1CJCA 3W6UA 4IDGA 1C1XB 4OSOA 4YRDA 1OMOA 2D4AA 2WYWA 1CETA 3BHJA 3F46A 4OL9A 2Y0CA 4UEKA 1Q2XA 1LLDA 3HFGA 5L40A 2WD7B 1W73A 2EXXA 1I30A 5JAZA 4AVYA 2GD1O 2Z1NA 2HKIA 1DO8A 3O4RA 5JCJD 5FYDA 3NAQA 4Z9XA 3FR8A 3ITKA 4ZGWA 4N18A 1UP4A 4Y9DA 5JPIA 3S2GA 1N5DA 1YL5A 4BQPA 1L7EA 2RHCA 5MDHA 2JCXA 3GEGA 3K9QO 1OOEA 2DU8A 3ABIA 3HDHA 3DOCA 4HFMA 3AI1A 2G76A 1F0YA 2NU6A 1E5QA 2Q99A 4M87A 2CY0A 1G0NA 1P3DA 2PD3A 4I5DA 4XQ9A 1QG6A 3HJAA 5BNIA 1AGNA 1HEUA 4RF5A 1Q7BA 5JAMA 3B6ZA 1ENPA 1GYQA 1EFLA 1HDXA 2CNBA 4URFA 2BFPA 4CLEA 4HKTA 4XJTA 4B3IA 3QVSA 3CINA 1DRWA 4DL9A 2EW8A 1I3LA 3INGA 3WLEA 1UZMA 1ULUA 3ZWVA 2DTEA 2AQHA 4P4NA 2POQX 1WW8A 1VC2A 1LSJA 1KVRA 1PJSA 3NTOA 4UAGA 1YBVA 4YJGA 4DYDA 5CDYA 4HADA 3DZKA 2X8LA 5TJHA 3SXPA 1P44A 2YYYA 5THQA 3JQ9C 4S3MA 1CRWG 3PZRA 4Z3DA 3D5QA 4I8XA 4XJSA 3AI2A 4EZBA 2OMEA 3Q0EA 3ZWYA 3VKUA 3JV7A 3FSRA 4CQLA 3PK0A 2OHXA 2HMVA 3NDRA 1SPXA 1ZZEA 3RUIA 1WP4A 1EMDA 2B4TO 1SC6A 1E3WB 4Z9YA 2PD6A 3GGPA 4CM3A 2P9EA 2PH3A 3F1KA 3PXXA 3C7AA 1KVQA 4WCFA 4R4JA 3I9MA 1MXHA 1U5CA 3BMCB 5COQA 3WMWA 1ZO8A 2X0JA 1PQUA 5G0VA 1XA0A 3GNSA 2JFFA 2J8ZA 3WLFA 3JYQA 4YB8A 1U8XX 3E18A 2G17A 3IMFA 3ROQA 3ZV4A 2HK8A 1UZLA 1ADBA 3F9IA 5F5LA 2XXJA 3E9NA 1Q1NA 2GZ2A 3FTPA 3FWNA 2IXAA 3H2SA 5A3VA 3C3XA 4F45A 1LJ8A 1HXHA 3GOHA 4B3HA 5L7WA 1QORA 5DBFA 1P1RA 1ZJZA 3ZNNA 1JVBA 4DWVA 5G4KB 4R1NA 2HO5A 1WXDA 5BT9A 2EP7A 4YYZA 3KYCB 3EYWA 4CV0A 3AOEC 4ROSA 2VYND 4PG8A 1YBMA 1WDLA 2FZWA 3DC2A 5T6BA 1LRKA 4QEDA 3SVTA 1FDTA 3PHHA 1NVGA 3HN2A 2JHGA 3I52A 4E5KA 5JDIA 4INAA 2Y0DA 3OJFA 4AJIA 1Y7TA 5KJ1A 4Q3CA 3PYLA 4RQUA 3FF4A 5T67A 2Q50A 3TJRA 1CYDA 4L4SA 3DZBA 3JQBC 3RFVA 2VRCA 1EQ2A 4MKZA 2J3KA 3PWSA 5JMPA 3QVOA 4GAEA 3K73O 4HNGA 3WTCA 2VHVA 3WYBA 4DYVA 2PA3A 4O0LA 2O3SA 4DXHA 2Q46A 4XQGA 3H5AA 4J3FA 1Z6ZA 4U0KA 4K26A 1P0FA 4EI2A 3HZZA 3INRA 1NAIA 1R0KA 2C29D 3PQFA 3D64A 3KYDB 3DMYA 1D1TA 4MP8A 4U7WA 2ZB8A 4G2NA 5TX7A 1KETA 3HNPA 4BO9A 2Y99A 1VLLA 2XOXA 1ZJYA 4A7PA 3R3JA 5C7LO 2X7HA 4DTIA 1MFPA 3GR6A 3UXYA 5JE8A 4BGVA 1E7MA 1HL3A 5DOVA 5A9SB 3W4JA 1YL7A 3Q2KA 1XGKA 1E3LA 1ZCJA 2PFGA 3AY6A 3PWZA 4YTEA 1AN9A 4FFLA 1LNQA 2DUWA 4BUCA 1E5LA 2HRBA 2Y0EA 2TMDA 1GZ3A 3VHRA 1R4MB 3JQFC 1X1EA 5CDUA 1RM4A 2QRLA 3JQ8B 4XYMA 5GZ3A 1OI7A 4DLLA 1QYCA 1LLUA 2WTBA 2RH4A 3FBGA 4JBGA 3RUAA 3P7MA 4L4XA 4BNGA 3FD8A 4ND5A 4PZEA 1HDRA 1X15A 3G1TA 1Y81A 3DZGA 3ZHXA 3GPIA 1IUKA 1YB5A 3LQFA 3ROKA 1T4BA 4YWJA 3QWHA 2W98A 4A2CA 4X54A 4D3SA 2D1YA 4RF2A 1FDWA 2VZ8A 3OF2A 5IXYA 4B3JA 3PJEA 3ICCA 4FC7A 1DPGA 3GG2A 4XR9A 5BSHA 2EGGA 2JCYA 2HLPA 1PGQA 4ALMA 2RCYA 1HLDA 4NU5A 3EHEA 1KY4A 2P2SA 4NBUA 1F8GA 4OSPA 2GPTA 3NV9A 3KTDA 3RUCA 4J9VA 4QSMA 1LC3A 4MVJI 1VJTA 2QG4A 1I33A 3ZHZA 3M2TA 2W4QA 1DC4A 3IJPA 3PJDA 3BYZA 1DOHA 2VNAA 3VZRA 3UOGA 1GPDG 4BNLA 4XGNA 4DMMA 3BTVA 2J6IA 4PLGA 1WNTA 1NBOA 3WFJA 2A9FA 4NZ9A 4Y98A 3KSDO 5BR7A 5B4UA 1K6XA 3RU7A 1X7HA 3QV1A 5IDXA 2BD0A 2PLAA 3E8XA 4HX5A 5JCXA 4D0SA 2P68A 1U8FO 3EZYA 4O59O 2I99A 4ND4A 1J4AA 5L4NA 2IEBA 1H2BA 1X1TA 4RPKA 1XR3A 5AXAA 1KEVA 3OIGA 1XKQA 1NQOA 4YT5A 2GASA 4UVHA 1XG5A 1HE2A 4R54A 3GPDG 3PTZA 1RJWA 2GDZA 2VWPA 4IM7A 4WLUA 2V6GA 1N92A 2FPIA 2X1HA 3OQBA 3GVPA 4I9UA 2O23A 4DPMA 1VI2A 3NKLA 4J7XA 4BL5A 4ESOA 1RPNA 1A4UA 1KOLA 4CM4B 2O50A 1H5QA 2Y1OA 4CM8A 3RJ5A 1KY5A 3RBXA 1B3BA 1YVEI 1R4NB 4NU6A 4J9UE 5FI3A 2YV1A 3CIFA 3GAZA 2VWQA 1VPDA 2I67A 3DZFA 3ZI0A 5IZCC 1LA2A 4N5MA 4MDHA 5AYVA 4IS2A 4RL6A 5J23A 2RAFA 4U0JA 4RF4A 4BO4A 4XYGA 5CP8A 5KJFA 3QWAA 1YE3A 4N5NA 3GFBA 3H3FA 2XPCA 3GNTA 1NR1A 1EBFA 4GLOA 4GMGA 3RUDA 2Y67A 4DIFA 5FEUA 1LLCA 1YXMA 2WJPA 3KVOA 4R3NA 4OOEA 4B7UA 4ID9A 3ZWXA 1UAYA 2Q3EA 3WIEA 2VN8A 5DT9A 2EIHA 3ZU2A 4PVDA 1TEHA 1ZK0A 4G65A 1IPEA 4GH5A 1P45A 1IULA 1BXGA 2Y66A 4CQMA 1GR0A 3JQGA 3MCVA 3OA2A 4GGOA 1ZSYA 4OM8A 1O94A 3GVXA 3EAGA 5L53A 1H6AA 4XCVA 1P31A 1YQXA 1YBAA 2C0CA
chains in the Genus database with same CATH superfamily
1G59A 1YS1X 1TZBA 2PX2A 3AVOA 2YBDA 1YDEA 2V45A 4GBGA 4B2IA 2EJVA 4B43A 4HEHA 5BV8A 1JIJA 1UFQA 4E21A 2XQKA 4D0NA 5IS2A 1RM0A 1CZNA 3DAYA 3MBIA 1IMJA 4QXRA 4B40A 2CCJA 2GTIA 2QRJA 4IMIB 1MJGM 2WKRA 2WT9A 4XW2A 1DP4A 2IOFA 2ZU0C 3JD2A 4RVDA 4WAUA 2PKQP 1BZYA 5ALWA 5KYUA 2IZ0A 3BIJA 3FVVA 1F8YA 1L5KA 1ZH2A 1VHLA 4KOAA 3DWFA 5BVHA 5T3YA 2QIOA 4KWHA 1E6EA 3T3OA 3LECA 1FSSA 3EH1A 4P3PA 3E3NA 5EE3A 4IWXA 4OKIA 4F9GA 4RTNA 2Q5LA 2VT3A 1OGIA 1LJUA 3QV2A 4JAVC 1IHDA 5BWCA 1KSJA 2KYRA 1G7SA 4NE9A 5C8XA 3AHGA 3IAHA 3JQ8A 4QICA 3S81A 1MA0A 1RP7A 3DCIA 1YRHA 4JJKA 4RYDA 3UV3A 4IVRA 3LGSA 3VH2A 1C7IA 2IZ7A 1UADA 2J5BA 2VUTA 2VYCA 4PZZA 3ZGYA 2RIPA 5JZOA 4RPIA 2FRDC 2C8VA 2IP2A 5TQ2A 4C6TB 3TD6A 5DLPA 1LNSA 1X77A 4ZOAA 4ZEVA 4AZ3B 3IXLA 4G0YA 1TM5E 2X86A 4IY1A 4R8VA 4WFJA 4N54A 3HO1A 4MKXA 1VB5A 1K7CA 2RAPA 4QFMA 3I4FA 4X90A 5EKXA 1C0LA 1ONPA 2QGZA 1RBZA 3DBLA 1W19A 4YJ3B 5FR2A 5J1TB 4BNHA 4I50A 2BCJQ 2DPXA 1PU2A 3B1ZA 2Q1WA 3UJ8A 2FUKA 1Z2CA 1XKXA 2JRLA 1B0AA 1K0UA 1TM2A 2ATVA 4RHEA 5K3AA 4DKXA 4E2ZA 5KTRA 5EPEA 5F3DA 1L4NA 4WK4B 2JIZD 1JQ3A 4B0OA 4E7OA 2GNOA 3DZCA 2MJLA 2X41A 2FWNA 2OCPA 3M6AA 4YJFA 3AESA 1J9ZA 4OQPA 3HDJA 1DOAA 2IPXA 4IDPA 1JHDA 3AEZA 1F8FA 3LWZA 4RJKA 4V0MA 5JG7A 2PKYX 3RIEA 5B12A 4YMGA 4V0SA 1Z37A 1ZWLA 3NJ8A 4TS9A 4O2AA 4B17A 1KYZA 2R5FA 3HKDB 4DLAA 3LFHA 4QBKA 9GPBA 1YRWA 1CW2B 3EFOA 3JWPA 4G0WA 2OESA 2RHRA 4EATA 1C0KA 3ZDFA 1P5RA 2R00C 3PL5A 4M9RA 1Z2PX 3SNHA 2PIAA 2GZ3A 1ES9A 3DT6A 4M22A 5D3KA 2V7BA 10MHA 5DWQA 1AGYA 1VE5A 2D4HA 1BOOA 1E2LA 2Y1LA 2OQ2A 4W5RA 4L6IA 4ND2A 3HVRA 3OZSA 4TL9A 1IM2A 1VDZA 2E37A 5IC6A 1IQUA 4RKWA 1G2OA 2IOHA 2VZ0A 4C2UA 1WXHA 2HBQA 2WWGA 3GP3A 1NNI1 2GZMA 2IF0A 4FGWA 4LVUA 5AHKA 5DHSA 5DT2A 4IJUA 4KRGA 2A9RA 5B2EA 5B1SA 1G18A 2ZWMA 1ZUNB 2AG6A 2RH5A 1B0UA 1SZDA 2W2VA 3DW3X 4XWYA 1S0UA 3IOYA 1D2MA 1T2DA 2YR0A 3L7BA 1PP4A 1RTTA 4X62B 1S8AA 2OY0A 1GADO 3PV0A 4TN1A 4TV8F 2CN1A 2JARA 1Q50A 3DWEX 3CRQA 4CMKA 5IT9A 1OT5A 3FUCA 3QY9A 2LIVA 4FR0A 4HN4B 3SLGA 3MRVA 3IV9A 3K3PA 1E6WA 3IHKA 1R6TA 3N7UA 4DLWA 4C87A 5BSWA 1T4CB 2Y76A 3DHVA 5AR1A 4KQKA 5EHXA 4LC1A 4KQFA 1ELOA 4P0QB 2BEKA 3GMSA 4JEMA 3RPEA 3LUFA 5BN3A 1Z0JA 1KH3A 2ZIAA 4E46A 2EKBA 3RS0A 3NUQA 3GLIA 3GT7A 4Q7QA 1DRKA 2VRBA 2VPZA 3AFNA 3ZWQA 1GAQA 4B47A 4JLAA 2KJQA 2CWDA 2CCGA 4L5AA 2FPGA 4PQFA 5IUNC 1KS9A 1EFPB 3TD9A 3QKSA 5JY1A 3OE5A 2Y4OA 1AQYA 1EFHA 3TAHA 1NJ8A 5JCZA 4FWTA 3CZCA 5J5VA 1Y1LA 1C9KA 2PFKA 1JAXA 3SC4A 3KZKA 4F6RA 4KXQA 4WN9B 1YQQA 3GLUA 5ECWA 4YJDA 3LC1O 4BV9A 3R7DA 3V1LA 3FWYA 4P38A 4Z49A 1MP0A 2JI8A 4LTDA 4UE2A 1FQWA 3QYAA 4WGGA 3HMKA 4QBIA 4I55A 1RZRD 4C0JA 3U44B 2C84A 1OH7A 2CHUA 1CUEA 1QRUA 2D13A 2XQGA 3GA5A 4KXUA 3PNSA 1UDCA 5A5FA 1HE8B 4CDGA 3K7EA 4WNIA 3SD7A 1EXMA 2COEA 1EVKA 2SNIE 1Y4ZA 4XFKA 2Q41A 2VDQB 4C6HA 1A76A 1G5RA 1ZXBA 1E1QA 2IDMA 3SDBA 3QJYA 1POXA 4R83A 4RF3A 2I9KA 4WUVA 4ZT5A 1J8QA 1Q0SA 2VOEA 2VS1A 2WWVD 1C1HA 3RVBA 5LZ7A 4XVUA 4AZSA 1KAOA 4HGNA 4D82A 3I62A 5DXAA 1JDBC 1BVHA 4YAGA 1M33A 4AYXA 4QSHA 1ECLA 1W2GA 3CZRA 3W6ZA 4LMBA 4E12A 4J90A 4IHAA 2VUIB 2PX3A 5AOAA 2AQKA 5LVAA 1AS2A 1MH1A 2OGUA 3I34X 1WJGA 2JKYA 4US2R 2QNBA 1V9SA 2QZSA 2MCFA 4KQXA 2QROA 3K30A 3JY6A 1H9CA 4FHDA 2JI6A 1GZ5A 1XCPA 4OHRA 2P79A 3ETJA 1HUQA 1N1MA 4NP6A 4U7FA 3RV3A 5JO0A 4RIGA 1EUDB 3OU2A 4CKEB 4N3CA 1I6LA 1ZRMA 2BEVB 1DHTA 1TZKA 2ZYIA 4MUMA 5LNK1 3TR6A 3TRJA 4ECAA 5FLXA 1MFZA 3KWLA 3L0ZA 4EL5A 1Z33A 4P7KA 4PCUA 2O7SA 4ZVLA 1RHKA 4IILA 5DF1A 3D7NA 1TF7A 3KEGA 1MXFA 4HZIA 5EI5A 2RFLA 3CSDA 1AGPA 4OHVA 4RK6A 1YA8A 4X97A 1TJ3A 4D4HA 5AW8A 4FIZA 4O4JB 5L3SB 1F0PA 3K2QA 3N74A 1MT3A 4HS4A 2TMGA 2PUFA 2PAAA 2KSQA 2GBLC 4L51A 4O2BA 3WLAA 2Z9DA 2SKDA 4MKFA 5J2TA 3VOBA 1G63A 2VNHA 1JHQA 2Z2ZA 4H4EA 1C41A 3NH9A 3S1LA 4AKGA 3BULA 3VTKA 3D0OA 3PC8C 1QHHB 5IFLA 3NUGA 5HG0A 4BPBA 4ZHQB 2WUGA 2JLAA 2X15A 1XHLA 1Z6GA 2QP9X 4MYTA 2PRYA 4N5LA 5GADl 2C07A 2PRZA 1JJVA 2FSSA 3TB6A 5BSRA 4S05A 3B3GA 1P2UA 1MLDA 1KFJB 4QA9A 3LF2A 3U4GA 5A4FS 4EA8A 4GGPA 4ZKDA 3D6UA 4HWOA 2X4IA 1M0TA 4R40A 2AYXA 1LDGA 2V6MA 1FRNA 3BH6A 5ENVA 4M9XA 4HMQA 3HFJA 1PNRA 3NGMA 3W7VA 3S2FA 3G9ZA 1QRAA 4RIEA 4TLAA 4KBYA 5FOWA 1G3IA 2NT4A 1TA4A 4LSWA 4Q9IA 1JG7A 4IG4A 3VJMA 1NLZA 1UT5A 5EESA 6GPBA 2ZDGA 2JJYA 2DKNA 2UYOA 5ERXA 5IAOA 4WKGA 2EW2A 3E5RA 3T1YB 1M2KA 4PN3A 4HGYA 4KMOA 2WOOA 4KFTA 4KSYA 3LP8A 4EGCB 1E7QA 4HDSA 3RS4A 5CA1A 4N49A 2OLEA 1Z8NA 2PU5A 4I5IA 5DO9A 3TI9A 4I6JA 2G0TA 1RYBA 5AKKA 5CBPB 3OQIB 1T8RA 2ZJOA 3QK7A 2Z09A 1TCCA 1HT1E 5P21A 4W9NA 5CT4A 5HZGA 4RA9B 3Q7SA 1P6QA 2B5OA 3KBOA 1FFYA 3LLSA 3ZTTA 3GJRA 4PHTA 4EYOA 4MP6A 4RZQA 2CHEA 1JIUA 4HWTA 4MUIA 5HDQA 2EEPA 4F56A 1AU9A 3MBKA 3K71B 1L2TA 3C5HA 1E2QA 4UHEA 5C8DA 4HZUB 2P5TB 3EZ7A 4Y1FA 1ODLA 1N0VC 2B1JA 5AJVB 2A33A 2PA0A 5GV8A 5I5GA 1TADA 3ZWOA 1PK9A 4YJHB 2PFSA 5BNTA 6REQA 5K03A 4CUJA 1DQRA 1WR8A 3MAGA 4QXQA 4ND7A 3EPHA 2DCUA 3CX6A 2VZLA 1MX5A 3CHYA 3WS7A 3WGVA 3ZNPA 4D7AA 2H4JA 1E2PA 5LBTA 4DIOA 5ED4A 2ZZNA 3K8OE 1C7QA 3UJ6A 3N6XA 4RADA 3C3EA 3NPMA 3WVNA 4DNPA 4POAA 4IH4A 4HXYA 3Q3CA 2PUDA 2J59A 1AHIA 2PLRA 4KZKA 5TV2A 4O2BB 3DBRB 1UDXA 2X0IA 5K8JB 2IY7A 1QE0A 1BN7A 3P26A 1AO0A 5HTOA 1Z39A 2GPWA 2JLQA 3DV9A 1KYYA 4P82A 1Y8CA 4S12A 3OZIA 3FUTA 1D2NA 1V11B 5JBNA 1OV6A 5K3BA 2ZS7A 4EYEA 5JEEA 1WSWA 2DWUA 4OGLA 5K6RA 2O9JA 3BF7A 5I9TA 2WDPA 1GNSA 2IELA 3L77A 3PQ2A 2GK4A 3EIHA 2QZZA 1AY0A 3N28A 4EOGA 4MB0A 1QQ7A 4RAOA 3CB4A 1J24A 1B93A 3VR3D 4DUPA 2IHBA 4KR0A 1L6IA 5DW0A 3OTIA 4U6NA 3G0GA 2YMLA 5E2AA 5J1SB 3T0GA 3ZI7A 5DMHA 3BG5A 4ITUA 1B43A 3BRWD 4LZWA 4EGFA 4M0UA 5EN4A 5BN5A 1A4IA 5BQFA 1UJ5A 3H8JA 1Z16A 3BOSA 4WSOA 4KWCA 1IY2A 1E0DA 1PFWA 1U0SY 2V9ZA 4IFBA 3HVHA 3I9LA 3RJ9A 3ZBUA 2B5WA 3JWGA 2XT0A 2R8YA 3TOVA 1P2TA 3PQ4A 3DEZA 5ILQA 5EIEA 3U3OA 5JC8A 1QDEA 1B6GA 3HLYA 2PO5A 1D6SA 1OLUB 4EUHA 3U49A 3AEQB 1E2JA 3I5UA 3H5NA 3L4JA 5JLAA 1LUAA 2PXHA 1Z3CA 1PBNA 2OXIA 2H5LA 1JKJB 3D8NA 5BSEA 3MQ4A 3JWJA 1WIWA 4L0MA 3GQVA 3M9XA 5HHTA 2ZOSA 1DC5A 4YXFA 1Z74A 3EMKA 1U7PA 5G53C 4ZT3A 5IUJC 3D6NB 2XE8A 4G56A 4KVGA 3WV5A 2GXAA 4C30A 3WLLA 1XD8A 3P0FA 3OQ6A 1IY0A 4OHCA 4DN6A 3BMOB 4MYUA 2QZ9A 3SNKA 4B32A 2CGEA 4GYWA 4JI5B 1WUHS 1T8SA 4BLRA 5LWHA 5BRAA 1JFVA 2QZPA 2ZI7A 3I9V6 3TEFA 1TKBA 2XZDA 3FIUA 1CX9B 1QCYA 3CMCO 4EI9A 3L4KA 3THWA 1IZ8A 4CIAA 2PS0A 3N2KA 3N3BC 1EVJA 2FPGB 3C3PA 2QRQA 2QD3A 3EWNA 4JUDX 2IEAA 4DC0A 1VIVA 5G0SA 1D9ZA 3C3JA 1Z26A 3IJRA 3UWDA 5IKOA 2XCIA 2GILA 1GGEA 1P7VA 2PKXA 4LWPA 4LCEA 3UKJA 2CL0X 1L5QA 2GXQA 5L3QA 1KZ9A 1OX6A 1US8B 4EY7A 3LT1A 5EUCA 2VNJA 3BWVA 4ZHSA 3IB3A 1Y8ZA 1XK7A 3T3IA 3RADC 1NVFA 3WSVA 1L1EA 1DV2A 1QRSA 1YHYA 2FQYA 1Y80A 1GNQA 3BE4A 1QZUA 2GERA 2NXJA 4ZAYA 2UZ1A 3TZCA 2YMMA 3ABQB 1YC2A 3F8TA 1QS0A 3CF2A 3KPJA 1EA5A 3EPLA 2AFHE 1XSEA 4A0GA 4BWYA 3G0BA 2BBTA 4E88A 1DXHA 1XZPA 4BKPA 3RVLA 3GB9A 3PRYA 3SI7A 1W44A 1A5BB 3KQNA 4MWSA 1LDEA 3R5KA 4PLZA 5K9ZA 1E2BA 1WZ2A 2JGDA 3FTCA 2V5UA 4H6XA 5CT5A 1XWIA 3PC3A 4KW7A 4U7GA 5EXTA 3VI3B 3P9PA 3K0FA 4R1SA 1TXGA 2JJ1A 2R62A 3E1GA 4PG7A 4X8MA 3ZXYA 1OT3A 2X2FA 3FOWA 3PC6A 3B6IA 1TCAA 3M4YA 1NQTA 3ZBPA 4ETNA 5CFOA 5KNBA 3RJTA 2G63A 3G89A 1RSZA 5LA6B 1NZDA 3HLTA 3VU9A 2PUEA 1JFFA 3BIXA 1VL1A 1UZNA 3P9SA 3AR4A 3ODPA 2GEJA 3P2IA 1HRDA 1J90A 2PZJA 3ETNA 3F47A 5JW6A 3N2LA 3DNFA 1S89A 3KNZA 3SC2A 3LZCA 1U8EA 3DDUA 4GO1A 4YWHA 4HV4A 3LY9A 1HDYA 3DR5A 4L9RA 3DKRA 4ESHA 3E8MA 5DI9A 4Y2SA 5DTEA 1L8LA 5NLLA 2ZSDA 1NQVA 1PD0A 2GX6A 4XEHA 2I6UA 4A6XA 3F4KA 1GGHA 1P91A 2WHPA 4D5EA 2DT5A 4EW6A 3W9UA 1VPEA 2UYQA 3C3AA 4Z8YA 4U1RA 1KE1A 1MOPA 3WLKX 1YA4A 3D3WA 2RBGA 2XNKA 1L8OA 2QTZA 1VIDA 2C2OA 4R2JA 5BVGA 4JNCA 1VHTA 4MUFA 2VF4X 4MGHA 3SEFA 1VYUA 1IY8A 4RNDB 1NM5A 1RI1A 1UR5A 3C6QA 3R7BA 4URVR 1N6OA 3DVAA 1LD3A 3D0QA 5BT8A 3JQ6A 5JDCA 5CLFA 5B57C 3BA1A 4KLCA 3R8CA 4KC0A 5LKRA 3S8YA 1H6DA 2Y9MB 4R8MA 3GLTA 3HV0A 2ZZKA 3CTPA 3UOAB 2H5EA 4EJFA 5ARDA 1SKYB 1LJLA 1KYQA 4RULA 4YRLA 5CR9A 2V8BA 1NMXA 1ISGA 2AB0A 3LBYA 2DPYA 2WI8A 5IVIA 3LTNC 2G6TA 2AHRA 3M81A 5LQCA 3GJ0A 5DX1A 4GWLA 3IQZA 4UEWA 1V8BA 4W1PA 1THTA 4UARA 1H23A 1D2AA 1CJVC 1DKLA 2YYAA 3H9JA 2V96A 2YJ5A 2PGIA 1PTJC 1PTKA 5JYBA 3CNOA 2DQKA 3KXLA 3SJCA 4JVNA 3WKAA 5BV1A 3L8GA 4LOKA 1Z47A 3HP1A 4Q4CA 2GR9A 4IIDA 5AVJA 5IBCA 2RGNA 2IOQA 4DNXA 1MABA 1N8TA 5JBQA 4CEIB 1JQ5A 3TX2A 4CLXA 2JIPA 2VDOB 1ZJ6A 4CFYA 2GEKA 3UXHA 1SZJG 4R16A 1KHTA 4XGIA 4OVKA 1H9AA 3SDZA 2BP7A 3WGOA 1JWBB 4FINA 1WEHA 2C8KA 3WGNA 4NL4H 3AMVA 3IUMA 5JD3A 3EY9A 4HTFA 2NU7A 4WI1A 2WUDA 1A88A 5K0EA 4JWKA 3RTAA 1T5BA 4NCBA 4NENA 1X3SA 2IK8A 3AF5A 4IGKA 4PIPA 3TM4A 2QM3A 2V0GA 1C0IA 4CF6A 2C3UA 1IZ9A 2APJA 3CW9A 3E5HA 4Q1CA 1WUIS 2PK3A 2PX4A 5EMMA 1YRYE 2P7HA 1P73A 1FDOA 2GYWA 3K5WA 1RADA 3OT4A 4BP8A 3C14C 4PO9A 4WJKB 1IQPA 1XYGA 3OPNA 4R31A 2AJLI 2QX7A 4TT8A 4U02A 4WPGA 4NI5A 4MINA 4WFQA 3EXAA 2ZTHA 5AI4A 5JZBA 4XSGA 3FPEA 1HEYA 2EWWA 4I6EA 5KTSA 1FDUA 1ZZGA 4B3CA 3FKJA 4BASA 1LTHR 3EDYA 1H0KA 3EXIB 4JOSA 4KNYA 4G81A 4FQ5A 2F4VB 4LZNA 3FDFA 3BA6A 3HWWA 2FOLA 5FBLB 3T9FA 2Q2VA 3CRZA 1R5NA 5JSFA 2KM1A 1CUDA 2Z57A 4G5RA 2GN8A 3CYFA 3WGTA 1I2BA 5T7BA 1YF3A 4RK0A 4M7PA 1M2EA 1USUA 3DEYX 4TRNA 3NIWA 4DMRA 3G5UA 1FMJA 3A26A 1QSGA 1SHZA 1B1AA 3G7UA 3G2KA 1XNHA 2FW1A 1JILA 2OHOA 3G2OA 4L8FA 4L9SA 1KJNA 2GWRA 2OOSA 4EPVA 3GU3A 5KTMA 1OWMA 1SGWA 2FEXA 3KWMA 5HS4A 3HBLA 1GGVA 4KDEA 2W2LD 3H2IA 2YV4A 4QBFA 3AL3A 3X44A 4Q1EA 1DIAA 4Q3BA 3KYDA 3DPUA 2WAAA 5DHFA 5GAJA 3U9LA 1RLTA 2Q8NA 3NVKI 1AK9A 3AP3A 2CE2X 2Y77A 2AI3A 3AQ4A 3PYMA 2PQ6A 5D86A 3R76A 3U4HA 1YOVB 5I6DA 3AEUB 2W83A 1JX6A 4MB6A 1AQ6A 3U62A 2SHKA 1FU4A 4PLFA 5TC4A 4AJOA 1QQTA 5CBKA 4HUJA 5C1OA 3U4MA 4MRAA 5BQOA 3RNOA 3ORSA 1CVIA 3BHIA 3QEBZ 2A84A 3TGLA 4UHJA 3G8YA 1K88A 3AY7A 4AG3A 3CGWA 4BNVA 1JYEA 1HLFA 2P3QA 2WILA 4BECA 1Q84A 4R0MA 3DEJA 1AG9A 4WNAA 1DWPA 1NF2A 3RS7A 5K3EA 2IEDA 5C1BA 1G3RA 2GRAA 4G5GA 2I65A 5DDIP 1B15A 1VZ2A 5JFGA 3WLHA 4RHTA 4ZDIA 4QOHA 1P2VA 2P0AA 5HYVA 4IZOA 1G8AA 3WWDA 1QDUA 1E2DA 1MEJA 1H94A 2I0FA 2VJMB 3DDHA 2BHNA 5C0OE 4BMZA 1KU0A 2WNHA 2ASVA 1S2NA 1TT5B 4TMTA 1GZ7A 3WB0A 2CMKA 4W8OA 5DGCA 4CLOB 3SYNA 2DUMA 2J87A 2OUIA 4LGYA 1DC7A 5ESWA 3MM4A 3NIGB 1A9QA 2FPPA 5DHQA 2OORC 1RXEA 2ZJAA 3RSSA 3UAXA 4ZOLA 2O8BB 4HDCA 1LW7A 2WK1A 5GJVC 2QR3A 1F12A 2P9TA 3JQPA 3LXRA 2PNFA 1CJSA 3HDGA 5J59A 3CF4A 1V35A 2BDUA 4M60A 3S2EA 1U1EA 5LLDA 3IP3A 2HXSA 4A6DA 2JEOA 1T9GR 3NBXX 1A5SB 4JLVA 1VE9A 2Z8YA 3TQTA 2YHIA 1ZIXA 5T5QA 1VSTA 3EARA 1Q1EA 1KIAA 1RQ7A 2WUVA 1W8DA 3ANNA 2AKAB 4HGOA 4EY8A 4JOBA 4O1HA 2XAUA 1AC5A 5ALJA 3V4VB 3PNVA 4FFBA 3JU3A 3FSJX 3K53A 4YO7A 3SZMA 3T4PA 3ZHYA 1EINA 4N39A 1MEOA 2CFOA 1P0IA 4QDJA 1FEZA 4U4AA 4GSYA 5FOVA 4BMVA 4JVLA 3FMPB 4TS1A 3REOA 1PEKE 4R68A 3B6JA 3ZY5A 4BNFA 4IHJF 1H1LA 1XWFA 1Z22A 4GOJA 3WLRA 2XZOA 3WMXA 4F9TA 1EIWA 4IOKA 3UMVA 1UK8A 2DWCA 5BXQC 5BRNA 3EEIA 4IJVA 1W581 3GFQA 4BNIA 5I8WA 2DR3A 5F35A 4D25A 3RUEA 4ZZ3A 1EAMA 3CUYA 4FGZA 4ZDWA 4N12A 4DQVA 4CWAA 4UNRA 4E3WA 5AW6A 4GT1A 3HBFA 5EINA 1TDJA 3JQ7A 1NW7A 2IQ5A 3N8KA 3DYVA 2LCIA 3FB4A 4NF2A 5D84A 2VPQA 4IIJB 1EVQA 2X6RA 1NVEA 2IX3A 3PEFA 4JJFA 4K05A 4NU8X 1YVDA 3IEUA 1EFRA 1NMQA 2HYDA 4DIUA 2Q49A 2QLJA 3VVLA 3T3MB 2VH5R 1JECA 1XMPA 3DPIA 5JH7F 2C7OA 1POWA 2VRCD 3E58A 1U3TA 4LY6A 3SCZA 4ZYLA 1NF8A 4EUKA 3DXXA 4EGAA 4U39A 1UBCA 3E5NA 4AJLA 2NNWB 4QPPA 5EJMA 1HDOA 3PDIB 3KKLA 3LYLA 4JELA 3W5UA 4C3OB 4D6PA 1DJNA 1DJPA 2VNKA 3C8DA 2PXAA 1R37A 4G1FA 1MPXA 3MUFA 1YU9A 4GX0A 4GQBA 1H2FA 3EIFA 4OQLA 5EWMA 3V55A 1WD7A 1Z45A 3ETCA 2J0QA 5IWAB 1IOLA 2CMDA 2PZKA 2ID8A 1EUZA 1N9GB 1NQ5A 2EF0A 2GKSA 2QL6A 2Y3IA 3BRSA 3GZNA 3NXKA 3OZUA 3EN0A 4U3JA 2ZLBA 1C1DA 4A27A 2FJPA 5AJYA 3D54D 4D0RA 1T29A 2CW5A 3IT1A 1MB3A 4NBWA 4Z2AA 3WGZA 3U4AA 2P41A 3B20A 4RVCA 1HT0A 1KI8A 1LBEA 2W2LA 3U4DA 2FG7C 4YV1A 4KOEC 2RBEA 1V16A 2HSDA 3QVJA 2H3EA 3Q9UA 4ZVRA 1ZHOA 1GRCA 2A0XA 1KNXA 1AQIA 3BEOA 2ZQ5A 2OFFA 2C9DA 4PG4A 4BKRA 1H1TA 4WCDA 1YUNA 4Y9TA 2GK6A 2VQEB 4ARZA 4X20B 3R40A 2P9QA 2W6JD 3DOIA 4G67A 3GUCA 5K8TA 3BXZA 4IUBS 2ZYVX 1TC1A 2CDAA 1EXNA 5EMJA 2WMYA 1KZ4A 4JDUA 5FL7D 3CA8A 1W5EA 4DUGD 1OAKA 1ZD5A 2B69A 3GEPA 3N1UA 2W2MA 2ZVQX 2EHJA 2R1TB 3OM0A 4MV1A 1I7NA 4UUOA 4B8WA 5JD5A 5KX5B 2NT3A 3O91A 3TL3A 4M1ZA 3FR7A 4IPTA 3SKVA 1SXJD 1S01A 1C3JA 1D09A 5KTYA 1Y37A 3UMMA 1RS0A 5CDTA 1YJAA 5LBIA 2PPLA 4C0KA 4EHAA 3CO5A 1QB8A 3V34A 4BO3A 3UMRA 2YYZA 3HA2A 4OLFA 1DIHA 1N2CB 4TKVB 5A6VA 1E3MA 1PR4A 3JVEA 3HR4A 2VZEA 3HCFA 5BN4A 3PGKA 3NHSA 1NU6A 2JFZA 3I83A 3ODGA 4MWZA 5TVKA 3VTAA 5AQ1A 3OMLA 3GLHE 4GPBA 1Z8DA 4KXXA 4RZXA 1BEUB 1N2CE 4F3YA 2XADA 4C22A 5CB4F 4Q1BA 4RPCA 3ZZUA 4IWYA 1N6NA 4HXGA 2KLHA 3F7NA 4NESA 5KDOA 3PUKA 1N6PA 3FZQA 4HWSA 3MXOA 2DY0A 4JBXA 2AQ8A 4JXKA 4URUR 1WPRA 1Y4UA 1RJDA 2HLDA 3VJLA 3BRWA 4HNUA 5HRCA 2HIAA 3J81k 5DBEX 3GVCA 1WXGA 4J0QA 4P4TA 4C4ZA 4TN5A 2CE7A 3G49A 4O4LA 5A2QA 3B5JA 2JB9A 1P29A 3CF0A 3DE0X 1V6CA 3MB5A 3SJBA 5JANA 2E82A 1A72A 1I4WA 2P6MA 4JHXA 3A6LA 1QLHA 2BBOA 3R6LA 4DMHA 4B44A 3NU1A 1V95A 1W49A 2NADA 4WLEA 3U9TA 1XCJA 1K5GA 5CX1A 2XCOA 4N0DA 4EKIA 1MG0A 2E0IA 3MPUA 5G3ZA 4YNBA 1JXQA 1QP8A 2P2ZA 2WFLA 4UOQA 4EHDA 3ETLA 2BFWA 2XCRB 2GNAA 1EHIA 1H0SA 3K0HA 1CUHA 1ARZA 4IHJB 4PYKA 2CSUA 5MGNA 2VK1A 5EEGA 3HM2A 1CQJB 4FBLA 3CV3A 4POOA 1MO5A 3IH5A 4IH9A 4U7JA 5SV2A 3WICA 2AMFA 3BJMA 5FWXA 4J0FA 1RBMA 1WPGA 1QIIA 2OCLA 2E48A 3G9TA 4KCGA 3KB8A 5HF8A 3MINA 3IJEB 1AUXA 3HB5X 1WABA 1DTWB 4OO3A 4QLAA 3BB3A 4GKJB 4YACA 2HLNA 3AJEA 3RYIB 4ZJPA 1FOEB 4KN8A 3UAVA 2WUWE 4F4FA 1M1UA 1MEEA 3B6MA 2LTAA 4L5CA 2VUUA 3FFXA 4MW4A 3WL8A 1E0AA 3OKCA 2OQRA 5C4GB 4CM9D 4L7VA 2Z1MA 4LOIA 1UJ4A 4Q03A 4FQ8A 3S99A 2FQQA 2FFBA 1N6HA 1NONA 1U8YA 1V37A 2ZB4A 4X7RA 3W78A 5I7FA 1JTVA 1Y5IA 1SCQA 3MD0A 4DR7B 4KHZA 4BO6A 1JI3A 4EA9A 1F51E 4CQMB 1H3EA 1WCWA 3KUDA 4BVLA 4CVNA 4HC4A 3PSHA 1EP9A 2G71A 1JAYA 3BKWA 3PC4A 2QX4A 2J4FA 5JYEA 1R8JA 1N1GA 2WA2A 1HBJA 5I9LA 2XB2A 1QYDA 3AIIA 4MRMB 4HH0A 1NA5A 1R7RA 4YJ3A 5F1PA 4H4DA 3LT4A 1K9VF 1UBTS 1WY5A 4R7ZA 1YHZA 3ZWNA 2RGYA 4Y7CA 5IH3A 4E2FA 4NSNA 1S7GA 3ZCVA 2WPDA 3L93A 1XZAA 1JT2A 2JDID 3GFPA 3I6MA 3OOJA 4ZOCA 5KCZA 2C9ZA 3A1NA 2B6HA 5DYNA 4UM5A 5ESXA 3EQ2A 4Z4HA 1RPJA 3RIYA 4CLRA 4F85A 2WIGA 4MUKA 3RFUA 1Z68A 3Q3IA 5BSVA 2GCPA 2NTVA 1JIXA 5PGMA 2OB2A 3CW2A 4ZDKA 1FNSA 1QONA 2IFTA 2K6GA 4AMBA 6AT1A 1CU1A 1KC1A 4Q37A 4DARA 5JU6A 4TRRA 1N2CA 5DYTA 2B8EA 2CJPA 5B36A 4CEJB 5CIYA 3JD3A 3DTVB 3T9CA 1VP3A 3CE9A 3C97A 4Q15A 4EYQA 4F6LA 3HYSA 1KIFA 2QI9C 3HKBB 3FWZA 1JG3A 3PNOA 3UTCA 3CF6R 4Q9AA 2FZKA 5DBGA 4BZQA 1ZK2A 5C46F 2FWMX 3GARA 1NQAO 2B99A 1IB6A 1M6VB 5DSTA 2OAQ1 2JAHA 3OZFA 4U2EA 2QS9A 3BWYA 2PUGA 1MOZA 2ZBQA 1E0KA 1R4AA 1R3UA 3GO4A 1F4VA 1J21A 1ZAKA 2JAPA 4Q4DA 1G2QA 3TLKA 2WU8A 2FP4B 3E22B 4S1OA 5EQDA 2V0CA 4G4SO 3IQGX 3QBEA 2XMQA 1A3CA 2WSSA 2J09A 2WFZA 3KT8A 2CF5A 4JFRA 3C43A 3M1LA 3UMJA 1X9HA 1IBRA 4NCHA 2XXAA 5BN3B 2FR0A 1NBHA 5KYGA 4GLLA 2NUAA 4HATA 5HM6A 5TQ0B 5HBRA 1JKXA 4LC9A 3PUHA 2OYSA 1X7XB 5ECDA 1R0XA 2VR1A 2H51A 1T4GA 1RC1A 2HFJA 4HNAB 3DSRA 1TVKA 3TOSA 2A94A 2H1IA 4IEFB 3ZDZB 4ZYWA 1XPUA 2A1TR 3GZ4A 3K1JA 5TARA 3QF4B 1ZQ1A 2VP6A 4MVJP 4PZPA 4D3YA 3AQIA 4Z4GA 2HSJA 2MU1A 4DV5B 2JD2A 1P4AA 2ZROA 3GZNB 2PSDA 1XU4A 2XMSA 1D2CA 1XCGB 1EEXB 3VISA 2B1GA 4L8VA 4BC0A 3TN7A 4A0HA 3S2UA 2H2IA 3K8QA 3K4HA 3OFND 1XKLA 2OXRA 3K9GA 4L9AA 3SM3A 2PD4A 3W5VA 2NACA 5K8IA 1N7HA 2JCVA 4H16A 4TLEA 3HXLA 3PL1A 1I24A 4G37A 1ZU4A 1RZ3A 4FYIA 4Z99A 5FR1A 4XYEA 4TLLB 3LDFA 1U2TA 3QW2A 1OVMA 4O63O 3A2MA 4X1YB 3WRYA 1QV6A 2M6LA 4FB4A 3L6RA 4PLVA 2A14A 3LW8A 2R7MA 1KJWA 3A2LA 1JB1A 2C00A 2PTGA 2I87A 3BGDA 5F9MA 4CQLB 1ISMA 1PKXA 1XZEA 2ID9A 3ASZA 1XZ8A 5G41A 4ASUA 5FTKA 2UDPA 5U4QA 2D62A 3RTCA 1J23A 4ZALA 3UK7A 2CBGA 4PG5A 2YW9A 2O8CB 1F06A 1LVUA 3EA4A 3Q0TA 4PAGA 1QQAA 2GM9A 2PX5A 3CPJB 3VH1A 2OR3A 1WVMA 5L7TA 4X24A 1JJIA 2QA5A 1VCOA 3DCNA 4LNAA 4MARA 4DY4A 2PLNA 4D57A 3SJZA 1G5TA 2FZEA 4K6CA 4RY9A 3QVGB 2ZWIA 1KS2A 1QPBA 1UJNA 4RY0A 3JZFA 2IPAB 1BGVA 5IN5A 3TLCA 3DEHA 1YFJA 3WYEA 4DJFC 1OFTA 3FTNA 4KBFA 2BGGA 2B2XA 2R79A 1BDMA 4G07A 5HF5A 3C5WP 3VAYA 1KJJA 2OCAA 5HMMA 3WYAA 5IKEA 1MIOA 1J2JA 2CF6A 3EGOA 4K8OA 4KQWA 2ZDHA 3QLUC 4J76A 1JQDA 4P31A 5DSZA 4H08A 1DJOA 1GG2A 3KLOA 4MHSA 4Q7LA 3TO5A 3AW9A 1V8ZA 3ZGVA 1MAVA 1GKKA 2BI8A 4BNNA 4BWGA 4DSOA 4F86A 4H1WA 3ESZA 1ATZA 1VJ0A 4HVLA 2FZ4A 3FKQA 5IM5A 1NW8A 2X5XA 3L92A 2VQ6A 2FFHA 5A1JA 3ZHTA 2QT9A 3EISA 3KELA 3SHOA 2NU9A 4DR2B 4MAAA 4B4OA 3TCNA 3VR6H 2F8MA 3TVYA 3IEKA 4GP7A 4FJ0A 1L5GB 2QRPA 4BP1A 1NBMD 1Z18A 2VSQA 3N0WA 1RAAA 4EL0A 1UINA 2VNSA 2IUTA 4UOZA 2GZHA 1GZSA 1JXOA 2ZB3A 2ZBRA 4JJGA 4PCLA 4YCBA 2CLFB 2AG0A 2IA5A 2JKVA 4NHEA 1G6Q1 2JPDA 1JWAB 1VB3A 4FIDA 1NTOA 1VPWA 1JU9A 5CEEA 2K7ZA 3W4KA 3IIJA 4CYMA 4U8HA 2WSYB 3GBVA 4Z7JA 5EXDA 2J7PA 2O8FB 5EMLA 1PKEA 1QKKA 2JCSA 3W3AA 3S29A 1ZRSA 2ROQA 2JNWA 4CG1A 1QCDA 3BK2A 2HSWA 4I3HA 4AX4A 3AI7A 5CUQA 2FGJA 2CT8A 1WOMA 3HB1A 4CLDA 1U7ZA 4WFKA 4BWFB 4WKBA 4AJNA 3PFCA 4TWZA 2NX2A 1A8SA 3E9DA 2BEWA 5B1EA 2IHZA 4HMOA 1ONOA 2GWHA 4WNCA 3DXZA 3ISTA 3H18A 2OHFA 1F17A 5IRCD 2RI0A 3KQOA 4LNHA 3D2CA 2JATA 2CL6X 2J3QA 1REQA 1BXZA 2XUJA 3HK2A 3BXXA 4UHKA 5K6AA 2K7FA 4V39A 1DGQA 1OZGA 4RDHA 5CEFA 1Y3FE 2EBHX 3NHMA 4R9SA 2I71A 2BZGA 4D8UA 1BKSB 4E5UA 2GVZC 1VHWA 4LC0A 4EPXA 5BQ3A 2OV4A 4UNSA 3B89A 1A97A 3MVEA 1LQ2A 3MMZA 4M8KA 4QJBA 2HSGA 4I14A 1SCUB 4EM6A 3B1WA 2XUPA 1K6JA 2BKLA 4LQLA 2H2DA 3TTYA 4PS0A 4BQEA 1EX6A 3GLGA 1MZVA 1B6RA 1XC7A 1OFIA 2AC2A 3UGJA 1H4SA 3R0QA 1EE2A 1PEDA 3W6OA 2GFQA 3BMCA 1MRSA 2VDVE 5FWNA 4QHYA 4N6OA 1HF3A 4O2RA 3MT9A 1E9SA 1SHLA 1SXJA 4R05A 2IDZA 5K0TA 1NFRA 5LZ9A 2QPLA 1G7RA 2DFDA 1N1DA 2FUNB 2VDKB 2YZGA 3BJIC 3BXOA 5I3ZA 2RC5A 2CXXA 4MVJG 1ZINA 2ZTUA 3R9IA 4E03A 4BOYA 2C1XA 2K5UA 4I1VA 5FPSA 3G82C 2DH6A 3BE6A 2PNJA 5K0SA 5KI6A 2W6JA 3X1WA 4JLJA 2XTAA 4R5HA 1QHIA 3RC9A 4JVOA 2CUZA 2ZK7A 4MQEA 1OPXA 2IKSA 2AA3A 2CVHA 4LWOA 1ZD4A 2MYUA 1QVRA 3K9LA 3PDJA 1DIGA 2ATIA 2FUEA 3ZE8A 3JPWA 1M3SA 1TVMA 2R8BA 3KUCA 2XCSB 2OHIA 4H3KB 4BUJA 1BXKA 1DKNA 1PT9A 1G21E 2J3EA 3SJUA 5LOVA 1RZRA 4Q0MA 1CY1A 4MQ5A 1L5HA 4UHCA 2PXXA 2WVGA 1RBYA 2Z30A 3ZGXA 3L2OB 4UZSA 1I4EB 3LUBA 1GLGA 2QMOA 3LYAA 4UUNA 1CUBA 1CXZA 1DMSA 1M34A 1XRLA 1ZESA 2Z2JA 3MAAC 3S8EA 4RPJA 3EG5A 5K8VA 3HPQA 5FTJA 4C88A 2HGZA 3K9BA 3OLWA 4KE7A 2PT5A 1P5FA 4FOTA 2NU9B 3MSCA 4NC9A 1KJQA 4KKVA 1QP0A 1PR1A 2ZSFA 3L8DA 3MWDA 4LNUB 4BFZA 4EENA 2TRSB 4C7XA 5HTKA 4KUHA 4I2NA 1YIDA 4E0BA 3V1TC 4HGQA 2FN4A 3QXGA 3SXUA 4RJTA 3RUFA 5BY2A 4BGDA 1TM4E 3NR2A 2PMBA 3QU5A 4P7JA 4C5BA 1J70A 1MW9X 1PJAA 1G20B 1VIYA 2ZREA 1XQVA 1DDIA 1NT4A 3AETB 5HS6A 4C7VA 2QRNA 3OLYA 5DLQC 4Z1OA 3EHDA 3T4UA 4GG1A 3FI0A 4ZQIA 1A9XA 3CLRC 5TSDA 2ZJ0A 4QJ3A 1SR8A 4K9LA 1U7WA 5M04A 1QV9A 2OXTA 3CPEA 3KKPA 3CT4A 1E2NA 4ZPJA 4P5EA 3TZLA 4CN8A 1DKUA 1PJLA 3I6BA 4X63A 1Q7TA 1CY2A 3THYA 3Q7EA 2QVCA 3Q88A 4HMPA 1N6IA 3PFKA 5DP2A 3AU9A 1E2EA 3OZCA 3WIVA 1C80A 3DEAA 2R44A 5HILA 3L0BA 2J6CA 3UWKA 5E2BA 4EG6A 3HXQA 3UWMA 1R66A 4P36A 2C2HA 1SIUA 1AUPA 3MMSA 2PUVA 3PWKA 4S2EA 4UBLA 1SU4A 2CNWD 3JD1A 4EUEA 4Q4JA 1IG3A 3JD0A 3S3TA 4D9CA 1XJ0A 2CNWA 2Y1CA 2PTHA 3A9UA 3W1EA 2GJKA 1P4HA 3EB9A 1E9DA 3NVAA 5A04A 1LTQA 1T9BA 4JB0A 4F97A 3WQSB 4Q02A 1FP6A 1I5RA 3F5SA 4KMRA 1PZNA 4GE0A 5AKIA 1ZIDA 2C4WA 2ZE7A 4OHUA 3GZTB