3S2GA

Crystal structure of furx nadh+:furfuryl alcohol i
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
340
structure length
340
Chain Sequence
b'AMMKAAVVRAFGAPLTIDEVPVPQPGPGQVQVKIEASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGYVSAVGSGVSRVKEGDRVGVPWLYSACGYCEHCLQGWETLCEKQQNTGYSVNGGYGEYVVADPNYVGLLPDKVGFVEIAPILCAGVTVYKGLKVTDTRPGQWVVISGIGGLGHVAVQYARAMGLRVAAVDIDDAKLNLARRLGAEVAVNARDTDPAAWLQKEIGGAHGVLVTAVSPKAFSQAIGMVRRGGTIALNGLPPGDFGTPIFDVVLKGITIRGSIVGTRSDLQESLDFAAHGDVKATVSTAKLDDVNDVFGRLREGKVEGRVVLDFSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc-containing alcohol dehydrogenase superfamily
molecule tags Oxidoreductase
source organism Ralstonia eutropha
publication title Crystal structures and furfural reduction mechanism of a bacterial zinc-dependent alcohol dehydrogenase
rcsb
total genus 109
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3s2gA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3s2gA01
3K5PA 1E7YA 3GUYA 4NZ9A 4PZEA 1LC0A 5KNLA 4BGVA 1T2DA 5F1OA 3O4RA 3BMOB 4ZA2A 4MKXA 1JDJA 3F46A 2IXBA 1LXCA 1A4UA 1GZ4A 1NPDA 3Q2IA 4BNTA 3O03A 4IMPA 5BR7A 4RCVA 4BKUA 1GPJA 5G0SA 4B7CA 2C7GA 5KJFA 2IZ0A 1IYZA 1U9JA 2PA3A 3NTRA 3GN1A 1DFGA 1GL3A 4K1LA 4L74A 5JYDA 1UDAA 4R5HA 1QKIA 1Y8QA 4ITUA 3CIFA 1KY5A 4RPGA 1EVIA 3E9MA 3I3OA 1U3UA 3QWHA 1Q7CA 2A94A 2GPTA 4R5MA 1LLQA 2NVBA 3AM3A 1D8AA 4P4LA 1CYDA 2C2YA 4BL5A 2IE0A 5U4QA 3KZVA 5IDXA 3FCOA 4ALIA 2J3KA 4Z0PA 3G0OA 3FRJA 4J7XA 1PZHA 2BI7A 2HJSA 3RU9A 1BXGB 2J8ZA 1NVTA 2SCUA 1I32A 1DAPA 3Q0EA 2G17A 4J4HA 4NH4A 3P2OA 3N58A 3PLRA 4IJKA 3S2GA 2UDPA 1AGNA 1R4MA 4GMFA 5L7WA 1EK5A 3ZNQA 2HDHA 3ZU3A 4E21A 1DB3A 4IDGA 3LU1A 3MWEB 5ICSA 4UUMA 1OAAA 2OOSA 4FOSA 5JMPA 4WLNA 2AQKA 5ER6A 1YBMA 3QJ5A 4YRBA 4CM3A 3ADPA 2I9PA 3DXFA 2H5LA 2Q50A 4BKQA 4HFRA 1PIWA 1LJ8A 1TLTA 4BS9A 4DBVO 3HJAA 5T67A 3V1UA 3KEQA 3GDGA 4IY1A 1LRLA 2WE8A 2RH4A 3CE6A 3GRKA 2BLLA 1OI7A 3L9XA 1A4IA 4ONEA 3KYDA 1ZMTA 1LDGA 2DLDA 5KVSA 2C54A 2O2SA 3NT2A 4Z0TA 3SVTA 1S7CA 3FBGA 5T64A 1C0IA 3JCZA 4H7PA 4F3YA 2E6UX 2X58A 5I8WA 4CMGA 2J5KA 3SEFA 3RC9A 1GYPA 3PWSA 3U3XA 4M54A 4AJJA 3HN2A 4RVFA 5C7IO 1M76A 1GEEA 2AMFA 5DBGA 3U5TA 1YH3A 4B3HA 4OXNA 1ULSA 5JXWA 4MVJD 1LDMA 5T6BA 4U0JA 3H5RA 4MKZA 3RFXA 2X8LA 1WMAA 1J5PA 4HV4A 1TEHA 4RVDA 2UUPA 1HXHA 1SEPA 4H16A 1UZNA 4IDCA 4KTTE 1C14A 3T7EA 3WLEA 1WWKA 4PLGA 3CEAA 3A4VA 3PTZA 2Y1FA 4G81A 2X6TA 5EERA 4QEDA 2UAGA 4IS3A 4CJXA 2H6EA 1R12A 2X0JA 4DLBA 4DUPA 5H83A 4LW8A 5EMHA 5I8ZA 1I30A 2DFVA 4DLLA 1YS4A 1P74A 3W4KA 1BVUA 1HETA 1WXDA 2J5QA 4E4YA 1U28A 1GADO 3VDQA 4RZHA 4YR9A 2FPIA 2YZ7A 3L77A 3AOGA 3OH8A 1PSDA 4BMNA 3RC7A 1O89A 2P2SA 4E3ZA 1TB4A 3LT0A 4KMSA 1PJ2A 2NTNA 3KVOA 1F14A 4ZRNA 4CMHA 4YT5A 5BSFA 3D3WA 3E18A 4JIGA 4P4NA 2BFAA 3UCXA 2HQ1A 3OETA 1EQUA 1NPYA 1VJ1A 2IYPA 1PJLA 2NVUA 3TL3A 2O3RA 1NNUA 3QA9A 1B3BA 4XKJA 5JAZA 1RWBA 2OUIA 4TSKA 4DYDA 1DLIA 1ONNA 2ZTUA 4XQ9A 4EJ0A 3I52A 4I1IA 1GD1O 4BB6A 5A3JA 5A9SA 3I6QA 4X54A 1JU9A 4WLUA 1KOLA 4B3JA 2YV2A 1JLLA 3H2SA 2DM6A 4JXKA 1LSJA 5CDYA 5HM8A 1MFPA 2VTEA 2C07A 1W8DA 3BTSA 4YXFA 3WQSB 3BMOA 4CMAA 3D3WB 1P45A 4PLYA 4BIIA 2PD6A 1MX3A 3WDSA 3CINA 4K6FA 3DBRA 1E3JA 4U6QA 3L0DA 4XQEA 4GX5A 3WOHA 1BTOA 1DJQA 3SJUA 1LLCA 3FNHA 2CMDA 3GGPA 1C1XB 1HWYA 4L8VA 4PVCA 4GBJA 1OC2A 1EK6A 5A3VA 1PZEA 3HZZA 3BYZA 3HN7A 3TPCA 2DTDA 1B0AA 1PEDA 1EFKA 1P1IA 1JKJA 1KEWA 1UP4A 3HDJA 1JW9B 1W0CA 4YAGA 3FSRA 3GZNB 4UAGA 1HDXA 4OM8A 4K26A 1HLDA 3BA1A 4I5DA 1RPNA 3DZKA 5TSDA 1LA2A 1ADFA 4D41A 4KDEA 4KUHA 1NQAO 1WPQA 4QECA 2CF6A 3UGKA 4XDYA 3K9QO 3Q9NA 2HKIA 3ZCXA 1SMKA 3P5SA 4J1SA 3RROA 3M2PA 3PDJA 4YRDA 4W9NA 3WGIA 1BXZA 2V6FA 1H9AA 3DBRB 1GCOA 1P3DA 2O7SA 5TIIA 4CLEA 3ONEA 1EUCA 1QMGA 3F5SA 4BMVA 2Q46A 1Q7GA 4BKPA 1K6IA 1PL7A 5EINA 2Y1DA 1VL8A 3OA0A 2AXQA 3PLNA 1FDTA 1G6KA 4IINA 1IUKA 1YQGA 5IFLA 4B79A 4TWRA 4XQGA 4OL9A 2HU2A 4NG5A 2EJWA 5GY7A 3LF1A 4NFYA 3ZV4A 1EZ4A 3OJOA 2VQ3A 1O95A 2EIHA 1XYGA 3NJ4A 2ZIZA 1Y8QB 5JE8A 3G79A 2PZKA 2O4CA 1HEUA 2P5YA 1NHGA 2NU8A 3N7UA 3WFIA 1YKFA 3V5NA 1F12A 5F5LA 4A2CA 1LRKA 4D42A 2DBRA 4ZN6A 4MDHA 4RF2A 4EUHA 4CV0A 1HDYA 1MXFA 1X0VA 1WDMA 2QYSA 2O23A 2VCYA 4ZQHA 5HBRA 3AY6A 3RJ9A 4NIMA 2D3TA 1BXGA 1QXSA 1UP7A 5LC1A 4EJ6A 1R4MB 1K6XA 2VRCA 1DBVO 2GN6A 2P5UA 2VHYA 1DRUA 3PHGA 2EF1A 2ZYDA 3B70A 4L75A 1O94A 2GERA 4YT2A 2C82A 2VZ0A 3HWRA 3DMTC 5I7SA 4YYZA 4ROSA 3ONFA 4Z3DA 4E5PA 1LX6A 1IOLA 3TZCA 3WTCA 2X4GA 3R3JA 1E3WA 1LNQA 2R2GA 2Q2VA 2VRCD 4UEJA 4IXWA 1LLUA 1MC4A 3GPDG 5IDYA 2JL1A 1I2BA 4BKOA 1MFZA 1N7HA 3RASA 1E1KA 1VSVA 5MDHA 4CM8B 2HSDA 3D7LA 1XDWA 5KTKA 1E5QA 2EGGA 1SOWA 1NR1A 2F00A 2R00C 1XHLA 1O9BA 4CUKA 1J4AA 3X2EA 4R16A 5L3ZA 1HDZA 4HY3A 4NJMA 4PLZA 5G4KB 3RIHA 3EY4A 4D3FA 1XA0A 3VH1A 5CEJA 3C7DB 5B4TA 1ZNQO 3JYOA 3M1LA 4D0RA 1I3NA 5DT9A 4M1QA 5K9ZA 4ND1A 1XKQA 4WCFA 1V3VA 1R15A 2EP7A 1CDOA 4HKTA 3WJ7A 1WZEA 1SCUA 1F8FA 4H15A 1QYDA 3OIDA 5JAQA 4B3IA 3MEQA 1PX0A 1GTMA 3ROQA 4AJOA 1LQUA 2ZB4A 4RF5A 5HWSA 3INTA 5DZSA 1JKFA 4Q3AA 2O3SA 3M2TA 5TS3A 1GY8A 1HSOA 5JCXA 2JCVA 4FIZA 4B4WA 5L9AA 5JPIA 5DP2A 4XDZA 4GSKA 2QX7A 1U7HA 1LRJA 2BFMA 5TJ9A 1VLLA 1QYVA 3GVXA 3ZN2A 4W6ZA 1FDSA 2Z95A 1HE5A 1NQ5A 1X7DA 2I65A 4M8SA 3NUGA 5DCYA 3SLGA 2CD9A 4U8GA 2R00A 4LMPA 3K73O 1D3AA 3WGHA 2C20A 1FJHA 1T24A 4WECA 2VRBA 4RL6A 4KUGA 4J49A 1ZK0A 2ZATA 1PTJA 1EVZA 3LDHA 3TSCA 2BH9A 2OP1A 5FEUA 3KLMX 3B1KA 4BGEA 5KIAA 1E7MA 1SB9A 2EKLA 4FD3A 2PZLA 1ZUD1 5A03A 1BVRA 3DAFA 5TT1A 4FCCA 2VYND 5KWEA 1T2CA 3ZWVA 3UH1A 3DOOA 3PZRA 1R4NB 1ZSNA 1DPGA 1CF2O 1EBUA 3KLPX 4W4TA 4FOOA 4RQTA 4E32A 3PQDA 1T1SA 3GT0A 3QVWA 3PHHA 1UH5A 3RJ5A 3O8QA 1U5CA 4IQ0A 3PWKA 1ENOA 3OFSA 1VC2A 2RHRA 2DTEA 4D44A 3UOGA 4DPLA 4XB1A 3NAQA 2ZJ1A 5JNLA 4TMFA 2BGLA 1IZ0A 2JHGA 2QIOA 3KXDA 3EC7A 3NTQA 5I9LA 3AUUA 3KYCA 2ZB8A 2WWRA 1DEHA 1H5QA 2AQ8A 4IDBA 4NR0A 2Y67A 3HFGA 4E5KA 3OSUA 1X7HA 3WS7A 1H2HA 4BNKA 2ZCUA 2W2KB 4HNGA 4YBZA 3LT2A 3DDNA 3JQDA 2WSBA 2EERA 1V9LA 3KM0A 6ADHA 4E2ZA 3GLQA 2Y0EA 4FFOA 5FYDA 1OFGA 4AICA 2RH8A 3LC7O 3F47A 2VWGA 3IC5A 5ES3A 2GASA 1P0CA 3QHAA 4WCDA 1DC6A 4BNZA 1IHXA 4L4RA 4D7AA 2D1YA 3H9JA 5JMWA 4EI2A 2X0RA 4DMMA 2OXIA 4HFNA 1K89A 4UVHA 4J9UE 1L1FA 5L95A 4XQCA 3Q9UA 4S1VA 1G0NA 3I9LA 3GAZA 3U4DA 2UYYA 1EFLA 3KYCB 4HADA 5CEFA 4DVJA 4J6FA 4DMLA 5GZ3A 5AOVA 1O0SA 1P1KA 1HTBA 1N7GA 3JQEA 3PIDA 2F1KA 3ZV5A 4EZBA 1GPDG 5EQFA 3HE3A 1P0FA 4DPKA 1RJWA 1XCBA 2DBVO 4INAA 2AEJA 3JSAA 3UCFA 2GD1O 4RZIA 4II2A 3LLVA 3OF2A 1E3SA 4JP3A 3GF4A 5COQA 1DIHA 1CQJA 4CR8A 2B35A 1P31A 4PLCA 4YTEA 2GZ1A 3KO8A 3L4SO 1XQ6A 4XX0A 5TC4A 2FN7A 3WGZA 4WCFC 3JQFC 3KSZO 3GEDA 2CDAA 5ITWA 2Q1SA 3ZHBA 3E03A 1NBOA 3ABIA 4E33A 4DA9A 3V2HA 3WGYA 2PK3A 5HRUA 1ZXLA 4FQ8A 1NAHA 3CPSA 2H9IA 1ZBQA 1I5RA 3CH6A 4DIFA 4YCAA 4BO6A 1YOVB 5K0ZA 1H0KA 4RORA 1ZEMA 3OMLA 2XAAA 1GQ2A 3UXYA 3AI1A 5A06A 4KP7A 2UUOA 4BO4A 4CV3A 3KB6A 1Y8RA 4R3WA 3AU9A 4YEDA 1E6EA 5B4UA 5JY1A 3H3FA 4J4BA 1W4ZA 1GUZA 1BG6A 4E5YA 5ILGA 1ADGA 2PTGA 3ITKA 1UXGA 3LSYA 4WNCA 2JAPA 4NU5A 1D1TA 4KUEA 5DBIA 3FR8A 4WLEA 5JBIA 4DC0A 3ZWAA 2EWMA 4L0QA 5IZ4A 4NPCA 3NDJA 4PIVA 3DHYA 4A73A 4FFRA 1UDBA 1K6JA 5JC8A 4MVJF 4O59O 1ZZEA 4XD2A 4BNLA 2BHLA 1EVYA 2HUNA 1NVGA 1ZK1A 3IUSA 2CNBA 3P2YA 1XU7A 4YWJA 3GVHA 4BO3A 3U09A 2FP4A 4RF3A 1Q7BA 2Q45A 3FN4A 2RBEA 5CFZA 1I33A 1QV6A 3VH4A 4LISA 4YT8A 4PGFA 3NT4A 3OIGA 4Q3EA 2ZB3A 3IUPA 4R9SA 1KEVA 5IZCC 4MIOA 4MP6A 4CMKA 4XCVA 1JQBA 5FWNA 1GYRA 3U4CA 2B4RO 3MCVA 1JAYA 3CKYA 3QWAA 3IP1A 2IZ1A 1QYWA 3OA2A 3EYWA 3UF0A 4Q3NA 4H3VA 4HUJA 3E8XA 4UUPA 3GEGA 1QG6A 4MVJM 1PJ4A 2ZQZA 3IAHA 4NK4A 4BMSA 2WTBA 4FFNA 1PR3A 2X0NA 1Z7EA 5A05A 9LDTA 5I7FA 1HYHA 1MGOA 1YDEA 2V6GA 1U7TA 3VPXA 2P9CA 2JD1A 2ZYAA 1GFSA 4UREA 4E13A 1ZW1A 3TL2A 1QR6A 4JBIA 1MXHA 1Y9AA 3ASUA 3VAZA 2Y99A 3IJPA 2QRJA 3PXXA 1Y9EA 3IOYA 1DDOA 3PJGA 3TRIA 3W8DA 1YQDA 2YFHA 1B2LA 3DHNA 1UZMA 3BMQA 3RCBA 1A72A 1GUFA 4IGEA 3HB4X 4BNMA 3CSDA 1P1RA 5BT9A 3IJRA 2JKVA 3QWFA 4IDDA 3RUFA 4RVUA 3UFXA 2GZ3A 3MJSA 2DVMA 1C3VA 1E7WA 2J6IA 1DC3A 4CLHA 3RKUA 3QVXA 3GNQA 4JROA 1PQWA 4N5MA 3UUWA 3E9QA 4OSPA 1EMDA 4PLHA 3PDUA 4IQ8A 4QX6A 4A5OA 3O26A 3Q6IA 1I2CA 4N5NA 3I83A 4CM9D 1A7KA 3Q11A 5JO0A 4M86A 4DPMA 3EDMA 2CVZA 2G1UA 4IBOA 3CMCO 3KSUA 1VPDA 5IG2A 1N92A 4PG4A 3NRCA 4TKMA 1VJ0A 2CF5A 3EGOA 1H6DA 4XJSA 1H6BA 4K9DA 2B5VA 4OIMA 4P38A 4PG6A 4BHTA 4EW6A 3JQAB 2A4KA 3I1JA 3GRPA 3QE3A 2PKRA 5F1PA 3VTFA 3WYBA 3JQAA 4E6PA 5TT0A 1XGKA 4FBGA 5G0TA 3KYBA 3BMNA 2I66A 2C59A 4JK3A 3JYLA 3WTBA 3DBVO 3JQ7B 5JC1A 3FHLA 3V1YA 3F1KA 2VHXA 3HQ4O 4M89A 2AG8A 4NFHA 5DP1A 3JYNA 3WSWA 5KOIA 3DTTA 3VZQA 3NEPX 1NFRA 1RM4A 5A4DA 4OO3A 2EHDA 1FK8A 2C0CA 4GKVA 4MP3A 3TZ6A 3TZQA 4OXYA 1GDHA 3GR6A 3UN1A 4IXTA 4R3NA 1PJBA 1SC6A 3H4VA 3W4JA 3AU8A 4HWKA 2PV7A 4OJNA 4UUOA 1Y7TA 1T2EA 4CL3A 2PLAA 1ZCJA 3IKVA 3ZH2A 3T4EA 1GYQA 4QO7A 3GPIA 2D4AA 3PYMA 1QV7A 4LVCA 3DTYA 2OGUA 2NV6A 3BHJA 2NNLD 4FSHA 1MUUA 1U8XX 2C7VA 3W8EA 3AI3A 2VOEA 1AHIA 1HL3A 2BGKA 3AW9A 4PLTA 2Q1UA 3DHEA 4MKRA 1CWUA 1W73A 2I67A 3OICA 1X15A 1MG5A 1PJQA 2R6JA 3WFJA 1HDGO 4IMRA 3UAGA 1GQYA 3DOCA 3M6IA 1TVEA 3P7MA 4YDRA 1V6AA 3LT1A 1YRLA 3L4BC 5A9TA 3RFTA 1I36A 5T8KA 4DTIA 2Q2QA 3MTGA 5AXBA 3RUAA 4XIJA 1U2DA 3E5RA 3QVTA 1HYEA 1KEUA 3INRA 4MINA 3WWYA 1I8TA 1IB6A 2DPHA 4XGNA 2YUTA 3K96A 3ANLA 2GR9A 2FR1A 3COSA 3MJEA 1YL7A 3GFGA 4O6VA 1ZIDA 4WLFA 3RSHA 3ZNOA 4YRAA 4KWIA 5U1PA 3GHHA 4AJKA 4WJZA 4TRRA 1MP0A 3H6KA 5TGDA 4DGSA 1NWHA 3DZFA 3I23A 2GSDA 5DOVA 2HMUA 3K6JA 3WNQA 4EDFA 3ITDA 5I9NA 3PRJA 5U9CA 1WAMA 4Q39A 5DOZA 4TVBA 1X7GA 5IF3A 2I76A 3H9UA 3ENKA 3G1UA 2JJYA 3JQ6A 3AUTA 2WYUA 4CM4B 5MGBA 2WYVA 4LRSB 5TQVA 3VKVA 2V6BA 5CEEA 2ZTVA 3DZIA 1AN9A 2X5OA 4CM4A 1B8PA 3HG7A 4M49A 4BNHA 4URFA 3C3XA 4GPD1 4FB5A 4M55A 1HZJA 1WZIA 3ETGA 3FTNA 3MOGA 3JQBC 3RD5A 4IIVA 1DRWA 1GUYA 1T4BA 5A04A 3L6EA 1YBVA 2EW8A 4I5FA 3W6ZA 3DC2A 2OORA 3JD3A 3I5MA 4PRKA 2YJZA 3GY0A 4AJ1A 2QZ9A 1U3WA 2YW9A 1IULA 3B1JA 4PZCA 3D4PA 3GEMA 1GR0A 1RYDA 5I7VA 3PQFA 4Z9YA 1ONPA 5F5NA 2HLPA 4WPGA 2NUAA 2GLXA 4GAEA 2NU6A 1E1MA 4J1QA 3B6ZA 1X0XA 3DL2A 3AFMA 5THKA 4CMEA 1I2ZA 1KVSA 4JJIA 4IDEA 1OBFO 1R4NA 2XXBA 2HRBA 2OHXA 5C5IA 1DFHA 2J5RA 3LT4A 2DFDA 1X14A 3BAZA 3F1LA 2DT5A 1VRWA 2AQHA 3H9GA 4TRMA 4CV1A 4A7PA 3ZDFA 3VZPA 3GVPA 3G17A 5DCWA 1F0YA 3HDYA 1KS9A 3DZJA 4YA6A 4Y67A 3ULKA 4DIBA 1A27A 1TA4A 4M87A 2PZMA 4DRYA 4AJPA 4II3A 3RUCA 2X1HA 4F46A 2PGJA 3ZU5A 4HFMA 3DFUA 4W9NC 1LSUA 2OL4A 2POQX 4CQMD 1AUPA 1EDZA 1Z7BA 5B12A 5J23A 4OQYA 4R1NA 2GN9A 5L4LA 5B37A 2B4QA 3G1TA 5ILOA 3NX4A 2ZYGA 3ZU4A 3A9WA 3WGGA 3GA0A 1PR9A 2PH5A 5KCZA 4AFNA 1QRRA 2V6MA 5HTOA 4FN4A 5CPFA 3E1KA 2VUUA 3PQEA 4CM5A 3A28A 3INGA 1B7GO 4XRRA 9LDBA 2WEKA 2Y93A 4CQLA 4BVAA 2UVDA 3NJ8A 4N54A 3A14A 1HDOA 2NQTA 1TT7A 1M2WA 4HNHA 1DIGA 3ZV3A 3LF2A 4CL8A 5BSEA 1ZO8A 3WG9A 4XB2A 1M75A 1WLYA 4D3SA 5C7OO 1I0ZA 3NV9A 3BTVA 3CMMA 3I4FA 3KUXA 3VZSA 3RKRA 4EGFA 1UXIA 1GV0A 1EBFA 2AHRA 2VWQA 2IZZA 5JAMA 5TNXA 2CZCA 4A03A 3ORFA 2FRDA 3QVOA 3W8FA 5FI5A 3ST7A 3QQPA 4Z6KA 3I9KA 3AUSA 5TF4A 4QQRA 2X9GA 5DCUA 4K28A 3L9WA 4I9UA 2BMAA 1LSSA 3FNGA 2E49A 4JGBA 4W7HA 4E5MA 4ZJUA 1NHWA 3GVIA 4FJ1A 4IJWA 1H94A 2EXXA 4QFDA 3ETEA 2AEFA 3CZMA 4NI5A 3STHA 4OOFA 2CVQA 1B14A 2QRKA 1FMCA 2Y68A 3EZLA 3LZ6A 3TWOA 1FXSA 2FR8A 2QHXA 3EMKA 1RM5A 1DLJA 3TNLA 5A02A 3S2FA 3VVBA 3RBVA 3HNPA 4LCJA 2W2KA 2D8AA 2Y1OA 1YO6A 3CZRA 4QFCA 4CQLB 1BHSA 3IIEA 1IY8A 1CRWG 2FZEA 4LK3A 1JVSA 4J3FA 3BZUA 3TQHA 3PWZA 1VE9A 2GYYA 3MOIA 2I99A 4L73A 4BNNA 1PGQA 3GDFA 4YACA 3BTOA 1B26A 3DR3A 3LYLA 2Q1WA 2Y0CA 3B20A 3ZHYA 1QLHA 4FJ0A 2X22A 1SEVA 3MTJA 1QYCA 4ALJA 1JN0A 4CR6A 3VC7A 2PKQO 4RPJA 2B4TO 4GVLA 1M6HA 5F21A 2DC1A 2JFHA 3JYPA 1PGNA 3ADOA 4B7XA 4I5GA 1NASA 5KJ6A 3GH3A 5KVCA 2ZCVA 1VSUA 3FWZA 1E3WB 1MC5A 3Q2KA 3WQRA 2O4UX 1PGJA 1YWGO 3LQFA 4UUNA 5DF1A 3OJEA 2WD8A 4W7IA 2BKAA 3H5NA 4E2WA 4Y8VA 4RO0A 3DBHA 4Z0HO 1GEGA 3MJTA 4GMGA 3VH3A 4TKLA 1XLTA 3JQBA 2BFOA 2X0IA 2E37A 4U5QA 5ENVA 1X1TA 3TOZA 1AHHA 5KVQA 2PGDA 4N18A 4RPKA 4R9RA 1DSSG 2FWMX 4HP8A 1ISGA 4IQGA 5CP8A 7MDHA 1Y5MA 5ADHA 3BMCB 4ALKA 3VTZA 4JBHA 2DUUA 3LK7A 4J1NA 3ZWNA 2RAFA 5JDCC 1K3TA 3PVZA 2PKQP 3TJRA 4IJVA 5FI3A 4JNKA 5CHEA 4YAEA 4BGUA 3DOJA 3BXXA 3EAGA 1UZLA 1K2WA 3HB5X 4QT0A 4B7UA 1Z82A 1KBZA 2G5CA 1IPEA 4O5OA 2I3AA 2GF2A 1X13A 5FF9A 1E6UA 3DONA 1KYQA 3F9IA 3PFFA 2PY6A 1E6WA 4R51A 3DO5A 1JAXA 5KVVA 4CUZA 3DWFA 4QTZA 1FF9A 4WCFB 3NDIA 1DO8A 1U2GA 3ASVA 3K2EA 4ALMA 4L4SA 4E2XA 1L7DA 5H81A 4J9VA 1E3IA 4XWYA 5CDSA 1G1AA 2PR2A 2NLOA 2XOXA 5JSFA 4BNJA 4OQZA 4QXMA 5DDIP 3KHUA 1T1RA 5L4NA 4FJ2A 1S6YA 2IRWA 4NBTA 1F06A 2QW8A 3H3JA 3WX0A 3HDQA 4YB8A 4LCEA 4BV8A 2Z1MA 1OOEA 1BDBA 4RVGA 1GZ6A 3ENNA 2JAHA 3GMDA 1GU7A 1ZK3A 3PJDA 1AXEA 3KSDO 2WM3A 2P9EA 4YQZA 2HAEA 3F4BA 1E92A 3VKUA 4G65A 1FDVA 4F6LA 4DWVA 3MJVA 4J4TA 1PWZA 1XG5A 4BO5A 3IS3A 2HO5A 4JP2A 2W90A 4C7KA 2CDCA 4FGWA 4XA8A 2IEBA 4A10A 5CDGA 1EUZA 1YVEI 2AQIA 4CUJA 3WR5A 1HLPA 2Q3EA 3K30A 3FD8A 4G5HA 2NACA 2NQ8A 3AM4A 2YV1A 3GNTA 4FFPA 5LDGA 4NBWA 1Z45A 2FPGA 2O3JA 5L51A 5L7YA 2GCGA 5IXYA 4KQWA 1IE3A 1P1JA 5T5QA 1NXQA 2FR0A 4RLHA 2E82A 4Q3CA 3HUDA 1BRMA 2VOJA 3AY7A 4JJGA 2O48X 4U6SA 3K8ZA 2JCYA 4DREA 3RUHA 2ZTMA 2O3QA 2Q99A 2UV8A 3C24A 1P9LA 5JY6A 4RPLA 4CM1A 2VN8A 2NWQA 3HHPA 1U3TA 3WBFA 1I10A 3RQSA 3PYXA 3FF4A 4IJUA 5A9SB 1UAYA 3C1AA 1ULUA 3ICPA 2FMUA 3MJ4A 3H7AA 2VWHA 3TZKA 2JD0A 5L53A 5LDHA 5A5FA 4R41A 5JDIA 1WVGA 1NPTO 3KV3O 4UEOA 4IIUA 4WOKA 2AE1A 2Y0DA 3AWDA 1XQ1A 1B3RA 3JV7A 1WW8A 2DQ4A 2O7QA 2FSVA 5GZ6A 5TJHA 4BNVA 3L4BA 1ISHA 3QW2A 1NAIA 4J2HA 3NGXA 3TFQA 4NU6A 1ORRA 4KOAA 1SO8A 1KC3A 1WMBA 4XYEA 2P91A 3PGXA 2VT3A 3GG2A 1OC4A 4ND5A 1SNYA 4O63O 1LUAA 3GZNA 1CIVA 5JW6A 2W2LA 4W82A 1ZMOA 3H9EO 3E6AA 4WLOA 3CTMA 4AJNA 5DN9A 3E82A 5EESA 2EV9A 5ICMA 4R1UA 2C5EA 3QIVA 4AJLA 5L40A 2BFPA 2DAPA 4O0LA 2O3UA 3I9JA 4I9NA 2GDZA 4J1TA 1E1LA 1UJMA 1Y6JA 2ZQYA 4P8RA 3SLKA 4XR9A 1YB1A 4XRGA 4OXKA 4GX1A 5IAAA 2IEDA 1C1DA 4OOEA 1Q0HA 5F3RA 1U1IA 2HMWA 3D4NA 1V35A 3U0BA 3WXBA 2NU7A 1UXHA 2VHWA 1PZGA 1JWAB 4MVJI 2C29D 4WEQA 3ETDA 4OAQA 4MVJG 1A71A 4AJ2A 5COAA 3FNEA 4UVGA 2VWPA 1DC4A 3VPHA 1V0JA 1U8FO 4DXHA 3DZGA 2EP5A 1C0PA 3ZHZA 1CQIA 4WUVA 5IDQA 2J3IA 1KIFA 1NWCA 3DMTA 2VZ9A 5A1TA 3D3EA 1GQQA 4J0FA 3S2IA 3PYLA 1P33A 3S1LA 3I9MA 1YGYA 1UXJA 1NQOA 2BI8A 4ND4A 1SAYA 3AK4A 1PQUA 4JCOA 4Z9XA 4S3MA 3FPCA 3JQ9A 1ENZA 3ZWCA 3D0OA 3S2EA 4EUEA 3N74A 5CG2A 4ALNA 2CSUA 1B16A 1HE2A 1ML3A 4J7CA 4Q9NA 4PN3A 1VJTA 3DMYA 1LDBA 4IZIA 4YJHA 1C0LA 4R68A 1QYXA 4JLWA 2FOIA 4XJTA 4YPOA 1CJCA 4PFJA 4D46A 5L7TA 4U0KA 1H6AA 4ZQEA 1HYGA 3AFNA 5F1KA 4YJGB 2A92A 2VYVD 2DU8A 4L4XA 1BWSA 3NGLA 3UW3A 1V3UA 2DPGA 4GL4A 2LDBA 3AI2A 2B36A 4WASA 4IDAA 5B1YA 3JQCA 1LDNA 1PL6A 1T26A 4N5LA 3B1FA 1A9YA 1UDCA 4MVJE 1CETA 3PHIA 3F5QA 4CLXA 2P68A 4BGIA 3AOEA 2FPPA 1WDKA 4U7WA 5EN4A 2VYVA 3I9OA 5B4VA 4ZGWA 5BNTA 4KQXA 3PZBA 5JS6A 1JA9A 2Q4EA 4NJMB 1IL0A 5G4KA 3RUIA 1D1SA 1LBEA 3TFOA 2FZWA 3H65A 5EPOA 5CAEA 2IXAA 8ADHA 5TLSA 3VPFA 1VL6A 1ZH8A 2OBNA 1TT5B 4PG7A 1RM3A 1Q0LA 3VPGA 4EITA 2IODA 5AXDA 4NBRA 4Z9FA 1WNTA 2NTJA 3VPSA 2BF7A 4MO2A 3JTMA 1KVTA 1YOVA 4IGFA 4HFJA 4YVFA 3GDOA 2Y1GA 3WJAA 1KC1A 3NDRA 1AE1A 1YB5A 1HKUA 3MWDB 5I7EA 1BMDA 5G0UA 1N9GA 4DQVA 1U3VA 3JQFA 4OH1A 5G2OA 1YDWA 2AA3A 1B15A 3BHMA 4J0EA 3GNSA 3VOSA 3GK3A 5KJ1A 1YONA 5K6AA 1ID1A 2X86A 1KVUA 3OBBA 2ZK7A 3WSVA 4NJOA 4ESOA 2V7PA 5GZ1A 5AYVA 4RVSA 4OHUA 5G0WA 4CLDA 4PCVA 3GUCA 2PH3A 2EEZA 4R1SA 1KY4A 5CDTA 5IXSA 2NU9A 3ZWMA 3LLSA 3L07A 2XF8A 2YHIB 4E31A 2PWZA 3WIDA 1O5IA 4MVJH 4BQRA 4DYVA 2J3JA 4PVDA 2X5JO 1NTOA 1HZZA 1NM5A 1R0SA 3FI9A 1IHYA 3BMQB 1ZJYA 4BO9A 3HFSA 4CV2A 4EYEA 1ZK2A 1O8CA 3WGOA 2WD7A 2J3HA 1FDUA 1JVBA 5A5EA 3WLFA 5H82A 3H9QA 1ZVMA 1NYTA 2BD0A 3R0IA 4KZPA 3VH2A 1P44A 5JAIA 1A5ZA 1BGVA 1NR7A 4ID9A 4JJFA 4F45A 4ND2A 1ZXBA 5C3MA 2CDBA 4ND3A 4BO8A 4ZICA 4NMHA 3QSGA 1EVJA 1YE3A 4CMJA 3LC2O 4RJTA 3DBLB 4J90A 4PZDA 2EKPA 3EW7A 4PLPA 1ISIA 1V3TA 3VVCA 1E5LA 3W6UA 2JFFA 4ZRMA 5L45A 2W98A 1YBAA 3AM5A 2OZPA 4YJFA 1R0KA 3ZI0A 5KKAA 1J0XO 1H9BA 4CPDA 4GGPA 4NQZA 4I8XA 2I5PO 4RQUA 4R54A 4OGWA 1SOVA 2RHCA 3GOHA 5EJ2A 3DB2A 3UICA 4NK5A 1DAOA 1YL6A 4P4GA 2DKNA 3WB9A 4AJHA 4BNFA 4NBUA 5IZCA 3E9NA 1H2BA 3PI7A 2A35A 5G0VA 1ZJZA 3D5TA 4I08A 3ROPA 1CEQA 1MLDA 3E5MA 4E30A 1XIVA 1XSEA 1A9ZA 5GMOA 1XWFA 2WE7A 3BMNB 3ZGYA 1ISFA 5KKCA 1Y1PA 3IKTA 3NKLA 4G2NA 1PGOA 2XXJA 1LEHA 3OECA 3ZZNA 3JQGA 2VHZA 3C85A 5K6AC 3WWZA 4BNIA 1XR3A 2VNSA 4BV9A 2DTXA 2RCYA 4J43A 1UAGA 2I3GA 1V8BA 2B0JA 5IDWA 2JCXA 4W99A 3IP3A 1KERA 1N9GB 2QYTA 3WMWA 4BNYA 4L9RA 4B4OA 4B4UA 4WKGA 4TROA 3DFZA 3AY3A 2OO5A 2Z1NA 3DAGA 1MV8A 4FR5A 1Q2XA 2NTVA 4CM6A 2DBQA 2O3TA 3FWNA 1ARZA 3QV1A 1EE9A 3RU7A 4Y6RA 3JD4A 2FHSA 3OQ6A 5THQA 1LTHR 5JLAA 4I5EA 4IDFA 2X9VA 4Y9DA 3K92A 4F6CA 3ZWXA 1F17A 5HS4A 1N1GA 4LSWA 1TI7A 8LDHA 4FC7A 2EJVA 2QQ5A 3O38A 5T57A 1B8UA 3FNFA 4TZKA 4C7JA 4B4VA 3UHAA 1L7EA 3G3EA 4MP8A 1VI2A 2AEMA 4L76A 3RI3A 2D0IA 2PFGA 1HE4A 2YHUA 3RWBA 2RIRA 4QUKA 2WMDA 2ZB7A 5DNAA 5COBA 1ZK4A 2VTDA 4RF4A 4Y98A 5HA5A 4MPDA 2HK9A 4D3DA 2JD2A 3JQ8A 4YJHB 2BRUA 1R66A 1UXKA 3SX2A 3NYWA 1T2AA 2EW2A 3JQ8B 1KEPA 1YB4A 4LVUA 4OKNA 1GCUA 4UEKA 4BOYA 3JQ9C 1WP4A 3Q3CA 3D64A 1LI4A 3GQVA 3WYCA 4BNXA 4GWKA 1E3LA 3C7CB 2YV3A 4LRTB 5JDIC 3TF5A 1VL0A 1KVQA 3WICA 3UVEA 2OBYA 2OFPA 1IZ9A 3RFVA 3EK2A 4E2YA 4IUYA 2HK8A 4PLVA 3GZ4A 4CMIB 3HDHA 4J16A 1P1HA 3U49A 5EL0A 4FFMA 1Z6ZA 3JQ7A 5IN4A 1PJTA 3C7AA 1A7AA 1W6UA 5CG1A 1N2SA 4P22A 4FFLA 1EUDA 4YT4A 4CQMA 2G82A 1I24A 3TZHA 4MIYA 3PHLA 4K6CA 2Y66A 2NVWA 1TT5A 5G4LA 1E7QA 3W1VA 1LQTA 1PGPA 4C4OA 2V65A 2A9FA 2YYYA 1DIAA 4N7RA 2H1SA 1GAEO 3V2UA 2CFCA 3RVDA 1SPXA 1BW9A 4GGOA 1JTVA 1PL8A 3S8MA 4I9HA 2YFQA 1U4OA 2O50A 2AW5A 2VYNA 3RBZA 4CMEC 1ENYA 4MOWA 2NSDA 2ZKLA 2VUSA 2AE2A 4R01A 3V1TC 4NNJA 3TOXA 5EIOA 3D5QA 3PP8A 4MJLA 3KBOA 4KWHA 1PU2A 4J2OA 3SJ7A 4BNUA 2LDXA 4YJGA 1XU9A 3BHIA 4E5NA 2VZ8A 4XGIA 1YQXA 1Z74A 1SZJG 1QORA 3C1TA 5KJEA 2FSSA 4WOJA 4YAIA 4EEZA 4CQMB 5C7LO 3O9ZA 1EE2A 1K0UA 3R3SA 5JCJD 1HDCA 1XEAA 2HRZA 3LC1O 3RC2A 2ILTA 4D43A 4DL9A 3IL2A 2ZJ0A 5IN5A 4NHEA 1DIRA 1NP3A 2JHFA 3L6OO 4UVDA 4CM8A 3GAFA 1RYEA 1ZSVA 1PWXA 4RV9A 3R6DA 3GC6A 3H2ZA 5ITVA 3F4LA 1ADBA 2OP0A 3WYEA 4GKBA 3RBXA 4EBFA 3ZWBA 2E4AA 1LLDA 2GN8A 3EHEA 2Q49A 3FPLA 3BIOA 4PG8A 5L4SA 1Z73A 1H6CA 1BSVA 2VHVA 3ANNA 4XYLA 2HMTA 3KOUA 4FS3A 5DBFA 2YQ5A 3X2FA 1PJSA 4Z3KA 5ER9A 2GN4A 1Q0QA 4E0BA 4UVIA 1HRDA 1YXMA 3ZWOA 1GV1A 3EZYA 4D0SA 3IQDB 1I3MA 4XGKA 4Y6SA 1NVMB 3RUEA 4DBZA 4BQPA 2Q4BA 3EUWA 2GRAA 1YL5A 1G0OA 3AUAA 4XR4A 3OP4A 4DIOA 4TQGA 3ZHXA 2Y05A 2NADA 3OHSX 1DIBA 2GGSA 3ROKA 4FW8A 3NTOA 4XEHA 2GNAA 3WGQA 1Y81A 1JKIA 1ISJA 2IYOA 3MZ0A 4JQCA 3TN7A 3ZU2A 3LVFO 3QY9A 3JYQA 3I4CA 4BUCA 4HBGA 4O1MA 4R4JA 3V2GA 5BSGA 3FBTA 1M67A 5DULA 4CLOB 2D59A 5A9RA 4RLSA 3KRTA 4DLAA 4BKRA 1DFIA 2BELA 1BW9B 2OMEA 3T7CA 4GI2A 1FDWA 1NX6A 5ENDA 2EG9A 2GUGA 1DJNA 4WK6A 3FTPA 4YAJA 4B8WA 3UKOA 2QRLA 3WMXA 3DQPA 1QSGA 3PGJA 3BTUA 3GVCA 1VM6A 1ZKMA 2HMVA 3SBOA 3H8VA 1XELA 4LN1A 4OYRA 1M66A 1TXGA 1U4SA 1IPFA 2TMDA 4ILKA 3DZBA 5BNIA 4BO2A 3U62A 3PIIA 4JX8A 2HK7A 4AVYA 1VKNA 3PJFA 2PD4A 3JQGB 1YJ8A 3QVSA 3KYDB 4CMCA 3OIFA 3S55A 4TRNA 4MVJP 4HX5A 4AG3A 2G0TA 1PJCA 4YQYA 1WDLA 3NT5A 3T4XA 2NM0A 4UULA 4PRLA 4AJ4A 1N5DA 4LMRA 5LCXA 1ENPA 1UP6A 2NVUB 3AJRA 1X1EA 1E3EA 4QO8A 1PZFA 2DBZA 4CLRB 4CLOA 1ONOA 2VNAA 1BDMA 1N1EA 4XIYA 1GZ3A 2PD3A 4HXYA 1QP8A 3F3SA 3RUDA 4ZD6A 1RKXA 4R69A 1B8VA 3OJLA 2YDXA 4PLFA 1RM0A 2X9NA 4BO0A 1KETA 2X5KO 4CM9A 3OQ1A 4J7UA 3ROMA 4DQUA 4GX0A 1ISMA 4MIEA 3RAJA 3BMCA 3MJCA 2I6TA 3JD2A 4XYGA 3PHJA 3GGGA 3U4IA 4GH5A 4EUFA 1ADCA 1LDYA 5T8KC 1EEHA 3U9LA 3DBHB 1DOHA 5FFFA 1P1FA 3IDSA 1ZSYA 3QWIA 4WE3A 4ZU3A 4NFSA 5JO9A 2O2YA 1PJ3A 1C0KA 2XPCA 4Q3DA 1Y5RA 4BNGA 1CERA 3HSKA 2VT2A 4DQXA 4BNWA 1HF3A 1NFFA 2QG4A 3TDKA 2P4QA 2W2LD 2EKQA 5CDUA 3OQBA 4FC6A 3PK0A 4YAKA 3Q1LA 2JFGA 4CMIA 4TVOA 3OEYA 3PFWO 4KTVE 5K1SA 3SC4A 3GMSA 2ZTLA 4BB5A 4BO1A 4Q3BA 5CPBA 2PZJA 1HT0A 1T4DA 2GO1A 4AL4A 3JD0A 4NDNE 1E7SA 3A06A 3ZWWA 1ZFNA 4JBGA 3WIEA 4FPXA 3EVNA 4WLVA 4WGGA 3ON5A 4WEOA 4A26A 2GZ2A 5JFOA 1SBYA 1D7OA 4FDAA 1EDOA 1I3LA 1VKOA 5AXAA 3OJ0A 3R1IA 5AXCA 1N8KA 3QLJA 3SXPA 3ZNNA 3AOEC 6LDHA 3U4HA 1M6WA 1NQTA 4Y6PA 1E77A 3ZW9A 1SB8A 3VDRA 3VZRA 3ICCA 4ZVVA 4GQAA 2QZZA 3F6YA 3M1AA 3OEWA 5BQFA 1LDEA 4TRJA 3DAPA 5JCJA 3P19A 2D2IA 4B8ZA 3KETA 1EQ2A 3EVTA 4CR7A 4FGSA 5BSHA 5EQDA 2HCTA 3DEYX 5JYEA 4OSOA 3OM9A 2YQ4A 5IJZA 4XZ3A 1R6DA 3HADA 3WGTA 3PJEA 1Q1NA 1R16A 4GWGA 1DHRA 2ET6A 3KEOA 2X23A 3V8BA 4EEXA 5AVOA 4RPHA 1Z75A 2P9GA 2W8ZA 2D5CA 4PLWA 5C37A 3D4OA 3DZHA 1HSZA 4AJEA 1MG0A 3GN2A 4TZTA 1LU9A 3FR7A 2D5AA 2YDYA 4RDHA 5BNFA 2Y1EA 1DXYA 1Y8RB 1LSOA 1KVRA 3ANMA 1F8GA 2B5WA 3OJFA 2FY8A 4RGBA 4RDIA 4GSLA 2E48A 3PEFA 2EGHA 1D4FA 1PS0A 1U5AA 4D45A 5TRTA 2CVOA 1DC5A 4GVXA 3ZV6A 2WDZA 1T2FA 2DUWA 2AG5A 3JQAD 4XYMA 4QSMA 4ZQBA 4CM7A 2YY7A 3UCEA 1HDRA 4JN6B 3GG9A 2WD7B 1ZEJA 1BXKA 4EJMA 5KJCA 1PS9A 2YHIA 4MVJA 1J6UA 1UR5A 1YJQA 2HJRA 3C1OA 4R1TA 4PG5A 2HMSA 1HE3A 1NFQA 1AXGA 2IDZA 4LGVA 1R0LA 3QP9A 3G49A 3IMFA 4OKIA 2B83A 1MA0A 4CMBA 3O8QB 1I01A 4NBVA 3SC6A 1OMOA 1PS8A 4WNIA 3D1LA 3DBLA 4YJFB 4GLOA 5JDCA 2PNFA 4ALLA 2Q1TA 4J91A 3ONDA 2H63A 2CY0A 5TX7A 1PQPA 4IM7A 4ZQGA 1JWBB 1K5HA 3GHYA 1QLJA 3H5AA 4LSMA 4RVHA 3ZWYA 4CODB 4E12A 3WQQA 3E48A 2Q2WA 3GGOA 7ADHA 2BGMA 4A0SA 3C8MA 1T25A 3QRWA 1J49A 5HS6A 1UUFA 4GX2A 3A1NA 2Y1CA 5I9MA 1DHTA 1P77A 1MB4A 4AJIA 3KTDA 3WBBA 2CUKA 3QWBA 3PPIA 4IZHA 4UVEA 4GLLA 1R37A 2TMGA 1LC3A 3ZWPA 3L6DA 4OMUA 1I3KA 1E0DA 3RC1A 1E7RA 4A27A 1C1DB 2P4HX 2Z5LA 2VUTA 2X7HA 4KDFA 4IS2A 4ZHSA 3K31A 1H93A 3I6IA 4ZQFA 4YJDA 2W4QA 3VHRA 2B37A 3CUKA 2B69A 3CXRA 2G76A 3JD1A 4IPTA 3WNVA 1OZAA 4BO7A 4DC1A 3W4IA 1DRVA 3K2BA 2C2XA 4CLRA 2WYWA 2PGLA 3ZW8A 1C1XA 3ZNPA 1E1NA 2C5AA 5AQ1A 1O6ZA 4XYBA 4D79A 3I9NA 2WJPA 3GFBA
chains in the Genus database with same CATH superfamily
1LH0A 1YCDA 4NZ9A 3OCWA 2Q7OE 1S2LA 3CRZA 2IU3A 1U02A 4ZA2A 2ISCA 4GOXA 3H11A 1P2GA 3KAJA 5FWDA 2IXBA 1GT91 1HQCA 2EIXA 1LXCA 2OC4A 1W1IA 3LW7A 1GZ4A 1NPDA 3Q2IA 4C6TB 1Q19A 4JENA 2WMNB 4TLEA 1BKDR 3O03A 4EAAA 4ZYXA 4BKUA 3W7AA 1GPJA 1Z6AA 4B7CA 1M5RA 1PVVA 5LYJB 4UU1A 1U9JA 3PPYA 1DBPA 2PA3A 2V55B 1AKYA 2XT6A 1W85B 3GN1A 1A2OA 4Q21A 4JH0A 4KZKA 1UDAA 1WCV1 1Z16A 2G9QA 5ELXA 1XZPA 3UAOA 1EVIA 3I3OA 5B36A 5LQJA 3WRVA 3QWHA 4XCQA 3DFMA 1DPFA 2GPTA 3DDOA 4TMZA 1AXRA 3AUYA 1L4LA 4PCLA 1TYEB 3NVMB 1PEYA 1TM1E 3H2KA 5DCLA 1M1NB 3SQXA 1DADA 2ZIGA 2J4CA 1IOWA 2QSYA 4DUGD 1D2CA 4P4LA 2HI0A 1MEOA 5IDXA 3IR5A 1L9KA 5F2OA 1DKOA 3FCOA 1LI5A 4Z0PA 5JZVA 1AZWA 2R6HA 5LMUB 2XQFA 3G0OA 3STYA 3B5EA 4Q4CA 3GJ7A 1KHHA 3I5AA 3LUBA 2BI7A 2HJSA 3O9VA 5DK4A 3OEEA 3RU9A 2AXEA 1Z37A 3OT1B 1U3CA 2OHFA 4N8EA 1DAPA 2Q62A 4DR4B 5KTSA 3Q0EA 1N2XA 5EWJA 2ATVA 5F73A 3ZQ4A 1T29A 4GPIB 1W48A 4PPFA 3N58A 4UW9A 5CTAA 1L4UA 4A0QA 1R4MA 4UDXX 1JEQA 1A5BB 3CLRC 4KIWA 4RJIA 1UBUS 5AKZA 1G21A 2HDHA 3EUFA 3ZNQA 3ZU3A 1B1CA 1LTKA 3R6GA 3VNUA 1FEZA 3LU1A 1Z4MA 4HX9A 1MC1A 5ICSA 1R64A 2HQOA 3BIFA 2YR0A 4FOSA 3BKXA 2DKFA 4LBVA 4IZOA 1E2MA 2RJOA 1XMVA 1ZOSA 4M1OA 5ER6A 1YBMA 3T3EA 4M38A 3LCCA 2I9PA 5BXYA 1L7NA 2Q50A 1YHZA 4DLYA 4I36A 4FNOA 3R8CA 2JGMA 3LGSA 4EPTA 1JE1A 1ZM9A 1E1QA 1LRLA 4WA7A 4FYPA 1W5TA 2LRHA 3C0KA 1NNEA 5HIAA 3L9XA 1OI7A 1A4IA 3DEJA 1ZMTA 1LDGA 3HKEA 1JR3E 2C8VA 2O2SA 1XPUA 2YCLA 4Z0TA 2QKYA 1FP4B 4DXDA 3FBGA 3LVRE 2KM1A 2IIPA 3MINB 4F3YA 1OJLA 4ZZIA 2BFDA 1SXQA 1TK3A 1U5BB 5K3SA 3SEFA 2WU3A 2BEVA 4FSXA 4Y1EA 1N5LA 1ZNXA 3L0IB 5CYFA 1TYZA 5BW4A 4RVFA 5AJVB 4DEXA 1E6CA 1NMXA 4HNAA 1GEEA 2AMFA 1C7EA 2I1LA 2OAEA 3SQDA 3CRVA 1YQTA 3CF0A 3U2QA 1YH3A 4MWGA 4PXYA 2O7NA 5EIXA 4XDHA 2O54A 3DYBA 4OL0A 2CVFA 2DY0A 1EUQA 3H5RA 3H99A 2N46A 2X8LA 3CBQA 3SG0A 2IH4A 1KMQA 1RBYA 2FA9A 3HCOA 2VDVE 4OBXA 2FPXA 4MK4A 2UUPA 3KU1A 1JI0A 4KIJA 2PEYA 1SEPA 1CUBA 4Q7LA 5CR9A 4LDNA 4IOKA 1WUYA 3TD9A 4QG7A 3T7EA 3BRCA 3CEAA 1FZTA 4KWEA 2EZ8A 2I1WA 1NX9A 2WFLB 1JQ5A 4QRHA 5EERA 5HIMA 4CJXA 2FWAA 2ZWOA 3BWCA 1XHEA 3P0IA 2WAMA 5K3FB 3ZY3A 3LKZA 3GEHA 4Q1FA 2VSYA 1TM7E 3W2EA 3PNVA 4B47A 3G2JA 1TJNA 1HOTA 5AVTA 2DFVA 1RPAA 4PZZA 1HG1A 1ID8A 3W4KA 2J5QA 1HETA 3MPUA 3PGA1 2O1WA 1UBHS 1GADO 3HR8A 1HMPA 1N0HA 5MF6A 1FY2A 4L4UA 5CJPA 5KOYA 2YZ7A 2WM9B 1FJGB 2B99A 2FWRA 1EWQA 1YFJA 3NTXA 4L8WB 3FFAA 1O89A 4G8DA 2P2SA 4FYKA 1JYFA 5EHNA 3ABRB 4JEHA 4ZRNA 3M6WA 3F3KA 4CMHA 4YT5A 1LBIA 3D3WA 4MR9B 4QTYA 3E18A 2BTOA 1DKUA 1E2PA 2MMGA 3UCXA 2IDMA 4E4TA 4ARZB 8MHTA 2IYPA 1CNEA 2O3RA 1ODJA 1B3BA 3BH6A 3PVSA 4B80A 1DWUA 2FX3A 1C9EA 1XTPA 4TSKA 4KQKA 3FDJA 4MVYA 1DLIA 1EE1A 2P5TB 3N6RA 4O3FA 5KDOA 4EUSA 1C9JA 3ZLTA 3WL3A 2YV4A 2PRYA 3I6QA 2JVJA 2P9TA 4NBNA 2ZJAA 1JU9A 1XK6A 1KOLA 3TIFA 3FBWA 3P97A 2IKQA 3WBJA 5KHOC 4JXKA 2AF4C 4J7AA 3OFNA 1G38A 1LPNA 4TMWA 3TOSA 2VTEA 3IMCA 1GVHA 1W8DA 2CFSA 2LCFA 3B6EA 4HNSA 4E51A 2DR2A 3V8MA 2C9BA 3LV8A 2BH2A 4CMAA 4YPFA 3D3WB 2NYUA 3A0RB 2ZT6A 2HHAA 3M7IA 1POWA 2O52A 3OZXA 4HEA1 1Q74A 3MJFA 4NAVA 4XQEA 5IXJA 4NTZA 3WOHA 1T43A 3S2ZA 1MH1A 2J4DA 1LLCA 3R0QA 2DPXA 2CMDA 1RC1A 1C1XB 1HWYA 2ZW9A 5JV5A 4L8VA 3ZJVA 1QIMA 2QTLA 2VSXA 5A3VA 4EGSA 2PZEA 3IEMA 1GTVA 3TPCA 3QSYA 2DTDA 5ALYA 1HLGA 3QKWA 4MQFB 2GEFA 4WFKA 1EJ0A 2OYRA 3GA7A 3HDJA 4BBAA 2DT8A 1Z35A 4YR7A 4AY6A 2H1RA 3GZNB 1I6KA 1XJ5A 3DSRA 1P9NA 4I5DA 3E5HA 1PBTA 1QX3A 1JQKA 3I09A 3ACCA 1LA2A 2R8PA 3L7YA 4KUHA 1NQAO 2P40A 3MQ2A 3IOEA 1Q6ZA 1VJDA 4QGGA 4YLEA 3W6NA 3K9QO 1SKYE 1DWOA 2AFHB 4HS4A 1DKPA 3H5VA 3Q9NA 1JFSA 4TZ6A 2K2QB 2DCUA 1N8NA 4JYCA 1FOEB 3RROA 1J8VA 1GAXA 1UOOA 3JASA 1II0A 2PYZA 4Q4HB 4FZ5A 3WRYC 1NN5A 4U63A 4X45A 3DBRB 4Y9SA 5TIIA 1AKMA 1ZMRA 4D3ZA 5F51A 1EUCA 3F5SA 3FUCA 3IQEA 3T9FA 4BMVA 4BKPA 2Q3DA 3FHOA 3P4XA 4FYVA 3QX9A 2DH6A 2X40A 4GPEA 4WA8A 4ZT2A 2JA1A 2XB9A 2Y1DA 3EGVA 4F72A 2AXQA 4PS1A 3H5IA 3D9QX 3IDOA 4ES6A 1IUKA 1UJCA 2OHIA 3QVVA 4W8HA 4EAQA 4YCLA 5IFLA 3FWHA 2PKWA 1T9AA 4J0IA 2XUHA 4OL9A 4TWRA 5KBYA 1CQWA 2HU2A 5FR1A 1J0CA 1N9KA 4N82A 1YBFA 3CT6A 5A2QA 2F17A 1TUBA 1IEXA 3AF3A 3ZV4A 5AW1A 2OHOA 4X00A 1MO6A 3UG7A 3UW1A 4MGHA 1O95A 2FG6C 2A5FA 3A3NA 2W6MA 3WGKA 5KOHB 4U3JB 5JE8A 2XBUA 1KPGA 1NHGA 2QR2A 2BPOA 5FLXA 2NU8A 3BEDA 1FA9A 2CLDX 3WFIA 1SD2A 1KDYA 1CD5A 1JWLA 2DBRA 4OK3A 1I5OA 2WIAA 1A9TA 1KK2A 3N2KB 1AUOA 3Q6MA 1CS0B 5FO0A 1CR1A 3OFND 2GM4A 1Z06A 2B3TA 1GQSA 1S8OA 2H11A 2HCFA 1Z25A 1JFRA 4CV0A 4ZWNA 4FYIA 2D7CA 1WDMA 2HIHA 3IHKA 4AZWA 4ENSA 2XAUA 2QRGA 3AY6A 2D3TA 2LBPA 2P6MA 3EF0A 2RG7A 1JEQB 1UP7A 2XMRA 1Y6GA 5B64A 1R4MB 1TQ4A 2VRCA 4CEJA 2EWWA 2R6FA 4KREA 5HQTA 3F97A 2XHZA 4L78A 4Z8XA 3ZCRA 3R0XA 2JKZA 2PX8A 1NBMA 1DKNA 3PHGA 1IUPA 3ZDBA 5SY6A 5AVQA 2ZYDA 1XWWA 2C8LA 3B70A 4HGOA 4L75A 1O94A 4P32A 1VJ5A 4YHBA 5HF9A 4KR9A 5JRDS 2DH5A 2YC4C 1M2OA 3D2BA 3OZEA 2C82A 2VZ0A 4FYJA 4M8KA 4OHMA 4YYZA 5DNDA 5I7SA 5KYNA 1Y8ZA 1P62B 2IUYA 4R2XA 4GRIA 3ONFA 5IBPA 3VJLA 4Z3DA 4F3CA 4RTRA 3EGXB 1GNVA 4ID3A 5JH7B 1LNQA 3KQKA 2R2GA 1C4KA 1N0IA 3ENQA 3WLIA 2BONA 4WZBE 1OILA 1WSBA 1MC4A 2OCYC 4JXXA 1CP2A 3OTGA 5IDYA 1I2BA 1SG6A 3CCCA 3LMKA 2A30A 4MLPA 1ULZA 4CM8B 5I7EA 3ANYB 2O14A 2V7TA 3BJRA 3N70A 4RNCA 5IVKA 2VH2A 1NR1A 5K8CA 2O2ZA 1XHLA 2PS1A 2XMGA 3NBYC 2NUTA 1J4AA 1PUXA 3R7LA 5K8UA 4M9XA 3F73A 3T94A 3SBXA 4NJMA 4HY3A 2L17A 1NLYA 4CCWA 2PVPA 5D1HA 1DAFA 3MUEA 3BRWD 3MXTA 4J0HA 1ZNQO 2J0UA 4X6XA 3UMCA 4DJTA 4HMPA 4ERXA 5B6JA 1OD6A 2DY1A 1PR6A 3DUWA 1GPNA 1HT1E 3KTAA 4I99A 4EZEA 4O4HF 3C8UA 3EFOB 5E8JA 2P79A 1PNTA 1PKXA 1J0AA 4BXOA 2XYHA 1E9RA 3QTBA 4HKTA 5ALWA 2WU4A 1KH1A 4Y1RA 5DN6A 3WJ7A 4FM9A 3C97A 1F8FA 1QHSA 4Q02A 1QYDA 1INLA 1Y89A 3Q0IA 3EWAA 2GN1A 3MEQA 6PFKA 1M74A 2QUBA 2C2HA 1Z28A 4AJOA 2B9VA 2ZB4A 3PS9A 1RWVA 2GEUA 5AOAA 2I9KA 1JKFA 4BYGA 4Q3AA 1YSCA 2NZ2A 3RNOA 2GFQA 3WE7A 1KO4A 1GY8A 9ATCA 3LK6A 5JCXA 1AF7A 2JCVA 4FIZA 4B4WA 4M0UA 4TWJA 1XNJA 5L9AA 1C4WA 3M3DA 1FQJA 5FX2A 1SZPA 4HN2A 2GJSA 3PC7A 2I2XB 1LRJA 2JGDA 1H65A 3HYCA 5TJ9A 1FU4A 3AO0B 1H42A 1E1CB 2WF7A 5TV2A 3R7SA 1X7DA 3SK0A 5F77A 4M8SA 3KLOA 2Q6VA 4RK0A 1P61B 1VXOA 2R60A 3OTOB 1CVLA 1EWRA 1WUJS 3A37A 2WHPB 3EVFA 2YFKA 4AUKA 3K73O 4QPCA 1MEEA 4YCMA 2C20A 3M81A 1T24A 4GR4A 1SWWA 1Q7EA 3G7NA 3QVKA 1NJSA 2VRBA 5EZYA 4RL6A 4KUGA 1PTJA 2W6OA 3D6JA 1P7WA 2BH9A 1IJKA 3LDHA 1WHTA 4GOMD 4Z0NA 3TSCA 4BGEA 2XDWA 3B1ZA 3BDAA 2C7QA 1SXJE 4K9OA 4RTLA 4MA0A 2DB3A 3AQIA 1QIEA 4BFUA 4KLCA 1T36B 4FCCA 5ALHA 2IOFK 4KWTA 1AZSC 3ZWVA 2WNSA 3UH1A 1BCRB 1AB6A 3VDMA 1IQ0A 2H06A 4N4AA 2JLYA 1R8YA 5HNKA 2HA2A 4V0ME 4RQTA 1GA1A 3AGPA 4JL8A 1T1SA 3KC2A 2EVWX 2H1LA 2NT3A 3QVWA 4YREA 2HPVA 2WIDA 3GP3A 3HMKA 3K6SB 2ZS8A 1QAQA 1Y37A 3TLZA 4EG7A 3JZDA 1QIDA 2HJWA 4UHDA 3UUGA 3L92A 4UNSA 2XUFA 3OFSA 1KTVA 3IRUA 4ZI3A 5HR5A 5FUQA 3RVRA 2O6HA 4QARA 2GVDC 4Z7NB 1UDRA 4V03A 2ATXA 2XZTA 4HHEA 3RTAA 1U8YA 4HT3B 1OYOA 5JNLA 4OHFA 3COYA 1G9SA 2WUVA 1C3OA 1P6UA 1BA3A 4O08A 5CTJA 2XUQA 1SK8A 5I9LA 5E8RA 3AUUA 5DASA 3WLMA 3IFSA 4RETA 3QXHA 1GIAA 2CV0A 5GIOE 3QOXA 3PX3A 4NR0A 2JBHA 4RSMA 1EFPB 4TLDA 1Y33E 3N53A 3FTEA 2C4NA 5E1BA 2JANA 1X1DA 3ABZA 1D8TA 4HNGA 2Q27A 2QZSA 3DDNA 4PIPA 1H8HA 3JQDA 4GEKA 1G5HA 3LY8A 2HRQA 4CNBA 2H59A 5F78A 3G8CA 3C3CA 3CS3A 2ZT8A 4BJ1A 4E2ZA 2DPMA 2GM5A 1UPXA 2RHBA 1TK2A 3N39C 4I1OA 5FYDA 3QELA 4ECEA 3T06B 4BLQA 5ALFA 3BILA 2OV4A 4WCDA 4PN7A 4FCWA 3H9JA 4EJSC 5ALVA 3NPAA 3N8HA 1NMYA 4HFNA 3VR5A 4J94A 2HF9A 1G3IA 3DB1A 1PV2A 4IHAA 2MSLA 4P3NA 4MMYB 1XPOA 4UKDA 1EYZA 1J0BA 2ZBVA 4IDPA 4IWNA 4MXDA 1K7CA 3U44A 2GVZC 3Q9UA 3HP1A 2XWBF 2KMLA 3T1OA 4NHOA 2F3RA 1U6IA 4AY4A 4EY5A 4FLFA 1G98A 4J0KA 2VDKB 1V1RA 4P7KA 4XJVA 2AEEA 4KSYA 4BVFA 4R3UC 3U4DA 3QEMA 1TIPA 2UYYA 4LKOA 3Q9SA 4GNKA 5LWHA 1Z8DA 3KYCB 4N3AA 1VMIA 4ZO7A 1CEXA 5JPCA 1ISPA 5J2TA 1LPBB 2N75A 3I5XA 5CFPA 1P39A 3SICE 3QMMA 2C78A 4WK0B 5JNVA 3AW8A 1VRVA 3ZV5A 2NXWA 1ACLA 2H9YA 2VPZA 2Y1XA 5AK4A 1GPDG 1U0TA 3IT0A 3DVAB 3HE3A 4DPKA 5LMCA 1RJWA 1DP4A 1T8PA 4INAA 1SU8A 2GOYA 3CO0S 1PFWA 4HYTA 1QV9A 4M9SA 5EZSA 1ORVA 3UCFA 2NSJA 5ICFA 2OT3B 3UXEA 3ZBTA 1MBZA 4OHBA 4KHPB 1USVA 2SHKA 2NV0A 4EYQA 1MIOB 4CR8A 1OR8A 1M1XB 1P73A 4PLCA 1CDZA 3M4NA 1ZCFA 3AC0A 1YZQA 4XX0A 1X7XB 2ZIVB 3EF3A 1OAKA 1LFDB 2ZAYA 4TTIA 3WMGA 2CLOB 4B35A 2VQDA 2CMGA 5F12A 2QDKA 3RSHA 2JGFA 3ZJ5A 5B7GA 2B5OA 1DO0A 1JG1A 1QE3A 2ORVA 1USWA 2I6XA 2KPOA 5DRTA 3WL5A 4ZZ2A 4AMUA 2PK3A 3SKXA 4BV3A 2ERYA 5EWMA 3V80A 4ZCTA 5LP1A 1NAHA 2AWNA 1KQGA 2H9IA 1ZBQA 4XSGA 3R41A 5ERXA 3G5TA 5KVAA 3EIXA 2E4YA 4NYMR 4F9TA 1HE8B 1ODIA 4P31A 2NU7B 2AOXA 1N2CA 4QJ4A 4KP7A 1V5IA 4BO4A 1JMVA 3KU4A 4JQOA 3S2SA 4D4IA 1S0UA 3KB6A 4DARA 3AU9A 5KI6A 4P92A 2P65A 2ZJ2A 4C7MA 2QD4A 2HLNA 1W4ZA 4CTKA 3EXHA 5ILGA 2NMVA 1N5MA 2PTGA 3WHIA 1WB4A 5CM8B 1PHRA 1UXGA 2E7ZA 1UDXA 3OF5A 3QOFA 4FFSA 5IFKA 3BSWA 3HEAA 3LSYA 4QBGB 4NU5A 5JASA 1M8GA 2XNSA 4KUEA 5KX5F 1VBFA 5LQKA 4KRYA 4QDKA 2ZBDA 1P2DA 1SM4A 5CBPB 1ZRMA 4G3XA 3OZGA 4QUEA 1FVOA 5JBIA 2ZUTA 2CXHA 2ZDGA 3ZLVA 4OAPA 5AW2A 1ZWKA 1DO2A 3P26A 1A96A 4BFCA 4CF4A 4FFRA 1K6JA 1OV4A 3ENZA 3VKGA 1HUQA 5CNJA 1XZCA 2EKZA 3C7KA 3E7WA 4BNLA 3LP5A 3K8QA 4UMDA 1EVYA 4QODA 3GLVA 1NVGA 3U09A 3HVIA 2CNBA 3P9KA 4XW2A 4YWJA 3LZCA 1N6IA 3EQ8A 4IKEA 5C34B 3EQ6A 3VO2A 1ZLXA 4Q15A 2WG0A 4RF3A 5DXFA 1AIPA 1HEYA 1Q7BA 2VBGA 2C58A 4BATA 5ELLA 2QTVA 1YZGA 1QV6A 1Z0ZA 2BFEB 3K4PA 3SQMA 2IZOA 4JT2A 4DCPA 4WJLA 1X92A 4Q3EA 4ZAYA 2ZB3A 4HB3A 4R9UC 1YQQA 2HLHA 1Q22A 3AUJB 4KQ2A 5IT4A 2XYVA 2FI1A 3KT0A 4IEEA 1R10A 4MP6A 1RWPA 5IZCC 3NNDA 2C1EA 2ZSAA 1FXWA 2N47A 2DFLA 4MEJA 4NPAA 4R8KA 5FWNA 2GJAA 3U4CA 2B4RO 2VPIA 3MCVA 1JAYA 4PC2A 2V0GA 2IZ1A 3H7IA 1RS0A 4JC8A 2KW5A 2R1TB 1U0NA 4HUJA 2WBLC 1PDWA 4MVJM 3IEPA 5DWDA 3V1LA 1IIBA 2ZQZA 3WLAA 1VKRA 2X9QA 2G1AA 2VSQA 3NWBA 4JLUA 4BMSA 4OQ4A 3R3VA 1QGOA 3TOVA 5ESXA 1R74A 1F20A 2Q3HA 1L7RA 3TAHA 5IAGA 4C04A 4C7OA 2SKCA 1YDEA 2UU9B 5FDFA 3EOZA 1K6MA 2JD1A 4RJLA 4E13A 2FOXA 1D4ZA 1ZW1A 2OG1A 2OQ2A 2OM2A 4PU0A 3VHXB 1P6XA 1TLFA 3VFDA 1Z13A 1Y9EA 1YZVA 1XFDA 4EG5A 3WL4A 1RYFA 4LXGA 2YFHA 4WHMA 3V33A 2VA9A 4B3DA 3L3BA 2Q5JA 1DX4A 5H4HA 1A72A 1E4VA 4IIJB 1OFVA 3OFJA 3AB8A 4CKBB 4BNMA 1M7GA 4KYUA 1IBCA 2Q4TA 5ALZA 3KOOA 4UCXA 3RUFA 4EO4A 4H6WA 1XT6A 4RVUA 4K1XA 2P9HA 4UNNA 5DFAA 3WL8A 3RAEC 1RKBA 4CLHA 3RKUA 4P84A 4NCNA 3RT7A 4RKFA 4G86A 3M6LA 3UAVA 2BEKA 3IKJA 2P3LA 2EX4A 1H4SA 1JMKC 4MKGA 4QX6A 4A5OA 2GFIA 1G7TA 2RGRA 3VR2D 5H5JA 3O26A 4MUHA 2WHRA 3H2GA 3IV7A 5B58T 4CM9D 4IXMA 1S2GA 2PO7A 4KFUA 4ACBA 2CSXA 2IGTA 1VECA 2ZUBA 3KSUA 1VPDA 4BASA 2YW2A 4HPWA 4M83A 1OF1A 1V7QA 3H97A 1X7ZB 4D9HA 1V8FA 1L5VA 3I12A 3LGXA 3AVQA 1U1FA 3K1ZA 4I4LA 4TT8A 1IJFA 1H6BA 2B5VA 4OIMA 4B2IA 3RRMA 2W6IA 1K7FB 2A4KA 3GRPA 3I1JA 3K4QA 3R7NA 5JSHA 5F1PA 1CS4C 2WJ4A 3MELA 4LZJA 2C42A 3FVWA 3W9YA 2M1XA 1ADYA 3Q1KA 4M37A 1EFRD 1XGKA 1RRFA 1XNRB 1XB2A 4FBGA 4IVRA 4CDGA 1U2EA 2DUJA 5F2KA 3BMNA 3E0XA 3DBVO 3JQ7B 3FHLA 2ZYUX 3F1KA 4M89A 4NFHA 3VO9A 1O5OA 3CRQA 3HB1A 4LHVA 3WSWA 5KOIA 1GL6A 1E8MA 3NEPX 1XQWA 3I9FA 3WC4A 1ZD5A 1WMFA 4ZT4A 1W30A 4DABA 1VBNA 4YJ2F 2R1VA 3D8TA 4CHGA 1GDHA 3HCAA 1ISSA 1IWBB 3FIUA 4TT3D 4B74A 1Z12A 2D54A 2XGGA 4K9KA 2XEXA 2W71A 3AU8A 4HWKA 3MWEA 4N0QA 4UUOA 4WOBA 1GLVA 4V0OA 1T2EA 2R97A 5EZ5A 3L01A 4N7JA 3GJXC 2BAGA 3L7LA 1GG8A 3ORYA 4I1SA 5T6MA 1XROA 2VK2A 3ETCA 3GCWA 3H9BA 1WBJB 4NNOA 4QO7A 3NVKI 2GX6A 1DQPA 3EZ9A 1BE1A 5FPSA 3PYMA 3KVNA 4LVCA 4RANA 5BNZA 3JWJA 2OGUA 3BHJA 4A5SA 4DB2A 1GCAA 1PHPA 4LZWA 4HGZA 1UKAA 2C7VA 2R8YA 2VEDA 3AI3A 3MWJA 2VOEA 5HKAA 3N0WA 1IM5A 1SIBE 3PT9A 2Q1UA 4HWSA 2WIFA 3QTTA 4MKRA 2F8MA 4CN8A 4HTFB 3EH1A 4LHXA 4C4TA 4RK4A 1X15A 2JCBA 2JIBA 1YRHA 4GE3A 3M6IA 4MRVA 1TVEA 2V7BA 3U80A 1V6AA 3I30X 4PBTA 2C5LA 3R7BA 2HPHA 1PWYE 1MKYA 2IHUA 3RFTA 1T5BA 1Q57A 2CLIB 2FN8A 1QZ3A 2QAGB 3MTGA 4S1PA 3MWGA 3RIEA 3A6EA 3E5RA 5ECDA 3ZGYA 4LF6B 3A3YA 3MC1A 4MINA 4CIBA 2DPHA 4Z4HA 5K0EA 2QD1A 4REOA 3EZGA 3LECA 2QTCA 3WKAA 1XZQA 1NN3A 1UL1X 3OZBA 4QXAA 4D4HA 1K5PA 2WK1A 1US8A 4FNMA 4RTQA 2FR1A 3DF7A 2RSLA 2CNKA 3H5WA 5F35A 5FLKA 4UE6A 2G7ZA 2PLNA 2P4SA 4TL8A 4DCCA 1MP0A 1CUSA 3SYMA 3C6KA 4YRCA 3PEVA 5DLEA 3NEJA 4KGZA 3GRRA 5ECGC 1NWHA 2GSDA 1QONA 3BRWA 1CT9A 5I9NA 2R87A 3PRJA 1RYYA 2C04A 3EASA 1D1PA 1WAMA 3ZWDA 1FTSA 3OE7A 1JDVA 1JE0A 3FFXA 3GJ6A 4KKVA 4KYIB 1C29B 2QTAA 1DUSA 2RKOA 3AESA 3ENKA 3FTDA 3JQ6A 4CM4B 5HJEA 5LOVA 1I51A 5MGBA 2WYVA 3FGNA 4P36A 3PF8A 5TQVA 1ZD1A 2RB5A 2H31A 4KO3S 4WKNA 5CEEA 4KR6A 1P7VA 1T8YA 3CUTA 3T5GA 4CM4A 1XRNA 1P2UA 5LOVB 4DCOA 5ICGA 3HG7A 1QHHA 3DQQA 4BNHA 5FA6A 2CV2A 4WACA 4GPD1 4TQAA 4K3VA 5DBOA 4B5LA 5JAMA 5LKRA 3U16A 2ZYIA 3ETGA 4RM3A 5E1MA 1JHAA 1QH8A 2ZJFA 1JEJA 1XJCA 2NX2A 3FTNA 4ZV7A 3MOGA 4M6WA 5HFJA 1WY5A 3SFTA 3V3KA 3RD5A 1Z26A 1ZW6A 2I2AA 3G2LA 2IX3A 1DRWA 1T4BA 4S12A 2A1UB 2Z58A 3G2IA 3L6EA 3W6ZA 3LY7A 2IY8A 2OORA 2XGOA 3I5MA 4HVTA 4PRKA 1CNFA 3FY4A 4UD6A 1N2EA 3B1JA 4OUDB 4EG1A 1PFYA 3SSAA 3GEMA 1GR0A 1SGWA 4LVOA 2NUAA 2GLXA 4W1PA 3OX3A 5J2UA 4EG0A 4HNUA 1XAJA 2B6NA 3HLTA 3FJYA 4U7TB 3AFMA 5THKA 1MV5A 3EQ7A 3K0KA 5EI5A 4LJAA 1DT5A 2LZ0A 5JJBA 2XXBA 1ZGBA 1C9NA 5AVXA 3W34A 3MTEA 1QC5B 4YLYA 1T2NA 1VIYA 2EJTA 3OQOA 1WZ2A 3I2JA 4N0DA 2ZJ5A 4A7PA 5BR1A 2NVOA 3GLIA 3V6MA 4X9XA 2QX8A 1WXEA 3DZJA 3HN6A 1DUVG 4Y67A 5DTJA 4WBNF 3ULKA 4OM7A 5DBEX 4KPUB 4F9FA 1UIRA 4OXXA 2ZWPA 5LP6B 3GLFA 1A27A 1RWXA 1EFRA 4JI8B 4QRIA 4P5PA 4QHTA 4DV4B 1LF5A 3IV6A 4II3A 3RUCA 3W2TA 3HUEA 3DFUA 5C81A 1ODCA 1A8UA 2JAWA 4ZOQI 1AUPA 3DNMA 5ISMA 1RPJA 1L8LA 2OB1A 3FAZA 2Z2IA 1G42A 4O4LB 2B4QA 4F4DA 3TEMA 4ZCPA 4A15A 4IEFB 4QUDA 2ACWA 3L82B 1K08A 3WP0A 4COKA 4HX2A 2HRCA 3NTUA 3AG6A 3AL3A 3OQIB 3HRIA 1M33A 5FAXA 1Q15A 4DM4A 2PH5A 3GUHA 3LUDA 3I1IA 3IUMA 5LYYA 4GKKB 5KYXA 2A0UA 4JLKA 5FRDA 1CZNA 2WA1A 1UJNA 3E9RA 1GWNA 1TVCA 1ZUNB 2GBGA 2GT1A 2EYQA 3ESZA 3Q7SA 4MEAA 5JWHA 3JALA 4F1JA 3INGA 4JS0A 1B7GO 1CR4A 121PA 3AIOA 3B51X 3CKLA 4IH1A 4XRRA 9LDBA 3LQ1A 4BVAA 4UFPA 3A14A 3P9ZA 1RT9A 1FMJA 2I4IA 4JOSA 2YJ6A 4HNHA 4M1WA 2ZJ6A 1JNYA 1TCCA 3LF2A 3GGJA 1DGQA 1OVGA 2QN6A 3I6BA 4XB2A 3GT4A 4MZDA 3BTVA 2OSVA 3KUXA 4GP7A 3AP2A 5EP2A 1UKVY 3VZSA 4F85A 1V11B 5BN5A 2VWQA 2IZZA 5CGQB 2W2TA 4WNYA 4ZVNA 5TNXA 2WHPA 3SPXA 4A03A 3T9AA 2QX6A 4QAJA 1L5FA 4KL8S 3O3MB 3QQPA 3KZ1E 4TXHA 3N2IA 2FF5A 3I9KA 5TF4A 2X7XA 4ENRA 1L5KA 1RZRA 3V4VB 1UMDB 2V54A 4JA0A 1JZSA 1VHQA 1K68A 3DGFC 1Z2AA 4I9UA 4RPIA 4M9ZA 2BMAA 4A0GA 1TPZA 2R7LA 2E49A 5FTWA 3N07A 4FEAA 1QGUA 3DV0A 4ZJUA 2EBHX 4HSGA 4I4CA 3FDZA 2DUNA 1H94A 1H2RS 3VSBA 3W5BA 3RYHB 2IELA 3I4LA 2XVZA 3MG9A 4DC9A 1QQTA 1YOBA 2NGRA 5LDDC 3CZMA 1GFZA 3AHCA 2EAUA 2B30A 2CVQA 4WZZA 1KY2A 3ZXXA 3OM1A 2BEUB 2EF0A 3LRPA 1CIPA 3ND9A 2OGWA 1YJAA 2FGJA 2IW3A 3DXYA 1S3SA 4YJ3B 2QTTA 4ARVA 3CLTD 2W2KA 1W96A 2Q5EA 1V37A 2OC9A 4QFCA 3IIEA 5GAJA 3DC7A 2DSTA 2GF9A 1ESNA 1R6BX 3IXLA 1B76A 4LK3A 1FQOA 1OB2A 3SQNA 5K05A 1TNDA 3L0CA 3TQHA 4KQ9A 1OFUA 2PL3A 3PWZA 4B3CA 4BVEA 4YMHA 1PF7E 2GYYA 1JI3A 4L73A 4JI4B 3ZTWA 1CLEA 1F6BA 3P9SA 2IOHA 4YACA 3KXKA 1MN6A 1RQXA 3U3OA 5FWYB 4XQ0A 1RJFA 1XTBA 5AJZA 2QWXA 2WFZA 2Q1WA 2AZDA 2HCRA 3MFYA 2RD2A 4M9CA 2Z98A 3HR7A 3TTWA 3OPXA 1SEVA 2WIJA 4R31A 1S8AA 4R1LA 4WCVA 5D5PA 4ALJA 5EJIA 3VC7A 4QG3A 3DLBA 1YZKA 2JGNA 2PKQO 4QYIA 1EGMB 3WDMA 1SC9A 4YUZA 5F21A 5AHKA 1W44A 1IK4A 4G0VA 3G0DA 2QX4A 2ZGVA 2E6KA 2JAUA 2XY4A 3GH3A 2DETA 2ZCVA 1M83A 1VSUA 4YV7A 3SYRA 2QNBA 4DLVA 5B6IA 2C4MA 1JIUA 1UMBA 5TY0A 4EPRA 2O4UX 2VATA 1YWGO 4UUNA 5KREA 3EGIA 5DF1A 4YP1A 3RYFB 4RTPA 1DAGA 2FZCA 3KKMA 4XSHA 4WXYB 3KR9A 1JHUA 2XTNA 3KDAA 4ZU6X 3D6HA 1X80A 4P3XA 5DTQA 1AOXA 1XLTA 3TQOA 2WZCA 1CB7A 5ENVA 3H1PA 1PLKA 1RI3A 3C3KA 2P9YA 4RV5A 4N18A 2MYUA 1RHUA 1B43A 4TSFA 4R9RA 4XH9B 1Q7RA 5E7JA 2FWMX 5CXUA 3HBFA 5EJEA 1SVWA 4HP8A 1ISGA 1CEYA 2E2WA 4IQGA 5EXTA 2H48A 4Z4FA 3G0GA 1RYHA 3AR5A 4N41A 1N5IA 1OLOA 1OVMA 1WSDA 2PBZA 2D62A 2JAQA 2RAFA 2W4MA 1K3TA 3OZTA 4JBHA 4JEMA 4WN9B 2I87A 4XOUA 5FUWA 3AEYA 5FI3A 5EMLA 2H7YA 3MW8A 5CHEA 5EMJA 3LI2A 4KE8A 4DSNA 3U7GA 4N0EA 3SOZA 4EYKA 4EYSA 5IJWA 1AQIA 3BXXA 1AC5A 5LLSA 4GYJA 2ZZKA 4Q3LA 2QE7D 4UARA 4D82A 1FRZA 1Z82A 4B7UA 2LNDA 2EBUA 3NRBA 3HRKA 4XFJA 1PWEA 1KZ7B 3EFHA 2AL7A 2OO7A 3B7WA 2YMMA 5DTEA 3RK1A 2C2MA 3NASA 3P0EA 1NRWA 4Q4JB 4EHIA 3UA3A 4EMSA 1N5JA 2BUCA 4UCWA 3UKJA 2R79A 2VDJA 1FSFA 5KVVA 4MCIA 3V46A 3QX3A 4WCFB 4QJIA 1QFYA 3LW8A 1W5FA 2GS9A 4JLOA 4EB0A 2B3DA 3FAKA 1DO8A 1VIMA 2HWWA 3NDIA 2FEPA 1DG3A 2P0AA 3KWJA 4ALMA 1OLUB 2XRYA 3HI4A 3LUFA 4QOHA 5H81A 4IH4A 5JZSA 4XWYA 5AJTA 4CL2A 2VJKA 3HBLA 2ORED 1YBHA 3CVOA 5FQOA 2ZBPA 1S96A 1UOPA 1VE3A 1L1QA 1YASA 1KYYA 3NS7A 1P9RA 3GJZA 1YCHA 2H2IA 3R44A 1S6YA 4LWPA 3UA4A 1VPEA 2WV7A 4NBTA 4BBJA 1L3IA 5HILA 4D96A 3WX0A 2O5CA 4AG6A 3HDQA 4I5IA 2ZRDA 1CJSA 3B85A 4BV8A 2Z1MA 4KN5A 3P71T 5KQRA 1RACA 3FOZA 4UOQA 5BQXA 4IVQA 2RH9B 1UIMA 1T6BY 5CLGA 1CX9B 3AHGA 3U4AA 3AJ9A 2P9EA 3FPJA 3MFQA 4W63A 4C30A 4DNXA 1DTWA 1OXVA 1YHNA 2NV2B 2ZJBA 3QF7A 4J4TA 1GL9B 1J2JA 1QWSA 1QNLA 1XG5A 4YROA 4MUGA 1IG0A 3KR1A 4L9WA 4QUIA 2C4VA 3DHWC 1IOVA 3CNNA 4K9SA 5BVHA 2CDCA 4FGWA 4QM7A 1MOPA 3OZFA 2XCOA 3GQBB 4EO9A 5K0BA 4IQFA 3IV9A 3OZ7A 3WR5A 5LZ2A 3FGZA 2OYCA 3IPXA 3K30A 1QO9A 4IUCS 4IHJF 2FH5B 3NBZC 2CXUA 2V7EA 4O8ZA 2ANCA 3ID6C 3MAGA 4QUJA 3PFGA 5CXQA 4G1MB 5BWOA 4DLKA 5MN5A 1DBWA 4ZJPA 2B1RA 4MHSA 2CBGA 5KX5B 4NBWA 3RRXA 2R25B 2C88A 2O3JA 4E5UA 2JIZD 4YP6A 1ETHA 1KFKB 2BGGA 4N47A 4JI6B 1P1JA 1YR1A 1I13A 5AJWA 3REOA 3ZS8A 3AVYA 5T5QA 4RLHA 1NVKA 4AZTA 4Q3CA 4Y2VA 3HUDA 5GOZA 1WX1A 2AN3A 2WKWA 4C4SA 2VF4X 1PR1A 3G2MA 3KVRA 4QUGA 5A3RA 1PV4A 4JT8A 4DZTA 1PG5A 1G5PA 1ZUWA 3W6OA 5BV0A 2Q99A 4Q34A 1BHQ1 3UT5B 3LE8A 2VN8A 4LNUA 2VF7A 4ZHQF 1K4YA 2P2CA 2CLLB 4TLCA 5TMDA 4D8WA 4IJUA 2BJVA 1H4VB 1OAOA 2DPYA 2LKDA 4RJKA 3INNA 4UFOA 4IGAA 2QM8A 1CRZA 3WYGA 1RCTE 1JHXA 1ETUA 5JS8A 5EUMA 1C7RA 5IBCA 1NXVA 4DV6B 1N3BA 4G85A 4E1AA 4JC5A 1NL3A 3TD6A 1UPAA 1KP2A 3STWA 4PV7A 2PUHA 3QLUC 1NPTO 4UEOA 5I7HA 2XKJE 2PXAA 1KQPA 2AE1A 2Y0DA 3AWDA 2RC5A 1B3RA 1WW8A 3VU9A 5GZ6A 3W9SA 1N2IA 2GK6A 2WR8A 3SIRA 5TJHA 4ZIRB 4BNVA 1FLAA 1XI2A 4I8IA 5CLHA 6GPBA 3QW2A 4DADA 4GQBA 3A1DA 4UAVA 5LB4A 3CLUC 1YZTA 1KC3A 4YDSA 3M4XA 1WMBA 2P91A 3PGXA 5JCZA 4DA4A 5JJ5A 2VT3A 1AS0A 3DOHA 1OC4A 2G36A 4EW3A 2PSEA 5JNUA 4IGKA 4TVKA 2WKQA 5EKXA 1KF0A 4A1OA 5DN9A 2I80A 4C9BA 2EV9A 4TVSA 2OV1A 3OLCX 5DYNA 3I5YA 3CNHA 2GJ8A 3HKDB 4DT1A 4O0LA 2J08A 4QYMA 4RZ3A 4BN0A 1IY2A 2J31A 5LQCA 3Q7IA 2ZQYA 1GZSA 3SLKA 1Z0DA 1B00A 1JDZA 1EX1A 1YB1A 1JKJB 1WA5A 1Z2PX 4Q4AB 1XMSA 4P7BA 5E9WA 1GPBA 3AJ8A 1KAHA 4OXKA 1BS1A 3EZFA 4RX1A 1C1DA 1QP4A 1Q0HA 2XYRA 1U1IA 5F3RA 3LBIA 2OG2A 3HV0A 3U0BA 4I8DA 4AYTA 4L8GA 4MI3A 1UXHA 1NJ6A 2A6PA 3LXXA 3EEBA 2HSJA 2C29D 3DEKA 4PY2A 2MSNA 2BFBA 4MVJG 2WA2A 2YJ5A 2LKCA 4JKIA 5B2FA 2PAAA 1XZMA 4QOSA 5H59A 3SMVA 5K3OA 1E6KA 4U6NA 1ZD4A 4LY9A 4BY9E 1NBME 1FTQA 1VJGA 4FEYA 3T3OA 2IVFA 1VBKA 3UUFA 5KQSA 1U3GA 1CQIA 5IDQA 3K9HA 4EHAA 1KIFA 3DMTA 1QHEA 2G8NA 3UAZA 1ZN8A 3RYFA 3SN6A 3D3EA 4PWYA 3SJAA 3ZGVA 3TIXB 5IX8A 5DM70 3PYLA 3S1LA 3C5HA 1V4BA 1PG0A 4M88A 3IP7A 1NQOA 2BI8A 1A5SB 4ND4A 1S7GA 2B8NA 3UWKA 4Z9XA 1RXUA 5FL3A 4TV9B 1OT5A 1ZJ6A 2O2IA 3D0OA 3GJ0A 4EUEA 3QA3E 3DGEC 1ZUNA 4Q3KA 5GV8A 3HUUA 3BXEA 5NULA 4L0CA 2QAGC 4PN3A 2OHJA 5E95A 2BBSA 4Q47A 5E4JA 4HVAA 4K6K